--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Sat Dec 10 02:22:12 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/zen2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1932.35         -1941.15
2      -1932.32         -1940.77
--------------------------------------
TOTAL    -1932.34         -1940.98
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.261397    0.000573    0.216275    0.308015    0.259909   1264.65   1332.11    1.001
r(A<->C){all}   0.132227    0.000776    0.080717    0.187850    0.130416   1038.01   1062.51    1.000
r(A<->G){all}   0.281665    0.001511    0.211156    0.360357    0.280031    994.75   1100.72    1.002
r(A<->T){all}   0.108963    0.000610    0.057919    0.154683    0.108155    926.45   1020.33    1.000
r(C<->G){all}   0.112679    0.000804    0.057744    0.165526    0.110469    962.86   1021.48    1.000
r(C<->T){all}   0.254277    0.001405    0.180870    0.328324    0.253236    951.35   1031.49    1.003
r(G<->T){all}   0.110188    0.000739    0.059244    0.161419    0.108337    781.08    923.77    1.000
pi(A){all}      0.286989    0.000231    0.257292    0.315459    0.286837   1082.90   1222.98    1.001
pi(C){all}      0.237962    0.000212    0.208125    0.265894    0.237861   1074.19   1136.36    1.000
pi(G){all}      0.217708    0.000194    0.189610    0.244662    0.217185   1174.67   1202.96    1.000
pi(T){all}      0.257342    0.000225    0.228140    0.286621    0.257060   1042.41   1081.92    1.000
alpha{1,2}      0.760251    0.194257    0.154443    1.618787    0.655520   1501.00   1501.00    1.000
alpha{3}        1.591536    0.491753    0.484521    2.884768    1.460498   1122.03   1311.51    1.000
pinvar{all}     0.094085    0.005818    0.000001    0.243325    0.075379   1125.12   1313.06    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1889.720689
Model 2: PositiveSelection	-1889.720689
Model 0: one-ratio	-1892.321075
Model 3: discrete	-1889.659973
Model 7: beta	-1889.662601
Model 8: beta&w>1	-1889.662601


Model 0 vs 1	5.200772000000143

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=252 

C1              MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
C2              MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
C3              MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
C4              MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
C5              MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
                **. ********* ****:::****::****** *:*:*:**********

C1              SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
C2              SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
C3              SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
C4              SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
C5              SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
                ** *****************:*****************************

C1              STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
C2              STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
C3              STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
C4              STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
C5              STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
                ***** .:*  *:*:. :** ***  :::*******:*..**:***.***

C1              VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
C2              VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
C3              VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
C4              DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
C5              DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
                 .  .* :*:****:*****:**:.** : : ** ***** .***: *.:

C1              EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
C2              ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
C3              ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
C4              ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
C5              ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
                *.***::*:.*:    ** *:************** ****** ****:**

C1              NF
C2              NF
C3              SF
C4              NF
C5              NF
                .*




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  252 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  252 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5040]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [5040]--->[5040]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.273 Mb, Max= 30.549 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF

FORMAT of file /tmp/tmp6929717734034497927aln Not Supported[FATAL:T-COFFEE]
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:252 S:100 BS:252
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 88.89 C1	 C2	 88.89
TOP	    1    0	 88.89 C2	 C1	 88.89
BOT	    0    2	 90.48 C1	 C3	 90.48
TOP	    2    0	 90.48 C3	 C1	 90.48
BOT	    0    3	 82.14 C1	 C4	 82.14
TOP	    3    0	 82.14 C4	 C1	 82.14
BOT	    0    4	 81.35 C1	 C5	 81.35
TOP	    4    0	 81.35 C5	 C1	 81.35
BOT	    1    2	 94.84 C2	 C3	 94.84
TOP	    2    1	 94.84 C3	 C2	 94.84
BOT	    1    3	 79.76 C2	 C4	 79.76
TOP	    3    1	 79.76 C4	 C2	 79.76
BOT	    1    4	 80.16 C2	 C5	 80.16
TOP	    4    1	 80.16 C5	 C2	 80.16
BOT	    2    3	 80.95 C3	 C4	 80.95
TOP	    3    2	 80.95 C4	 C3	 80.95
BOT	    2    4	 80.16 C3	 C5	 80.16
TOP	    4    2	 80.16 C5	 C3	 80.16
BOT	    3    4	 87.30 C4	 C5	 87.30
TOP	    4    3	 87.30 C5	 C4	 87.30
AVG	 0	 C1	  *	 85.71
AVG	 1	 C2	  *	 85.91
AVG	 2	 C3	  *	 86.61
AVG	 3	 C4	  *	 82.54
AVG	 4	 C5	  *	 82.24
TOT	 TOT	  *	 84.60
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTTTGCCATTCAAAGCGAAAACTATTTTGTGGACAATTACTCAGTCAG
C2              ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
C3              ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
C4              ATGTTTGCCTTCCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
C5              ATGTTTGCCACTCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
                ******* .:  ************************** *.*********

C1              TGATTTAATGATGTATCCTTGCGTCGAGTTAAACGTAGAAGCCGCTCCCA
C2              TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
C3              TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
C4              TGATTTTGTGATGTATCCTTGCGTGGACCTCAACGTAGAAGCAGCTCCCA
C5              TGATTTTGTGATGTATCCTTGCGTAGAGTTGAACGTAGAAGCAGCGCCCG
                ******:.****.*********** **  * *********** ** ***.

C1              CGGCAACAACAAGGTCTTCGGAGAAATCAAAGAGATCTCGCACGGCATTC
C2              TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
C3              TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
C4              TTGCATCAACAAAGTCCTCGGAGAAATCGAAGAGATCTCGCACGGCATTC
C5              TTGCTACAACAAAGTCCGCGGAGAAATCGAAGAGATCTCGCACTGCATTC
                  **::******..**  **********.*****.******** ******

C1              AGCAGTCTTCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
C2              AGTAGCCATCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
C3              AGTAGCCATCAGCTTATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
C4              AGCAGCCATCAGCTAATCGAACTTGAAAGGGAGTTCCATCTCAACAAATA
C5              AGCAGCCATCAGCTAATCGAACTCGAAAGGGAGTTCCATCTCAACAAATA
                ** ** *:******:******** **************************

C1              TTTAGCCCGAACCAGGCGAATCGAGATATCACAGCGTTTGGCACTCACAG
C2              TTTAGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
C3              TTTAGCCCGAGCCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACGG
C4              TTTAGCCCGAACCAGGCGAATCGAAATATCCCAGCGTTTAGCACTCACAG
C5              CTTGGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
                 **.******.*************.*****.********.********.*

C1              AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
C2              AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
C3              AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
C4              AGAGACAGGTTAAGATCTGGTTCCAAAATCGACGAATGAAACTCAAAAAG
C5              AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
                *******************************:**.***********.***

C1              TCGACCAATAGGAAGGGTGCCATTGGAGCGCTGACCACATCTATTCCACT
C2              TCGACCAATAGGAAAGGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
C3              TCGACCAATAGGAAATGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
C4              TCGACCAATAGGAAAGGTGCCTTTGGAGCTCCGACAACATCTATTTCGCC
C5              TCGACCAATAGGAAAGGTGCCATTGGAGCTCTCACCTCGTCTGTTTCAGC
                **************. *** *:******. *  **.:*.***.** *.  

C1              TTCTTCCCAGTCGAGCGAAGATCTTCAAAAGGACGACCAGATCGTAGAGC
C2              TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
C3              TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
C4              TTCTTCCCAATCGAGCGAAGATCTTCTGGAGAACGAGCAGATCGTGGAGC
C5              TACTTCCCAATTGAGCGAAGATCTTCTCGAGGACGAGCAGATCGTAGAGC
                *:*******.* *********** **: .**.**** ********.****

C1              GTCTCCTTCGATATGCCAACACAAATGTGGAAACAGCTCCACTCCGGCAG
C2              GCCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTGCACTCCGGCAG
C3              GTCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTCCACTCCGGCAG
C4              GCCTCCTTAAATATGCAAGCACAAATCTTGAAACAGCTCCACTGCGGCAG
C5              GCCTGCTTAAATATGTAAGCACAAATGTGGAAACAGCTCCACTGCGGCAG
                * ** ***..***** .*.******* * ********* **** ******

C1              GTTGATCACGGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
C2              GTTCATAGCAGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
C3              GTTGATCACTGTGTCCTGGAGGAGGGTCACATTACACCACCCTATCAGAG
C4              GATGATCGCGGTGTCCTACAGGATGGTCAAATTACACCACCCCATCAGAG
C5              GATGAGCGCGGTTTCCTGGCGGAGGGTCAAATTACACCACCCCATCAGAG
                *:* * ..* ** ****. .*** *****.************ *******

C1              CTACGATTACCTCCATGAATTTTCTCCTGAGCCCATGGCTCTTCCCCAAC
C2              CTACGACTACCTCCATGAAATTTGTCCTGAGTTCATGGCTCTTCCCCAAC
C3              CTACGACTACCTCCATGAATTTTGTCCTGAGCCCATGGCTCTTCCCCAAC
C4              CTACGACTACCTCCATGAATTTTGTCCTGAGCCAATAGATGTTCTCCAAC
C5              CTACGACTACTTCCACGAATTTTGTCCCGAGCCAATAGGTGTTCCCCAAC
                ****** *** **** ***:*** *** ***  .**.* * *** *****

C1              TGCCCTTCAATGAATTCGATGCTAACTGGGCGAGTTCATGGCTGGGCCTT
C2              TGCCTTTCAATGAATTCGACGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
C3              TGCCTTTCAATGAATTCGATGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
C4              TGCACTTCAACGAATTCGATTCAGGCTGGGCGAGTACTTTGCTGAGTCTT
C5              TGCGTTTCAATGAATTCGATTCAAACTGGGCAAGTACTTTGCTGGGTATT
                ***  ***** ********  .:..******.***:*:* ****.* .**

C1              GAGCCAACGATTCCTATCGCAGAAAATGTAATTGAACACAATACACAGGA
C2              GAGTCAACGATTCCTGTCGCAGAACATGTAATTAAACCCAATACACAGGA
C3              GAGTCAACGATTCCTGTCGCAGAAAATGTAATCGAACCCAATACACAGGA
C4              GAGTCAACAATCCCTGTCACAGAAAACCTAATTGAACCTTATATACAGGA
C5              GAGTCAACGATTCCTGTCACAGAACATTTTATTGAACCCAATGCACTGGA
                *** ****.** ***.**.*****.*  *:** .***. :**. **:***

C1              TCAGCCAATGATACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
C2              TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
C3              TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
C4              TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCTT
C5              TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCGT
                *****.****.**************************** ******** *

C1              CATCGTCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTG
C2              CATCGGCGGATATTTTGGATGTTGACGATGACTTTATTCAAAATTTGTTA
C3              CATCGGCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTA
C4              CATCGGAAGATATTTTGGATGTTGACTATGACTTCATTCAAAATTTGTTG
C5              CTTCGGAGGATATTTTGGATGTTGACTATGACTTTATTCAACATTTGTTG
                *:*** ..****************** ******* ******.*******.

C1              AACTTT
C2              AACTTT
C3              AGCTTT
C4              AATTTT
C5              AATTTT
                *. ***



>C1
ATGTTTGCCATTCAAAGCGAAAACTATTTTGTGGACAATTACTCAGTCAG
TGATTTAATGATGTATCCTTGCGTCGAGTTAAACGTAGAAGCCGCTCCCA
CGGCAACAACAAGGTCTTCGGAGAAATCAAAGAGATCTCGCACGGCATTC
AGCAGTCTTCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAACCAGGCGAATCGAGATATCACAGCGTTTGGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAGGGTGCCATTGGAGCGCTGACCACATCTATTCCACT
TTCTTCCCAGTCGAGCGAAGATCTTCAAAAGGACGACCAGATCGTAGAGC
GTCTCCTTCGATATGCCAACACAAATGTGGAAACAGCTCCACTCCGGCAG
GTTGATCACGGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
CTACGATTACCTCCATGAATTTTCTCCTGAGCCCATGGCTCTTCCCCAAC
TGCCCTTCAATGAATTCGATGCTAACTGGGCGAGTTCATGGCTGGGCCTT
GAGCCAACGATTCCTATCGCAGAAAATGTAATTGAACACAATACACAGGA
TCAGCCAATGATACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
CATCGTCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTG
AACTTT
>C2
ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
AGTAGCCATCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAAGGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
GCCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTGCACTCCGGCAG
GTTCATAGCAGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
CTACGACTACCTCCATGAAATTTGTCCTGAGTTCATGGCTCTTCCCCAAC
TGCCTTTCAATGAATTCGACGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
GAGTCAACGATTCCTGTCGCAGAACATGTAATTAAACCCAATACACAGGA
TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
CATCGGCGGATATTTTGGATGTTGACGATGACTTTATTCAAAATTTGTTA
AACTTT
>C3
ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
AGTAGCCATCAGCTTATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAGCCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACGG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAATGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
GTCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTCCACTCCGGCAG
GTTGATCACTGTGTCCTGGAGGAGGGTCACATTACACCACCCTATCAGAG
CTACGACTACCTCCATGAATTTTGTCCTGAGCCCATGGCTCTTCCCCAAC
TGCCTTTCAATGAATTCGATGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
GAGTCAACGATTCCTGTCGCAGAAAATGTAATCGAACCCAATACACAGGA
TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
CATCGGCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTA
AGCTTT
>C4
ATGTTTGCCTTCCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
TGATTTTGTGATGTATCCTTGCGTGGACCTCAACGTAGAAGCAGCTCCCA
TTGCATCAACAAAGTCCTCGGAGAAATCGAAGAGATCTCGCACGGCATTC
AGCAGCCATCAGCTAATCGAACTTGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAACCAGGCGAATCGAAATATCCCAGCGTTTAGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGACGAATGAAACTCAAAAAG
TCGACCAATAGGAAAGGTGCCTTTGGAGCTCCGACAACATCTATTTCGCC
TTCTTCCCAATCGAGCGAAGATCTTCTGGAGAACGAGCAGATCGTGGAGC
GCCTCCTTAAATATGCAAGCACAAATCTTGAAACAGCTCCACTGCGGCAG
GATGATCGCGGTGTCCTACAGGATGGTCAAATTACACCACCCCATCAGAG
CTACGACTACCTCCATGAATTTTGTCCTGAGCCAATAGATGTTCTCCAAC
TGCACTTCAACGAATTCGATTCAGGCTGGGCGAGTACTTTGCTGAGTCTT
GAGTCAACAATCCCTGTCACAGAAAACCTAATTGAACCTTATATACAGGA
TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCTT
CATCGGAAGATATTTTGGATGTTGACTATGACTTCATTCAAAATTTGTTG
AATTTT
>C5
ATGTTTGCCACTCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
TGATTTTGTGATGTATCCTTGCGTAGAGTTGAACGTAGAAGCAGCGCCCG
TTGCTACAACAAAGTCCGCGGAGAAATCGAAGAGATCTCGCACTGCATTC
AGCAGCCATCAGCTAATCGAACTCGAAAGGGAGTTCCATCTCAACAAATA
CTTGGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAAGGTGCCATTGGAGCTCTCACCTCGTCTGTTTCAGC
TACTTCCCAATTGAGCGAAGATCTTCTCGAGGACGAGCAGATCGTAGAGC
GCCTGCTTAAATATGTAAGCACAAATGTGGAAACAGCTCCACTGCGGCAG
GATGAGCGCGGTTTCCTGGCGGAGGGTCAAATTACACCACCCCATCAGAG
CTACGACTACTTCCACGAATTTTGTCCCGAGCCAATAGGTGTTCCCCAAC
TGCGTTTCAATGAATTCGATTCAAACTGGGCAAGTACTTTGCTGGGTATT
GAGTCAACGATTCCTGTCACAGAACATTTTATTGAACCCAATGCACTGGA
TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCGT
CTTCGGAGGATATTTTGGATGTTGACTATGACTTTATTCAACATTTGTTG
AATTTT
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 756 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481336273
      Setting output file names to "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 434842149
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4880804508
      Seed = 54431556
      Swapseed = 1481336273
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 43 unique site patterns
      Division 2 has 31 unique site patterns
      Division 3 has 52 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2223.201378 -- -25.624409
         Chain 2 -- -2226.880552 -- -25.624409
         Chain 3 -- -2226.880552 -- -25.624409
         Chain 4 -- -2232.657341 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2180.023848 -- -25.624409
         Chain 2 -- -2227.126553 -- -25.624409
         Chain 3 -- -2139.887660 -- -25.624409
         Chain 4 -- -2217.011287 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2223.201] (-2226.881) (-2226.881) (-2232.657) * [-2180.024] (-2227.127) (-2139.888) (-2217.011) 
        500 -- (-1935.427) [-1939.380] (-1941.177) (-1940.170) * (-1946.049) [-1939.978] (-1951.647) (-1949.660) -- 0:00:00
       1000 -- [-1935.413] (-1934.442) (-1940.626) (-1934.731) * [-1944.749] (-1938.053) (-1939.480) (-1946.456) -- 0:00:00
       1500 -- [-1933.627] (-1934.918) (-1938.880) (-1932.283) * (-1941.173) (-1939.848) [-1938.961] (-1934.795) -- 0:00:00
       2000 -- (-1934.291) [-1933.272] (-1942.986) (-1936.671) * (-1941.025) [-1939.792] (-1933.708) (-1934.219) -- 0:00:00
       2500 -- (-1932.975) (-1940.031) (-1937.629) [-1934.589] * (-1937.822) [-1939.205] (-1933.861) (-1939.587) -- 0:00:00
       3000 -- (-1933.192) (-1940.166) [-1936.314] (-1935.050) * (-1933.467) (-1938.956) (-1935.806) [-1933.917] -- 0:00:00
       3500 -- (-1938.828) (-1936.067) [-1934.492] (-1936.613) * (-1939.712) (-1934.260) (-1938.721) [-1937.242] -- 0:04:44
       4000 -- (-1932.624) (-1937.486) [-1935.319] (-1940.471) * (-1936.867) (-1935.453) (-1934.683) [-1930.556] -- 0:04:09
       4500 -- (-1943.755) [-1934.340] (-1932.805) (-1937.574) * (-1935.919) (-1939.527) (-1935.968) [-1934.234] -- 0:03:41
       5000 -- (-1940.205) (-1938.287) [-1938.148] (-1933.195) * (-1938.728) (-1940.827) (-1934.042) [-1930.416] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-1934.016] (-1940.200) (-1934.870) (-1936.766) * (-1935.097) [-1937.154] (-1938.681) (-1931.111) -- 0:03:00
       6000 -- (-1936.919) [-1935.541] (-1932.811) (-1940.869) * (-1938.638) (-1938.928) [-1933.777] (-1932.740) -- 0:02:45
       6500 -- (-1933.963) (-1936.707) (-1936.173) [-1936.407] * (-1938.691) (-1934.719) [-1934.157] (-1930.113) -- 0:02:32
       7000 -- [-1938.323] (-1931.712) (-1936.814) (-1933.255) * (-1934.034) (-1932.288) [-1943.109] (-1933.427) -- 0:04:43
       7500 -- (-1939.538) [-1932.686] (-1936.438) (-1937.860) * [-1936.759] (-1938.067) (-1933.942) (-1936.777) -- 0:04:24
       8000 -- (-1935.042) (-1938.274) (-1938.180) [-1935.066] * [-1933.492] (-1932.790) (-1937.207) (-1935.732) -- 0:04:08
       8500 -- (-1932.851) (-1935.063) (-1935.803) [-1931.047] * (-1933.720) (-1933.877) (-1939.460) [-1932.454] -- 0:03:53
       9000 -- (-1933.273) [-1931.742] (-1932.890) (-1930.549) * [-1935.579] (-1934.832) (-1936.070) (-1936.195) -- 0:03:40
       9500 -- [-1930.618] (-1936.390) (-1933.926) (-1935.754) * (-1936.120) (-1937.106) (-1933.913) [-1937.195] -- 0:03:28
      10000 -- [-1933.535] (-1941.246) (-1939.083) (-1930.290) * (-1937.568) [-1934.511] (-1933.962) (-1934.577) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-1935.634] (-1938.387) (-1932.304) (-1932.434) * (-1939.179) (-1931.798) [-1932.529] (-1939.946) -- 0:03:08
      11000 -- (-1942.937) [-1941.813] (-1934.553) (-1932.041) * (-1939.138) [-1934.271] (-1937.904) (-1938.054) -- 0:02:59
      11500 -- (-1935.322) [-1938.171] (-1935.209) (-1937.371) * (-1938.696) [-1938.260] (-1937.472) (-1937.373) -- 0:02:51
      12000 -- (-1936.356) [-1935.479] (-1937.418) (-1937.349) * (-1936.607) [-1933.217] (-1938.338) (-1937.089) -- 0:04:07
      12500 -- [-1936.654] (-1930.463) (-1936.678) (-1940.728) * (-1934.880) [-1931.937] (-1939.372) (-1941.393) -- 0:03:57
      13000 -- [-1936.284] (-1938.086) (-1938.735) (-1935.920) * (-1938.231) (-1940.758) (-1935.151) [-1937.985] -- 0:03:47
      13500 -- (-1942.058) [-1939.334] (-1934.008) (-1932.146) * (-1940.423) (-1935.336) (-1938.277) [-1937.499] -- 0:03:39
      14000 -- (-1940.648) [-1938.886] (-1934.500) (-1938.253) * [-1937.599] (-1935.472) (-1945.270) (-1937.134) -- 0:03:31
      14500 -- (-1934.159) [-1931.639] (-1934.456) (-1935.694) * (-1932.708) (-1938.038) (-1935.917) [-1935.544] -- 0:03:23
      15000 -- (-1936.717) (-1932.026) [-1938.432] (-1937.950) * (-1938.852) (-1934.400) [-1937.480] (-1936.861) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-1933.995) [-1940.201] (-1943.290) (-1934.587) * (-1937.658) (-1936.777) (-1939.102) [-1939.390] -- 0:03:10
      16000 -- [-1937.171] (-1939.225) (-1939.235) (-1932.351) * (-1937.966) (-1938.959) [-1930.956] (-1944.723) -- 0:03:04
      16500 -- (-1936.985) [-1936.725] (-1937.874) (-1929.278) * (-1939.809) (-1933.578) [-1931.863] (-1933.670) -- 0:02:58
      17000 -- (-1935.590) (-1946.239) [-1942.427] (-1930.733) * (-1938.547) (-1939.343) [-1931.288] (-1942.210) -- 0:03:51
      17500 -- (-1933.315) [-1937.300] (-1944.072) (-1930.691) * [-1935.196] (-1941.395) (-1931.276) (-1936.260) -- 0:03:44
      18000 -- (-1929.184) (-1944.425) [-1934.587] (-1930.458) * [-1932.934] (-1948.396) (-1939.762) (-1931.949) -- 0:03:38
      18500 -- (-1932.893) [-1936.690] (-1936.616) (-1935.004) * [-1932.937] (-1939.225) (-1936.259) (-1934.421) -- 0:03:32
      19000 -- (-1938.210) (-1934.314) (-1940.294) [-1935.749] * (-1934.355) (-1936.791) [-1932.994] (-1930.619) -- 0:03:26
      19500 -- (-1939.776) [-1939.203] (-1945.100) (-1936.284) * (-1941.544) (-1935.936) (-1934.900) [-1931.592] -- 0:03:21
      20000 -- (-1940.667) [-1934.940] (-1945.344) (-1938.967) * (-1936.892) (-1932.604) [-1935.877] (-1939.152) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-1937.382) [-1933.253] (-1944.661) (-1938.090) * [-1936.718] (-1933.237) (-1937.240) (-1935.940) -- 0:03:11
      21000 -- [-1936.042] (-1934.536) (-1940.751) (-1934.064) * (-1933.069) [-1935.658] (-1937.059) (-1930.577) -- 0:03:06
      21500 -- (-1937.585) [-1932.975] (-1937.932) (-1943.655) * [-1938.623] (-1937.014) (-1938.034) (-1934.867) -- 0:03:02
      22000 -- (-1937.703) (-1935.656) (-1934.517) [-1934.403] * (-1938.355) [-1936.270] (-1936.751) (-1934.871) -- 0:03:42
      22500 -- (-1932.375) (-1931.850) [-1940.893] (-1939.301) * [-1936.479] (-1936.642) (-1942.202) (-1939.089) -- 0:03:37
      23000 -- (-1937.248) (-1939.963) (-1933.357) [-1937.104] * (-1934.619) (-1933.565) (-1934.812) [-1931.419] -- 0:03:32
      23500 -- (-1936.407) (-1935.677) (-1935.929) [-1937.562] * [-1939.857] (-1934.160) (-1936.712) (-1931.284) -- 0:03:27
      24000 -- (-1933.986) (-1936.977) [-1934.116] (-1936.614) * (-1941.979) (-1942.937) (-1939.137) [-1934.666] -- 0:03:23
      24500 -- (-1932.980) [-1934.537] (-1935.516) (-1937.008) * [-1930.858] (-1931.920) (-1939.212) (-1936.966) -- 0:03:19
      25000 -- [-1937.411] (-1939.370) (-1932.566) (-1940.803) * (-1930.597) (-1933.179) (-1932.920) [-1937.598] -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-1929.830) (-1931.564) [-1931.644] (-1935.842) * (-1930.664) [-1934.077] (-1934.799) (-1939.242) -- 0:03:11
      26000 -- (-1934.145) [-1936.812] (-1932.259) (-1938.848) * (-1939.650) [-1936.455] (-1937.061) (-1935.203) -- 0:03:07
      26500 -- (-1936.945) (-1946.275) [-1933.374] (-1933.147) * (-1933.558) (-1940.556) [-1929.920] (-1937.820) -- 0:03:03
      27000 -- (-1934.346) (-1932.442) [-1934.412] (-1932.265) * (-1933.420) [-1938.772] (-1930.922) (-1935.664) -- 0:03:36
      27500 -- (-1935.709) (-1944.481) (-1931.092) [-1931.582] * (-1933.435) [-1936.621] (-1940.440) (-1938.284) -- 0:03:32
      28000 -- [-1935.302] (-1938.317) (-1934.297) (-1931.639) * (-1932.493) [-1930.412] (-1938.255) (-1934.399) -- 0:03:28
      28500 -- [-1932.263] (-1933.768) (-1939.451) (-1935.020) * (-1932.523) [-1931.984] (-1940.084) (-1935.616) -- 0:03:24
      29000 -- (-1932.184) [-1932.927] (-1940.975) (-1934.401) * [-1935.407] (-1932.064) (-1934.000) (-1935.462) -- 0:03:20
      29500 -- (-1933.706) [-1935.504] (-1933.796) (-1931.754) * (-1945.217) (-1938.974) (-1935.941) [-1934.666] -- 0:03:17
      30000 -- [-1935.727] (-1937.217) (-1939.780) (-1933.798) * [-1936.024] (-1937.857) (-1930.746) (-1935.477) -- 0:03:14

      Average standard deviation of split frequencies: 0.000000

      30500 -- [-1940.167] (-1936.277) (-1935.573) (-1935.200) * (-1933.654) (-1936.784) (-1931.998) [-1939.603] -- 0:03:10
      31000 -- [-1934.300] (-1935.955) (-1935.057) (-1936.008) * (-1935.617) (-1939.552) [-1937.437] (-1936.803) -- 0:03:07
      31500 -- (-1936.329) (-1938.843) (-1934.393) [-1934.800] * (-1936.852) (-1933.622) [-1937.019] (-1939.923) -- 0:03:35
      32000 -- (-1937.017) [-1934.276] (-1937.624) (-1934.737) * (-1938.403) (-1933.780) [-1936.720] (-1936.401) -- 0:03:31
      32500 -- (-1939.801) [-1936.564] (-1936.483) (-1937.142) * (-1939.930) (-1933.185) [-1938.656] (-1937.609) -- 0:03:28
      33000 -- (-1933.326) (-1940.091) [-1937.080] (-1934.939) * (-1940.973) [-1937.478] (-1938.696) (-1938.236) -- 0:03:25
      33500 -- (-1934.372) (-1939.163) (-1939.029) [-1938.372] * (-1942.928) [-1931.275] (-1939.607) (-1935.082) -- 0:03:21
      34000 -- [-1939.778] (-1940.942) (-1938.269) (-1933.071) * (-1940.403) [-1933.341] (-1936.666) (-1938.762) -- 0:03:18
      34500 -- [-1937.045] (-1941.424) (-1938.582) (-1935.236) * (-1935.538) (-1932.842) [-1937.393] (-1941.767) -- 0:03:15
      35000 -- (-1940.982) (-1937.156) (-1938.923) [-1944.824] * [-1939.613] (-1941.053) (-1943.798) (-1935.872) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      35500 -- [-1934.087] (-1932.412) (-1935.424) (-1950.926) * (-1933.558) [-1932.456] (-1935.050) (-1939.913) -- 0:03:10
      36000 -- [-1934.227] (-1944.277) (-1940.664) (-1942.443) * (-1936.376) (-1932.050) [-1933.280] (-1934.650) -- 0:03:07
      36500 -- [-1933.092] (-1934.542) (-1941.263) (-1936.972) * (-1933.346) (-1931.616) (-1938.186) [-1939.218] -- 0:03:31
      37000 -- (-1944.865) (-1930.780) (-1937.418) [-1931.706] * (-1941.840) [-1938.384] (-1936.413) (-1940.582) -- 0:03:28
      37500 -- (-1942.603) [-1934.000] (-1937.426) (-1934.054) * [-1934.753] (-1939.870) (-1932.206) (-1934.871) -- 0:03:25
      38000 -- [-1935.576] (-1938.217) (-1943.458) (-1934.632) * [-1933.784] (-1937.489) (-1937.321) (-1933.022) -- 0:03:22
      38500 -- [-1934.697] (-1954.319) (-1939.266) (-1933.688) * (-1932.601) [-1935.788] (-1935.902) (-1934.671) -- 0:03:19
      39000 -- [-1934.459] (-1943.122) (-1940.741) (-1935.810) * (-1933.190) [-1933.286] (-1935.908) (-1937.191) -- 0:03:17
      39500 -- (-1937.482) [-1935.092] (-1937.357) (-1935.539) * [-1936.052] (-1933.591) (-1936.146) (-1938.178) -- 0:03:14
      40000 -- (-1934.111) (-1931.503) (-1937.954) [-1936.265] * [-1931.440] (-1938.184) (-1936.796) (-1939.263) -- 0:03:12

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-1933.337) [-1934.786] (-1940.453) (-1945.259) * (-1933.682) (-1939.552) [-1931.303] (-1941.244) -- 0:03:09
      41000 -- (-1933.643) (-1942.815) [-1930.551] (-1938.568) * (-1931.296) [-1931.562] (-1934.997) (-1938.515) -- 0:03:07
      41500 -- (-1933.120) [-1935.902] (-1935.450) (-1938.179) * (-1933.664) [-1936.621] (-1933.070) (-1942.433) -- 0:03:27
      42000 -- (-1934.205) (-1936.636) [-1936.436] (-1937.429) * (-1935.046) (-1933.507) (-1934.630) [-1933.993] -- 0:03:25
      42500 -- (-1938.023) (-1934.669) (-1937.468) [-1931.544] * (-1935.511) [-1930.762] (-1933.366) (-1936.930) -- 0:03:22
      43000 -- (-1937.959) (-1936.220) [-1940.829] (-1937.470) * [-1933.423] (-1934.470) (-1933.090) (-1938.380) -- 0:03:20
      43500 -- [-1937.707] (-1935.235) (-1939.292) (-1940.875) * (-1935.855) (-1931.218) (-1932.272) [-1933.460] -- 0:03:17
      44000 -- (-1941.568) (-1939.471) [-1931.746] (-1945.223) * (-1936.078) (-1932.973) (-1933.512) [-1931.450] -- 0:03:15
      44500 -- (-1934.516) (-1933.945) (-1931.516) [-1942.961] * (-1936.116) [-1934.209] (-1938.601) (-1932.520) -- 0:03:13
      45000 -- (-1936.557) (-1937.016) [-1931.658] (-1938.642) * (-1939.397) (-1939.728) (-1936.957) [-1931.806] -- 0:03:11

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-1939.269) (-1938.302) [-1932.311] (-1934.483) * (-1931.788) (-1934.620) (-1941.303) [-1934.291] -- 0:03:08
      46000 -- (-1934.256) [-1935.920] (-1935.191) (-1934.569) * (-1935.952) (-1932.056) [-1938.673] (-1934.100) -- 0:03:06
      46500 -- (-1934.299) (-1935.973) (-1940.192) [-1931.575] * (-1937.748) [-1931.634] (-1940.670) (-1934.622) -- 0:03:25
      47000 -- (-1938.107) [-1934.749] (-1943.141) (-1939.133) * (-1935.992) (-1939.814) (-1943.518) [-1933.568] -- 0:03:22
      47500 -- (-1934.406) (-1938.618) [-1936.350] (-1932.677) * (-1935.168) (-1935.107) (-1938.466) [-1934.308] -- 0:03:20
      48000 -- (-1936.138) (-1936.624) (-1934.399) [-1934.656] * [-1935.132] (-1932.907) (-1935.312) (-1935.530) -- 0:03:18
      48500 -- (-1932.609) (-1943.242) [-1928.871] (-1935.739) * (-1934.034) (-1936.325) [-1935.708] (-1944.247) -- 0:03:16
      49000 -- (-1941.561) (-1947.331) [-1931.795] (-1933.039) * [-1935.140] (-1935.473) (-1937.578) (-1935.836) -- 0:03:14
      49500 -- [-1936.253] (-1942.844) (-1936.866) (-1935.961) * (-1932.660) [-1935.452] (-1940.914) (-1932.668) -- 0:03:12
      50000 -- [-1937.439] (-1934.086) (-1932.480) (-1937.727) * (-1933.623) (-1937.633) (-1936.758) [-1934.750] -- 0:03:10

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-1937.125] (-1932.442) (-1936.985) (-1937.173) * (-1938.661) (-1934.500) (-1941.870) [-1934.349] -- 0:03:08
      51000 -- (-1939.448) [-1939.400] (-1934.733) (-1935.796) * (-1942.857) (-1936.609) [-1939.088] (-1934.872) -- 0:03:06
      51500 -- (-1938.650) (-1938.434) [-1940.915] (-1931.833) * (-1932.892) [-1936.755] (-1934.329) (-1942.808) -- 0:03:22
      52000 -- (-1936.898) [-1934.577] (-1937.162) (-1934.790) * [-1936.838] (-1944.822) (-1939.240) (-1948.349) -- 0:03:20
      52500 -- (-1936.618) [-1931.577] (-1939.080) (-1936.530) * (-1933.651) (-1935.761) [-1940.643] (-1941.926) -- 0:03:18
      53000 -- (-1930.018) (-1935.720) [-1933.814] (-1930.444) * [-1933.641] (-1941.895) (-1938.105) (-1937.255) -- 0:03:16
      53500 -- [-1934.055] (-1933.910) (-1932.490) (-1932.925) * (-1936.290) (-1946.334) [-1936.362] (-1933.492) -- 0:03:14
      54000 -- (-1932.577) (-1935.151) (-1932.962) [-1929.820] * [-1935.053] (-1941.520) (-1938.363) (-1937.152) -- 0:03:12
      54500 -- [-1932.459] (-1935.898) (-1932.869) (-1940.675) * (-1932.814) (-1932.128) [-1931.658] (-1931.452) -- 0:03:10
      55000 -- (-1933.522) [-1936.041] (-1936.025) (-1936.833) * (-1937.520) (-1933.170) (-1934.518) [-1931.738] -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      55500 -- [-1933.831] (-1933.067) (-1940.582) (-1940.110) * (-1933.290) (-1935.493) (-1932.023) [-1934.123] -- 0:03:07
      56000 -- [-1931.095] (-1941.207) (-1935.440) (-1936.637) * (-1933.521) (-1936.054) (-1931.934) [-1940.805] -- 0:03:05
      56500 -- (-1944.414) [-1934.546] (-1934.465) (-1937.557) * (-1932.367) [-1937.451] (-1935.970) (-1935.358) -- 0:03:20
      57000 -- [-1934.543] (-1935.910) (-1933.135) (-1939.664) * (-1935.164) (-1930.108) [-1935.003] (-1940.774) -- 0:03:18
      57500 -- (-1935.897) (-1932.223) [-1935.263] (-1936.141) * [-1933.464] (-1936.865) (-1935.568) (-1937.861) -- 0:03:16
      58000 -- [-1939.112] (-1933.287) (-1934.232) (-1934.594) * [-1930.935] (-1939.881) (-1937.140) (-1946.202) -- 0:03:14
      58500 -- (-1938.004) (-1934.475) [-1933.720] (-1937.959) * [-1931.275] (-1937.990) (-1934.314) (-1944.481) -- 0:03:13
      59000 -- (-1941.407) (-1938.346) [-1932.476] (-1938.659) * [-1933.299] (-1941.056) (-1936.217) (-1940.257) -- 0:03:11
      59500 -- (-1940.775) (-1941.910) (-1931.656) [-1935.558] * (-1931.346) (-1936.053) [-1939.031] (-1937.072) -- 0:03:09
      60000 -- (-1940.180) (-1942.330) (-1931.335) [-1933.820] * (-1934.929) [-1939.007] (-1939.948) (-1937.379) -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-1940.745) [-1935.161] (-1931.494) (-1937.456) * (-1937.470) (-1938.641) [-1931.348] (-1940.133) -- 0:03:06
      61000 -- (-1940.447) (-1933.194) (-1935.364) [-1937.565] * (-1941.555) (-1937.738) [-1930.957] (-1944.924) -- 0:03:20
      61500 -- (-1940.884) (-1932.809) (-1938.650) [-1936.694] * (-1934.428) [-1936.305] (-1932.297) (-1945.697) -- 0:03:18
      62000 -- (-1943.869) (-1938.334) [-1930.566] (-1933.290) * (-1933.808) [-1937.253] (-1933.705) (-1941.726) -- 0:03:16
      62500 -- (-1944.163) [-1933.459] (-1931.318) (-1939.469) * (-1937.290) (-1935.178) [-1929.367] (-1937.600) -- 0:03:15
      63000 -- (-1932.732) [-1934.014] (-1947.249) (-1936.437) * (-1931.947) [-1932.687] (-1935.189) (-1943.726) -- 0:03:13
      63500 -- (-1937.007) [-1934.112] (-1943.714) (-1945.891) * [-1938.046] (-1932.687) (-1935.778) (-1937.123) -- 0:03:11
      64000 -- (-1937.397) [-1935.678] (-1934.545) (-1934.703) * (-1938.209) (-1933.644) (-1940.252) [-1935.520] -- 0:03:10
      64500 -- (-1940.242) [-1935.287] (-1938.202) (-1934.934) * [-1934.825] (-1934.327) (-1936.213) (-1936.557) -- 0:03:08
      65000 -- [-1933.903] (-1932.064) (-1932.714) (-1937.121) * [-1937.486] (-1935.353) (-1936.166) (-1939.900) -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-1936.740) (-1933.424) [-1931.903] (-1944.613) * (-1930.709) [-1939.754] (-1938.413) (-1937.425) -- 0:03:05
      66000 -- (-1930.443) [-1930.330] (-1936.073) (-1940.814) * (-1932.109) [-1938.527] (-1938.149) (-1932.282) -- 0:03:18
      66500 -- (-1938.534) (-1941.134) [-1939.229] (-1931.286) * [-1934.717] (-1939.127) (-1944.007) (-1938.862) -- 0:03:16
      67000 -- [-1934.682] (-1935.386) (-1939.453) (-1938.878) * [-1938.829] (-1932.000) (-1939.488) (-1933.745) -- 0:03:14
      67500 -- (-1934.773) (-1936.240) (-1933.122) [-1934.098] * (-1938.408) [-1933.415] (-1936.822) (-1935.083) -- 0:03:13
      68000 -- (-1939.268) [-1932.420] (-1935.460) (-1930.939) * (-1933.908) (-1935.254) (-1935.297) [-1935.833] -- 0:03:11
      68500 -- (-1935.981) (-1937.287) (-1932.901) [-1934.402] * (-1937.486) [-1934.985] (-1934.192) (-1938.730) -- 0:03:10
      69000 -- (-1934.383) [-1934.076] (-1930.308) (-1939.325) * (-1936.906) (-1937.786) [-1936.753] (-1933.842) -- 0:03:08
      69500 -- [-1929.582] (-1931.471) (-1934.313) (-1936.234) * (-1943.378) [-1935.770] (-1932.345) (-1929.896) -- 0:03:07
      70000 -- (-1936.988) [-1931.313] (-1931.273) (-1929.512) * [-1939.176] (-1933.393) (-1936.259) (-1935.997) -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-1934.229) [-1934.238] (-1943.766) (-1933.254) * [-1937.039] (-1932.878) (-1933.340) (-1937.436) -- 0:03:04
      71000 -- [-1931.892] (-1935.020) (-1933.364) (-1936.606) * (-1935.388) (-1938.054) [-1936.367] (-1937.951) -- 0:03:16
      71500 -- (-1933.137) [-1938.653] (-1934.331) (-1933.715) * [-1935.159] (-1937.872) (-1943.644) (-1931.134) -- 0:03:14
      72000 -- [-1934.361] (-1936.199) (-1938.391) (-1938.644) * [-1941.043] (-1934.782) (-1939.018) (-1931.968) -- 0:03:13
      72500 -- (-1937.774) [-1936.571] (-1940.744) (-1938.877) * [-1935.033] (-1938.893) (-1939.037) (-1937.034) -- 0:03:11
      73000 -- (-1932.628) (-1934.623) (-1935.639) [-1932.685] * (-1934.431) (-1936.071) (-1940.558) [-1931.187] -- 0:03:10
      73500 -- (-1935.103) (-1936.907) (-1941.361) [-1939.516] * (-1940.640) [-1938.848] (-1933.584) (-1938.910) -- 0:03:09
      74000 -- (-1944.804) [-1933.747] (-1946.303) (-1939.480) * (-1937.722) [-1942.032] (-1930.053) (-1932.009) -- 0:03:07
      74500 -- (-1931.727) [-1931.947] (-1940.769) (-1942.245) * (-1940.033) (-1932.846) [-1934.748] (-1932.070) -- 0:03:06
      75000 -- [-1936.537] (-1931.985) (-1942.353) (-1936.879) * (-1938.799) [-1936.952] (-1937.568) (-1935.396) -- 0:03:05

      Average standard deviation of split frequencies: 0.000000

      75500 -- [-1936.742] (-1943.151) (-1938.151) (-1940.531) * [-1942.080] (-1933.292) (-1933.492) (-1933.388) -- 0:03:03
      76000 -- (-1937.994) [-1933.554] (-1935.428) (-1937.924) * (-1938.367) [-1931.554] (-1935.182) (-1935.270) -- 0:03:14
      76500 -- (-1939.805) [-1937.770] (-1938.560) (-1934.855) * (-1942.708) (-1936.238) [-1933.596] (-1933.435) -- 0:03:13
      77000 -- [-1932.081] (-1933.947) (-1935.707) (-1936.312) * [-1939.454] (-1939.505) (-1935.744) (-1935.783) -- 0:03:11
      77500 -- (-1937.322) (-1934.527) [-1937.050] (-1932.253) * [-1936.526] (-1937.824) (-1931.186) (-1933.982) -- 0:03:10
      78000 -- (-1942.201) (-1937.267) [-1939.383] (-1933.759) * (-1930.563) [-1934.172] (-1937.749) (-1935.157) -- 0:03:09
      78500 -- (-1938.129) (-1939.397) (-1933.683) [-1934.501] * (-1934.855) [-1935.621] (-1936.988) (-1933.585) -- 0:03:07
      79000 -- (-1943.498) (-1936.879) (-1935.000) [-1930.572] * (-1938.303) (-1933.637) [-1943.720] (-1933.507) -- 0:03:06
      79500 -- (-1934.999) (-1932.991) [-1933.298] (-1941.466) * [-1931.796] (-1935.573) (-1937.851) (-1935.713) -- 0:03:05
      80000 -- (-1933.982) (-1935.337) [-1934.618] (-1942.701) * (-1934.777) (-1941.965) [-1936.014] (-1936.895) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      80500 -- [-1936.587] (-1934.378) (-1944.730) (-1939.847) * [-1931.968] (-1937.277) (-1942.737) (-1934.712) -- 0:03:02
      81000 -- [-1935.099] (-1941.207) (-1937.760) (-1938.329) * (-1931.683) [-1936.616] (-1948.056) (-1939.465) -- 0:03:12
      81500 -- [-1932.942] (-1936.676) (-1935.025) (-1943.044) * (-1934.741) [-1937.118] (-1939.602) (-1933.131) -- 0:03:11
      82000 -- [-1938.980] (-1937.764) (-1938.529) (-1940.961) * [-1934.573] (-1937.707) (-1938.802) (-1931.987) -- 0:03:10
      82500 -- (-1933.809) (-1935.958) [-1943.266] (-1946.217) * [-1931.915] (-1935.165) (-1938.231) (-1933.450) -- 0:03:09
      83000 -- (-1934.091) (-1934.191) (-1945.207) [-1936.541] * (-1938.957) [-1939.456] (-1934.969) (-1931.980) -- 0:03:07
      83500 -- [-1936.068] (-1935.440) (-1941.500) (-1931.974) * (-1935.703) [-1932.513] (-1936.010) (-1930.870) -- 0:03:06
      84000 -- (-1936.600) (-1940.707) (-1943.200) [-1933.117] * (-1937.749) (-1935.154) [-1930.494] (-1936.900) -- 0:03:05
      84500 -- (-1934.191) (-1935.357) (-1943.024) [-1935.158] * (-1937.404) [-1935.286] (-1938.858) (-1942.043) -- 0:03:04
      85000 -- (-1942.441) [-1931.659] (-1942.727) (-1939.049) * (-1936.950) (-1937.835) [-1939.543] (-1935.949) -- 0:03:03

      Average standard deviation of split frequencies: 0.000000

      85500 -- [-1943.176] (-1939.630) (-1946.515) (-1941.869) * (-1941.270) [-1933.888] (-1935.789) (-1934.759) -- 0:03:01
      86000 -- (-1934.318) [-1932.370] (-1945.437) (-1933.469) * (-1931.499) [-1938.301] (-1934.115) (-1936.620) -- 0:03:11
      86500 -- [-1940.152] (-1935.934) (-1942.191) (-1938.253) * (-1936.110) [-1936.123] (-1937.482) (-1942.021) -- 0:03:10
      87000 -- [-1935.107] (-1931.597) (-1934.457) (-1935.332) * [-1932.581] (-1938.943) (-1937.867) (-1936.755) -- 0:03:08
      87500 -- [-1934.813] (-1930.684) (-1943.333) (-1936.322) * (-1939.511) (-1934.954) [-1932.939] (-1934.218) -- 0:03:07
      88000 -- (-1932.367) (-1934.119) [-1936.034] (-1936.420) * (-1940.470) [-1931.874] (-1938.130) (-1933.373) -- 0:03:06
      88500 -- [-1937.091] (-1932.437) (-1934.841) (-1935.110) * [-1935.507] (-1932.860) (-1940.270) (-1934.187) -- 0:03:05
      89000 -- (-1934.035) [-1936.859] (-1941.213) (-1940.924) * (-1935.605) (-1934.605) [-1935.486] (-1931.564) -- 0:03:04
      89500 -- (-1940.228) [-1937.264] (-1933.305) (-1938.941) * [-1932.851] (-1939.267) (-1933.068) (-1934.209) -- 0:03:03
      90000 -- (-1936.701) (-1937.915) [-1934.473] (-1935.027) * [-1940.162] (-1933.076) (-1935.464) (-1934.063) -- 0:03:02

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-1935.729) (-1940.003) (-1933.843) [-1934.156] * (-1942.032) (-1933.925) (-1934.716) [-1939.572] -- 0:03:00
      91000 -- (-1938.159) (-1937.407) [-1936.516] (-1935.927) * (-1934.866) (-1933.172) (-1934.222) [-1932.892] -- 0:03:09
      91500 -- (-1932.651) [-1931.129] (-1936.731) (-1937.184) * [-1940.571] (-1933.506) (-1942.119) (-1930.398) -- 0:03:08
      92000 -- [-1936.240] (-1935.871) (-1936.316) (-1932.821) * [-1939.994] (-1939.115) (-1942.303) (-1934.177) -- 0:03:07
      92500 -- [-1938.194] (-1929.659) (-1936.229) (-1934.962) * (-1939.183) (-1932.180) (-1939.148) [-1938.098] -- 0:03:06
      93000 -- (-1935.199) (-1937.496) (-1935.539) [-1933.516] * [-1939.627] (-1938.281) (-1937.693) (-1933.379) -- 0:03:05
      93500 -- (-1938.910) (-1930.050) (-1932.536) [-1932.917] * (-1936.451) (-1944.690) [-1935.698] (-1937.072) -- 0:03:04
      94000 -- (-1934.232) (-1933.273) (-1935.713) [-1931.593] * (-1942.568) (-1934.251) [-1932.043] (-1938.967) -- 0:03:03
      94500 -- [-1929.810] (-1934.329) (-1937.543) (-1934.882) * (-1932.794) (-1938.668) [-1934.608] (-1934.081) -- 0:03:02
      95000 -- [-1937.729] (-1934.112) (-1932.176) (-1936.072) * (-1936.867) (-1941.225) [-1933.244] (-1933.305) -- 0:03:01

      Average standard deviation of split frequencies: 0.000000

      95500 -- [-1941.061] (-1934.280) (-1941.472) (-1941.204) * (-1937.845) (-1941.102) (-1931.985) [-1930.654] -- 0:03:09
      96000 -- (-1942.058) (-1935.604) [-1941.911] (-1941.753) * (-1943.058) (-1939.138) [-1930.819] (-1935.050) -- 0:03:08
      96500 -- (-1940.205) (-1941.312) [-1936.405] (-1933.884) * [-1931.341] (-1948.259) (-1947.197) (-1935.587) -- 0:03:07
      97000 -- [-1934.731] (-1941.077) (-1933.929) (-1937.252) * (-1932.704) (-1939.206) (-1937.851) [-1934.839] -- 0:03:06
      97500 -- (-1935.813) (-1937.525) (-1938.590) [-1937.899] * [-1932.165] (-1940.293) (-1935.903) (-1931.812) -- 0:03:05
      98000 -- (-1935.812) (-1936.199) (-1940.550) [-1929.795] * [-1931.260] (-1938.852) (-1934.288) (-1936.225) -- 0:03:04
      98500 -- (-1935.951) (-1935.276) (-1936.796) [-1940.004] * (-1932.719) (-1937.176) [-1932.688] (-1936.351) -- 0:03:03
      99000 -- (-1938.505) (-1941.382) (-1940.505) [-1939.394] * (-1937.770) [-1937.049] (-1931.970) (-1937.402) -- 0:03:02
      99500 -- (-1944.657) (-1944.053) [-1935.981] (-1934.404) * (-1940.286) [-1929.652] (-1934.996) (-1935.245) -- 0:03:01
      100000 -- (-1939.489) (-1935.451) (-1933.287) [-1936.287] * [-1935.661] (-1934.461) (-1935.362) (-1937.166) -- 0:03:00

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-1932.510) (-1938.918) (-1939.221) [-1934.254] * (-1937.396) (-1933.164) [-1943.548] (-1941.435) -- 0:03:07
      101000 -- (-1938.522) [-1940.755] (-1937.039) (-1937.206) * (-1939.949) (-1932.956) [-1942.349] (-1939.713) -- 0:03:06
      101500 -- [-1939.776] (-1935.726) (-1932.661) (-1932.753) * [-1933.836] (-1930.734) (-1941.139) (-1944.244) -- 0:03:05
      102000 -- [-1935.088] (-1935.298) (-1935.957) (-1933.813) * (-1939.916) [-1933.011] (-1941.222) (-1934.081) -- 0:03:04
      102500 -- (-1934.876) (-1940.303) [-1937.102] (-1932.472) * (-1940.693) (-1931.229) (-1945.614) [-1941.257] -- 0:03:03
      103000 -- (-1935.911) [-1937.919] (-1938.245) (-1933.905) * [-1932.169] (-1936.905) (-1939.839) (-1936.292) -- 0:03:02
      103500 -- (-1941.036) [-1936.599] (-1943.728) (-1935.669) * (-1932.343) [-1933.895] (-1937.020) (-1937.494) -- 0:03:01
      104000 -- (-1939.135) [-1936.016] (-1934.898) (-1933.855) * [-1931.593] (-1933.559) (-1935.278) (-1935.623) -- 0:03:00
      104500 -- (-1939.355) (-1943.908) (-1938.410) [-1932.671] * [-1934.404] (-1937.737) (-1939.838) (-1932.123) -- 0:02:59
      105000 -- (-1938.310) (-1942.481) [-1941.776] (-1933.539) * [-1932.644] (-1937.124) (-1937.466) (-1930.772) -- 0:02:59

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-1943.601) [-1933.557] (-1940.401) (-1931.301) * (-1935.846) [-1932.801] (-1935.411) (-1938.501) -- 0:03:06
      106000 -- (-1945.382) (-1934.455) (-1936.445) [-1933.622] * (-1930.043) [-1933.737] (-1933.278) (-1941.180) -- 0:03:05
      106500 -- (-1944.541) (-1937.010) (-1938.194) [-1931.463] * [-1936.593] (-1932.146) (-1938.023) (-1936.898) -- 0:03:04
      107000 -- [-1939.512] (-1945.818) (-1936.450) (-1929.956) * [-1934.831] (-1935.282) (-1933.772) (-1938.889) -- 0:03:03
      107500 -- (-1937.518) (-1946.674) (-1939.009) [-1929.604] * [-1936.275] (-1935.021) (-1933.860) (-1936.313) -- 0:03:02
      108000 -- [-1934.686] (-1943.917) (-1933.785) (-1932.972) * (-1935.652) [-1933.700] (-1943.327) (-1933.061) -- 0:03:01
      108500 -- (-1939.228) (-1938.820) [-1929.178] (-1941.055) * (-1938.920) (-1935.593) (-1931.425) [-1935.997] -- 0:03:00
      109000 -- (-1930.879) (-1937.027) [-1931.466] (-1934.623) * (-1934.810) (-1931.973) (-1935.284) [-1935.462] -- 0:02:59
      109500 -- (-1931.849) (-1929.404) [-1934.252] (-1931.954) * (-1935.449) [-1937.150] (-1936.395) (-1934.521) -- 0:03:07
      110000 -- [-1937.358] (-1934.643) (-1937.386) (-1934.968) * [-1932.286] (-1934.035) (-1936.518) (-1933.078) -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-1938.625] (-1945.457) (-1938.563) (-1935.730) * (-1931.559) (-1938.046) (-1935.858) [-1935.329] -- 0:03:05
      111000 -- (-1931.505) (-1938.285) [-1939.255] (-1945.510) * (-1934.461) [-1931.177] (-1935.417) (-1937.759) -- 0:03:04
      111500 -- [-1932.970] (-1942.835) (-1936.574) (-1934.633) * (-1932.038) (-1931.211) (-1938.040) [-1935.215] -- 0:03:03
      112000 -- (-1931.485) (-1933.454) (-1934.497) [-1933.002] * (-1932.760) [-1931.232] (-1935.727) (-1936.831) -- 0:03:02
      112500 -- (-1931.714) (-1936.287) [-1931.334] (-1936.287) * [-1937.307] (-1935.686) (-1934.523) (-1934.759) -- 0:03:01
      113000 -- (-1935.753) (-1934.935) (-1935.615) [-1936.679] * [-1936.433] (-1935.596) (-1933.033) (-1934.178) -- 0:03:00
      113500 -- (-1937.500) (-1939.528) (-1931.202) [-1936.652] * (-1935.703) [-1932.616] (-1935.813) (-1937.618) -- 0:02:59
      114000 -- (-1932.098) [-1937.058] (-1935.135) (-1937.517) * (-1938.116) (-1939.495) (-1938.776) [-1935.905] -- 0:02:58
      114500 -- (-1938.287) [-1932.712] (-1935.917) (-1933.395) * [-1931.873] (-1943.920) (-1935.909) (-1932.783) -- 0:03:05
      115000 -- (-1938.956) [-1932.315] (-1936.906) (-1936.567) * (-1933.897) (-1934.582) [-1933.587] (-1932.752) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-1944.842) (-1936.245) [-1931.999] (-1934.163) * (-1933.184) (-1941.032) [-1937.383] (-1934.794) -- 0:03:03
      116000 -- (-1941.902) (-1930.702) (-1931.324) [-1935.873] * (-1940.668) [-1934.278] (-1939.525) (-1930.814) -- 0:03:02
      116500 -- (-1939.354) [-1933.584] (-1937.718) (-1939.610) * (-1935.380) (-1938.784) (-1937.275) [-1929.920] -- 0:03:02
      117000 -- (-1934.607) (-1937.942) [-1936.972] (-1941.372) * [-1934.101] (-1937.343) (-1933.463) (-1939.282) -- 0:03:01
      117500 -- (-1939.898) [-1931.548] (-1932.801) (-1936.891) * (-1937.885) (-1937.924) (-1936.670) [-1932.526] -- 0:03:00
      118000 -- (-1937.416) [-1935.828] (-1943.008) (-1937.173) * [-1931.843] (-1933.549) (-1937.874) (-1943.548) -- 0:02:59
      118500 -- (-1939.157) (-1932.708) [-1934.050] (-1934.671) * [-1929.938] (-1934.675) (-1942.358) (-1938.153) -- 0:02:58
      119000 -- (-1938.747) (-1934.686) [-1935.476] (-1935.648) * (-1933.713) [-1936.859] (-1938.533) (-1934.333) -- 0:03:05
      119500 -- (-1933.887) [-1934.059] (-1936.867) (-1936.969) * (-1941.145) [-1930.488] (-1939.361) (-1932.435) -- 0:03:04
      120000 -- (-1939.280) [-1935.389] (-1944.684) (-1935.126) * (-1933.186) (-1938.902) [-1930.990] (-1935.416) -- 0:03:03

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-1936.066) [-1932.370] (-1932.871) (-1934.143) * [-1936.484] (-1938.331) (-1933.769) (-1937.150) -- 0:03:02
      121000 -- (-1935.399) (-1933.454) (-1934.416) [-1938.848] * (-1937.243) (-1936.783) [-1928.869] (-1938.868) -- 0:03:01
      121500 -- (-1936.084) (-1931.347) [-1933.408] (-1934.942) * [-1938.435] (-1937.553) (-1934.556) (-1937.325) -- 0:03:00
      122000 -- (-1935.393) (-1934.581) (-1938.496) [-1935.463] * (-1938.142) (-1939.995) [-1936.575] (-1937.184) -- 0:02:59
      122500 -- (-1932.192) [-1935.521] (-1935.852) (-1934.463) * [-1937.911] (-1934.146) (-1935.153) (-1935.540) -- 0:02:59
      123000 -- (-1936.138) [-1928.059] (-1936.415) (-1937.977) * (-1931.086) (-1934.203) (-1939.203) [-1933.565] -- 0:02:58
      123500 -- [-1932.488] (-1931.199) (-1933.818) (-1937.043) * (-1933.172) (-1931.712) [-1935.770] (-1937.761) -- 0:02:57
      124000 -- (-1935.386) (-1930.608) (-1937.013) [-1936.534] * (-1938.308) [-1938.957] (-1940.730) (-1935.508) -- 0:03:03
      124500 -- (-1934.419) (-1935.213) [-1931.740] (-1938.250) * [-1936.108] (-1944.908) (-1937.677) (-1936.180) -- 0:03:02
      125000 -- [-1934.303] (-1934.187) (-1932.963) (-1933.073) * [-1931.537] (-1934.919) (-1943.414) (-1942.359) -- 0:03:02

      Average standard deviation of split frequencies: 0.000000

      125500 -- [-1933.704] (-1932.960) (-1945.829) (-1932.928) * (-1939.067) (-1933.412) [-1935.265] (-1941.668) -- 0:03:01
      126000 -- (-1935.191) [-1933.370] (-1933.311) (-1936.783) * [-1934.483] (-1931.402) (-1937.239) (-1937.712) -- 0:03:00
      126500 -- (-1935.036) (-1938.504) (-1935.161) [-1938.578] * (-1937.198) (-1930.260) [-1934.547] (-1934.359) -- 0:02:59
      127000 -- (-1937.580) (-1939.091) (-1941.031) [-1931.885] * [-1932.118] (-1931.605) (-1938.082) (-1934.665) -- 0:02:58
      127500 -- (-1936.077) (-1940.036) (-1946.123) [-1938.965] * [-1930.463] (-1933.657) (-1942.203) (-1932.612) -- 0:02:57
      128000 -- (-1934.575) [-1940.912] (-1936.376) (-1937.612) * (-1930.988) (-1934.522) [-1938.136] (-1932.248) -- 0:02:57
      128500 -- (-1938.771) (-1930.582) [-1933.953] (-1934.201) * (-1933.753) (-1931.472) [-1934.458] (-1938.779) -- 0:03:03
      129000 -- (-1945.048) (-1933.489) (-1944.567) [-1934.275] * (-1935.320) (-1935.124) (-1940.159) [-1935.998] -- 0:03:02
      129500 -- (-1943.858) [-1933.823] (-1938.423) (-1934.121) * (-1941.974) (-1936.574) (-1943.688) [-1932.999] -- 0:03:01
      130000 -- (-1938.280) (-1934.425) (-1932.582) [-1932.224] * (-1938.633) [-1935.670] (-1935.450) (-1930.779) -- 0:03:00

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-1936.690) (-1935.495) [-1931.609] (-1935.262) * (-1936.219) [-1933.084] (-1933.998) (-1933.329) -- 0:02:59
      131000 -- (-1933.254) [-1935.567] (-1939.047) (-1934.260) * [-1932.935] (-1937.912) (-1936.670) (-1930.438) -- 0:02:59
      131500 -- [-1930.308] (-1933.430) (-1931.178) (-1940.875) * (-1940.199) (-1933.276) [-1937.631] (-1930.569) -- 0:02:58
      132000 -- (-1935.209) (-1934.584) (-1934.204) [-1936.430] * (-1943.786) (-1937.237) [-1942.435] (-1936.093) -- 0:02:57
      132500 -- (-1941.453) [-1931.877] (-1932.841) (-1934.736) * (-1941.160) (-1935.277) (-1943.283) [-1935.430] -- 0:02:56
      133000 -- (-1935.635) (-1937.433) [-1936.173] (-1940.011) * (-1940.470) (-1936.390) [-1935.762] (-1933.023) -- 0:02:56
      133500 -- (-1936.802) [-1931.519] (-1945.619) (-1943.200) * [-1939.243] (-1933.025) (-1931.023) (-1936.368) -- 0:03:01
      134000 -- (-1934.605) (-1940.279) [-1943.163] (-1932.927) * (-1937.364) (-1934.841) (-1931.822) [-1932.000] -- 0:03:00
      134500 -- (-1934.280) (-1940.977) (-1939.112) [-1931.900] * (-1929.150) (-1939.240) (-1932.668) [-1936.685] -- 0:03:00
      135000 -- (-1936.713) [-1940.551] (-1936.810) (-1934.913) * (-1939.868) [-1942.274] (-1936.968) (-1932.880) -- 0:02:59

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-1935.843) [-1931.896] (-1933.883) (-1935.717) * (-1933.190) (-1941.825) (-1940.876) [-1933.705] -- 0:02:58
      136000 -- (-1940.627) (-1939.481) (-1940.065) [-1935.020] * (-1942.105) [-1932.470] (-1935.212) (-1931.912) -- 0:02:57
      136500 -- (-1931.853) [-1930.894] (-1941.024) (-1933.907) * (-1937.327) (-1934.749) [-1933.796] (-1930.993) -- 0:02:57
      137000 -- [-1930.601] (-1935.286) (-1929.832) (-1938.927) * (-1937.411) (-1933.567) [-1928.860] (-1933.223) -- 0:02:56
      137500 -- (-1934.987) [-1933.843] (-1932.393) (-1936.457) * (-1933.836) (-1932.840) (-1933.019) [-1933.132] -- 0:02:55
      138000 -- (-1934.995) [-1932.575] (-1937.055) (-1934.705) * (-1931.147) (-1936.814) (-1932.560) [-1941.715] -- 0:03:01
      138500 -- (-1935.358) [-1933.627] (-1938.876) (-1942.650) * [-1930.713] (-1943.217) (-1938.468) (-1942.231) -- 0:03:00
      139000 -- (-1932.849) [-1935.098] (-1942.597) (-1936.675) * (-1933.850) (-1936.773) (-1938.481) [-1936.894] -- 0:02:59
      139500 -- (-1934.385) [-1936.092] (-1937.258) (-1941.780) * (-1936.651) (-1939.863) [-1928.999] (-1933.012) -- 0:02:58
      140000 -- (-1937.832) [-1940.665] (-1930.348) (-1936.428) * (-1934.595) (-1940.624) [-1932.517] (-1932.683) -- 0:02:58

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-1932.907) (-1940.582) [-1936.396] (-1935.878) * [-1928.773] (-1943.174) (-1932.344) (-1938.532) -- 0:02:57
      141000 -- [-1938.293] (-1933.068) (-1933.141) (-1934.793) * (-1932.157) (-1937.131) [-1933.340] (-1932.909) -- 0:02:56
      141500 -- (-1938.845) [-1933.590] (-1932.882) (-1942.994) * (-1932.780) (-1937.969) (-1939.457) [-1936.654] -- 0:02:55
      142000 -- (-1934.735) (-1932.790) (-1940.348) [-1940.978] * (-1936.615) [-1944.135] (-1937.751) (-1935.093) -- 0:02:55
      142500 -- [-1931.640] (-1931.526) (-1938.598) (-1937.279) * (-1938.173) (-1934.966) [-1933.635] (-1943.502) -- 0:02:54
      143000 -- [-1936.121] (-1931.807) (-1935.207) (-1938.930) * (-1936.676) (-1937.804) (-1935.009) [-1943.845] -- 0:02:59
      143500 -- (-1936.864) (-1929.411) [-1932.339] (-1933.136) * [-1933.923] (-1938.587) (-1934.942) (-1942.361) -- 0:02:59
      144000 -- (-1939.128) (-1935.513) [-1934.411] (-1935.511) * (-1936.344) (-1929.853) [-1934.271] (-1938.576) -- 0:02:58
      144500 -- (-1938.079) (-1934.248) [-1936.004] (-1940.137) * (-1937.759) [-1931.597] (-1936.865) (-1937.492) -- 0:02:57
      145000 -- (-1936.013) [-1933.688] (-1933.222) (-1937.670) * (-1938.842) (-1935.040) (-1936.959) [-1936.423] -- 0:02:56

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-1936.450) (-1931.996) [-1934.340] (-1940.054) * (-1944.137) (-1936.656) (-1932.359) [-1936.348] -- 0:02:56
      146000 -- [-1938.791] (-1936.587) (-1936.566) (-1939.109) * (-1934.973) [-1930.924] (-1934.862) (-1932.655) -- 0:02:55
      146500 -- [-1932.878] (-1936.316) (-1941.335) (-1935.592) * (-1937.472) [-1933.463] (-1936.378) (-1934.104) -- 0:02:54
      147000 -- (-1937.263) (-1932.064) [-1939.179] (-1935.609) * (-1943.584) [-1932.290] (-1937.653) (-1932.806) -- 0:02:54
      147500 -- [-1941.642] (-1932.281) (-1938.755) (-1934.877) * (-1933.192) (-1937.735) (-1934.713) [-1934.856] -- 0:02:59
      148000 -- (-1937.698) [-1934.951] (-1945.759) (-1936.648) * [-1938.945] (-1933.518) (-1932.857) (-1933.227) -- 0:02:58
      148500 -- [-1932.845] (-1936.174) (-1942.319) (-1938.259) * (-1937.376) (-1931.609) (-1939.404) [-1937.968] -- 0:02:57
      149000 -- (-1934.639) (-1934.705) (-1938.729) [-1936.674] * (-1936.596) [-1933.863] (-1943.006) (-1934.719) -- 0:02:57
      149500 -- (-1934.855) (-1937.147) (-1934.636) [-1935.299] * (-1946.452) (-1935.529) [-1935.798] (-1934.592) -- 0:02:56
      150000 -- (-1943.992) (-1931.863) [-1934.228] (-1938.886) * (-1941.552) (-1934.843) [-1934.711] (-1931.804) -- 0:02:55

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-1939.901) (-1933.181) [-1929.297] (-1942.999) * (-1937.338) (-1934.555) [-1934.927] (-1940.773) -- 0:02:54
      151000 -- [-1935.330] (-1933.900) (-1942.977) (-1937.075) * (-1932.649) (-1940.749) [-1933.996] (-1935.744) -- 0:02:54
      151500 -- [-1934.426] (-1932.012) (-1943.484) (-1936.469) * (-1935.463) [-1930.741] (-1930.903) (-1933.146) -- 0:02:53
      152000 -- (-1932.335) [-1934.979] (-1938.646) (-1939.603) * (-1935.294) [-1936.284] (-1936.697) (-1941.191) -- 0:02:52
      152500 -- [-1935.970] (-1934.936) (-1935.069) (-1942.598) * (-1931.826) [-1937.135] (-1937.095) (-1937.164) -- 0:02:57
      153000 -- (-1940.284) (-1939.015) [-1932.595] (-1941.621) * [-1933.778] (-1933.465) (-1934.883) (-1937.217) -- 0:02:57
      153500 -- (-1939.071) (-1940.769) [-1931.483] (-1941.011) * (-1936.751) [-1941.761] (-1942.154) (-1936.606) -- 0:02:56
      154000 -- (-1931.567) (-1938.815) (-1931.878) [-1937.620] * (-1940.647) (-1936.815) (-1940.147) [-1937.443] -- 0:02:55
      154500 -- (-1932.076) (-1933.584) (-1935.557) [-1943.538] * [-1933.478] (-1942.276) (-1932.872) (-1931.420) -- 0:02:55
      155000 -- [-1937.501] (-1939.209) (-1943.367) (-1941.270) * (-1939.158) (-1938.389) [-1933.883] (-1940.141) -- 0:02:54

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-1933.501) (-1938.479) [-1932.035] (-1935.805) * (-1939.672) [-1932.479] (-1937.513) (-1940.348) -- 0:02:53
      156000 -- (-1931.141) [-1940.648] (-1933.743) (-1935.195) * (-1936.266) (-1939.551) (-1930.352) [-1938.203] -- 0:02:53
      156500 -- (-1937.245) (-1934.045) [-1938.072] (-1937.596) * [-1935.853] (-1936.329) (-1933.170) (-1935.247) -- 0:02:52
      157000 -- (-1938.928) (-1937.513) (-1936.759) [-1933.883] * [-1931.368] (-1935.148) (-1937.031) (-1941.500) -- 0:02:57
      157500 -- [-1932.730] (-1933.445) (-1939.846) (-1933.263) * [-1934.429] (-1937.792) (-1934.067) (-1938.513) -- 0:02:56
      158000 -- [-1930.090] (-1933.300) (-1935.334) (-1934.322) * (-1938.490) (-1938.581) [-1938.531] (-1940.650) -- 0:02:55
      158500 -- (-1938.625) (-1944.218) (-1937.895) [-1936.445] * (-1938.328) (-1936.619) [-1934.916] (-1939.841) -- 0:02:55
      159000 -- (-1934.172) [-1941.492] (-1936.810) (-1941.230) * (-1936.490) (-1950.140) (-1930.829) [-1935.425] -- 0:02:54
      159500 -- (-1938.153) (-1934.703) (-1937.769) [-1934.357] * (-1935.692) [-1944.060] (-1937.579) (-1936.352) -- 0:02:53
      160000 -- (-1941.011) (-1945.450) (-1939.518) [-1931.451] * [-1934.702] (-1939.148) (-1935.598) (-1931.149) -- 0:02:53

      Average standard deviation of split frequencies: 0.000000

      160500 -- [-1931.821] (-1930.832) (-1935.440) (-1935.165) * (-1932.700) (-1937.910) (-1932.806) [-1931.224] -- 0:02:52
      161000 -- (-1934.669) (-1940.101) (-1936.205) [-1933.043] * (-1936.696) [-1938.677] (-1935.026) (-1940.559) -- 0:02:57
      161500 -- (-1943.556) (-1937.275) [-1933.872] (-1936.330) * [-1932.201] (-1942.700) (-1939.352) (-1933.575) -- 0:02:56
      162000 -- (-1932.810) [-1934.947] (-1933.347) (-1936.192) * (-1941.383) [-1933.710] (-1936.163) (-1934.796) -- 0:02:55
      162500 -- [-1935.459] (-1934.808) (-1936.502) (-1934.586) * [-1938.330] (-1932.235) (-1937.372) (-1947.577) -- 0:02:55
      163000 -- (-1930.945) (-1935.820) (-1936.111) [-1937.785] * (-1931.254) [-1934.539] (-1937.028) (-1935.402) -- 0:02:54
      163500 -- (-1939.206) [-1941.230] (-1933.755) (-1934.316) * (-1932.481) (-1935.460) (-1936.587) [-1933.247] -- 0:02:53
      164000 -- [-1938.041] (-1935.234) (-1936.051) (-1932.517) * (-1934.242) (-1937.633) (-1939.751) [-1937.948] -- 0:02:53
      164500 -- (-1939.668) [-1937.383] (-1945.004) (-1935.741) * (-1933.773) (-1941.780) [-1934.300] (-1934.660) -- 0:02:52
      165000 -- (-1937.615) (-1935.378) [-1936.661] (-1933.628) * [-1932.515] (-1949.272) (-1932.667) (-1931.541) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      165500 -- (-1938.933) (-1938.128) (-1944.151) [-1930.740] * (-1935.056) (-1937.446) [-1934.453] (-1932.967) -- 0:02:51
      166000 -- (-1940.529) (-1931.896) (-1930.866) [-1933.922] * (-1933.734) (-1936.785) (-1933.158) [-1937.854] -- 0:02:55
      166500 -- (-1937.837) (-1934.798) [-1932.931] (-1934.349) * (-1935.566) [-1934.043] (-1933.891) (-1934.074) -- 0:02:55
      167000 -- (-1935.425) (-1939.507) [-1938.236] (-1933.312) * (-1935.626) (-1932.252) [-1931.468] (-1931.989) -- 0:02:54
      167500 -- [-1940.283] (-1945.134) (-1932.777) (-1934.750) * (-1935.470) (-1934.917) (-1932.936) [-1930.056] -- 0:02:53
      168000 -- [-1931.273] (-1935.496) (-1932.289) (-1933.559) * (-1933.915) [-1936.435] (-1936.443) (-1934.236) -- 0:02:53
      168500 -- (-1940.139) (-1941.544) (-1932.831) [-1933.660] * [-1929.965] (-1935.065) (-1938.820) (-1937.924) -- 0:02:52
      169000 -- (-1938.198) [-1937.794] (-1940.841) (-1931.893) * (-1931.892) (-1938.219) (-1935.914) [-1933.734] -- 0:02:52
      169500 -- [-1933.870] (-1943.637) (-1943.312) (-1937.904) * (-1935.346) (-1948.557) (-1948.695) [-1932.307] -- 0:02:51
      170000 -- (-1933.009) [-1935.584] (-1931.182) (-1939.168) * [-1938.445] (-1934.707) (-1938.130) (-1934.404) -- 0:02:50

      Average standard deviation of split frequencies: 0.000000

      170500 -- [-1930.961] (-1937.336) (-1933.369) (-1935.353) * (-1938.582) (-1931.831) [-1930.195] (-1934.111) -- 0:02:50
      171000 -- [-1934.605] (-1932.483) (-1941.310) (-1934.585) * (-1938.343) (-1934.974) (-1933.041) [-1933.094] -- 0:02:54
      171500 -- (-1935.984) (-1936.460) [-1933.491] (-1936.542) * [-1938.276] (-1933.455) (-1935.924) (-1934.049) -- 0:02:53
      172000 -- [-1932.622] (-1932.624) (-1936.250) (-1934.386) * (-1937.059) (-1935.356) (-1932.288) [-1936.021] -- 0:02:53
      172500 -- (-1937.124) [-1932.284] (-1934.849) (-1935.747) * (-1939.861) (-1935.436) [-1933.867] (-1938.442) -- 0:02:52
      173000 -- (-1934.862) [-1931.909] (-1939.181) (-1932.025) * [-1937.979] (-1930.480) (-1934.316) (-1940.174) -- 0:02:52
      173500 -- [-1938.217] (-1940.735) (-1940.441) (-1935.448) * (-1938.012) (-1938.935) (-1937.388) [-1934.935] -- 0:02:51
      174000 -- (-1941.692) [-1938.027] (-1936.716) (-1935.002) * [-1937.796] (-1934.391) (-1932.462) (-1936.790) -- 0:02:50
      174500 -- (-1943.883) (-1932.191) (-1934.717) [-1937.620] * [-1937.415] (-1934.337) (-1942.999) (-1938.135) -- 0:02:50
      175000 -- (-1936.225) (-1935.849) (-1938.099) [-1935.853] * (-1937.877) (-1940.366) [-1933.822] (-1941.102) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      175500 -- [-1935.004] (-1933.142) (-1935.092) (-1934.055) * (-1935.043) (-1941.844) [-1935.307] (-1939.865) -- 0:02:49
      176000 -- (-1938.202) (-1936.157) (-1938.206) [-1933.832] * (-1942.664) (-1936.759) (-1939.748) [-1939.095] -- 0:02:53
      176500 -- (-1933.274) (-1936.235) [-1932.132] (-1935.141) * [-1937.721] (-1944.728) (-1937.952) (-1939.859) -- 0:02:52
      177000 -- (-1935.425) (-1940.188) [-1935.189] (-1937.242) * [-1940.230] (-1946.505) (-1928.978) (-1937.213) -- 0:02:52
      177500 -- (-1937.057) [-1937.277] (-1937.490) (-1933.615) * (-1942.375) [-1932.264] (-1934.459) (-1945.142) -- 0:02:51
      178000 -- (-1933.416) (-1931.169) [-1932.126] (-1935.052) * [-1938.792] (-1932.218) (-1945.235) (-1943.197) -- 0:02:50
      178500 -- (-1938.052) [-1935.649] (-1939.274) (-1935.203) * (-1936.483) (-1938.431) [-1934.165] (-1940.383) -- 0:02:50
      179000 -- [-1933.397] (-1936.493) (-1935.452) (-1939.349) * (-1942.451) (-1931.401) [-1931.867] (-1936.909) -- 0:02:49
      179500 -- [-1931.854] (-1936.546) (-1934.281) (-1939.466) * (-1937.494) (-1932.725) [-1930.429] (-1938.730) -- 0:02:49
      180000 -- [-1934.435] (-1935.106) (-1935.134) (-1931.693) * [-1935.395] (-1934.237) (-1936.473) (-1931.382) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-1933.654) (-1937.786) (-1932.651) [-1933.535] * (-1933.752) [-1941.174] (-1934.482) (-1934.724) -- 0:02:47
      181000 -- (-1943.899) (-1946.536) [-1929.225] (-1933.663) * [-1933.672] (-1937.735) (-1931.900) (-1933.627) -- 0:02:51
      181500 -- (-1943.096) (-1938.165) [-1932.576] (-1938.262) * [-1931.951] (-1937.807) (-1937.970) (-1942.278) -- 0:02:51
      182000 -- (-1940.370) [-1941.246] (-1937.480) (-1933.947) * (-1934.793) (-1931.593) [-1935.148] (-1933.973) -- 0:02:50
      182500 -- [-1937.174] (-1933.155) (-1934.941) (-1935.946) * (-1932.296) (-1933.910) [-1939.514] (-1937.810) -- 0:02:50
      183000 -- [-1937.590] (-1935.482) (-1932.652) (-1936.587) * (-1934.325) (-1933.960) [-1935.718] (-1936.906) -- 0:02:49
      183500 -- (-1936.879) [-1936.854] (-1934.074) (-1934.600) * (-1939.400) (-1938.049) [-1933.593] (-1939.443) -- 0:02:49
      184000 -- [-1937.013] (-1940.964) (-1935.806) (-1931.032) * (-1936.873) (-1934.334) [-1933.520] (-1932.195) -- 0:02:48
      184500 -- (-1942.447) (-1940.821) (-1935.643) [-1938.863] * (-1942.865) (-1936.408) (-1934.275) [-1935.544] -- 0:02:47
      185000 -- (-1935.748) (-1939.067) (-1934.320) [-1933.686] * (-1934.124) (-1937.979) [-1935.234] (-1946.602) -- 0:02:47

      Average standard deviation of split frequencies: 0.000000

      185500 -- [-1932.143] (-1937.110) (-1933.792) (-1935.519) * (-1932.924) [-1934.885] (-1939.344) (-1941.651) -- 0:02:46
      186000 -- (-1934.025) [-1936.782] (-1937.909) (-1934.694) * (-1933.932) (-1933.351) (-1939.078) [-1934.602] -- 0:02:50
      186500 -- (-1934.637) (-1936.092) (-1936.484) [-1935.928] * (-1936.859) (-1933.593) [-1936.879] (-1935.026) -- 0:02:50
      187000 -- (-1933.830) [-1934.935] (-1938.364) (-1934.073) * (-1932.186) (-1935.603) (-1939.091) [-1933.417] -- 0:02:49
      187500 -- [-1932.879] (-1941.344) (-1939.091) (-1934.336) * (-1931.908) (-1934.439) [-1940.208] (-1928.192) -- 0:02:49
      188000 -- (-1936.396) (-1942.231) [-1934.919] (-1937.831) * (-1933.968) (-1935.567) [-1938.188] (-1929.468) -- 0:02:48
      188500 -- (-1936.590) (-1945.575) (-1941.906) [-1941.017] * (-1935.006) (-1935.241) (-1939.835) [-1935.790] -- 0:02:47
      189000 -- [-1930.920] (-1945.043) (-1935.383) (-1936.577) * (-1936.076) (-1938.205) (-1936.859) [-1935.396] -- 0:02:47
      189500 -- (-1931.875) (-1939.538) (-1931.723) [-1933.609] * [-1937.207] (-1932.466) (-1933.682) (-1939.976) -- 0:02:46
      190000 -- [-1935.073] (-1938.207) (-1932.993) (-1931.297) * (-1939.701) [-1936.280] (-1935.426) (-1936.397) -- 0:02:46

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-1934.580) [-1936.577] (-1936.222) (-1941.462) * (-1931.906) (-1938.036) (-1931.957) [-1933.916] -- 0:02:45
      191000 -- [-1937.417] (-1937.881) (-1936.318) (-1931.282) * (-1935.011) [-1932.356] (-1936.647) (-1935.703) -- 0:02:49
      191500 -- [-1939.342] (-1945.342) (-1936.577) (-1934.500) * (-1937.713) (-1942.616) [-1934.963] (-1938.888) -- 0:02:48
      192000 -- (-1949.715) [-1932.293] (-1936.638) (-1941.527) * (-1937.383) (-1937.529) [-1932.439] (-1938.094) -- 0:02:48
      192500 -- (-1935.085) (-1935.024) (-1934.160) [-1937.785] * (-1932.558) (-1941.561) [-1936.339] (-1938.187) -- 0:02:47
      193000 -- [-1935.204] (-1939.952) (-1942.179) (-1932.995) * (-1938.595) (-1935.669) (-1939.580) [-1932.006] -- 0:02:47
      193500 -- (-1934.702) (-1938.280) [-1946.840] (-1939.006) * (-1936.502) (-1935.061) [-1932.415] (-1940.823) -- 0:02:46
      194000 -- [-1933.193] (-1935.894) (-1938.793) (-1933.164) * (-1931.852) [-1939.540] (-1931.170) (-1935.998) -- 0:02:46
      194500 -- (-1933.140) (-1936.536) [-1936.080] (-1932.895) * (-1938.676) [-1930.163] (-1935.822) (-1937.848) -- 0:02:45
      195000 -- (-1936.233) [-1932.375] (-1936.619) (-1934.089) * (-1935.349) (-1930.010) [-1939.295] (-1936.146) -- 0:02:45

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-1937.449) (-1930.881) [-1933.040] (-1940.301) * (-1935.122) (-1931.367) (-1942.110) [-1938.743] -- 0:02:44
      196000 -- (-1937.036) (-1936.621) (-1933.623) [-1936.990] * (-1932.314) (-1937.633) [-1936.731] (-1936.471) -- 0:02:48
      196500 -- (-1934.027) [-1934.183] (-1935.761) (-1937.548) * (-1937.585) [-1932.936] (-1944.345) (-1937.677) -- 0:02:47
      197000 -- (-1940.177) [-1934.084] (-1932.247) (-1941.888) * (-1932.662) (-1934.222) [-1932.786] (-1941.749) -- 0:02:47
      197500 -- [-1933.466] (-1934.591) (-1939.181) (-1937.152) * [-1934.950] (-1937.298) (-1932.370) (-1939.327) -- 0:02:46
      198000 -- (-1934.297) (-1938.916) (-1930.317) [-1936.013] * (-1937.829) (-1935.297) [-1933.883] (-1936.612) -- 0:02:46
      198500 -- [-1939.328] (-1935.169) (-1939.478) (-1933.185) * (-1939.791) (-1936.914) (-1936.119) [-1939.620] -- 0:02:45
      199000 -- [-1935.471] (-1938.250) (-1934.964) (-1940.331) * (-1936.407) [-1933.817] (-1937.561) (-1936.875) -- 0:02:45
      199500 -- (-1940.324) [-1935.481] (-1944.304) (-1933.447) * (-1933.766) [-1933.149] (-1935.380) (-1936.047) -- 0:02:44
      200000 -- (-1942.309) [-1934.113] (-1940.450) (-1936.982) * (-1936.136) (-1930.820) [-1932.813] (-1934.784) -- 0:02:44

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-1942.285) [-1933.428] (-1945.469) (-1935.612) * (-1942.193) (-1937.467) (-1933.182) [-1934.592] -- 0:02:43
      201000 -- (-1933.142) (-1932.576) (-1941.635) [-1937.599] * (-1937.954) (-1935.917) [-1935.625] (-1937.702) -- 0:02:46
      201500 -- (-1934.655) [-1934.068] (-1937.213) (-1939.544) * [-1934.539] (-1934.422) (-1944.464) (-1933.814) -- 0:02:46
      202000 -- (-1939.918) [-1931.301] (-1935.084) (-1931.763) * [-1941.574] (-1940.184) (-1940.423) (-1942.782) -- 0:02:45
      202500 -- (-1933.660) [-1935.540] (-1933.133) (-1930.962) * (-1935.039) [-1936.455] (-1930.475) (-1941.190) -- 0:02:45
      203000 -- (-1942.666) (-1938.254) (-1941.476) [-1940.996] * [-1935.694] (-1941.658) (-1937.980) (-1941.662) -- 0:02:44
      203500 -- (-1940.301) (-1934.623) (-1941.520) [-1939.035] * [-1932.414] (-1934.093) (-1938.845) (-1941.327) -- 0:02:44
      204000 -- (-1934.443) (-1942.450) (-1940.825) [-1935.865] * [-1932.795] (-1933.384) (-1937.986) (-1940.173) -- 0:02:43
      204500 -- (-1933.473) (-1931.094) (-1940.083) [-1935.792] * [-1934.787] (-1935.821) (-1931.654) (-1940.269) -- 0:02:43
      205000 -- (-1935.966) (-1935.327) (-1942.254) [-1938.626] * (-1933.770) [-1934.076] (-1930.477) (-1936.744) -- 0:02:42

      Average standard deviation of split frequencies: 0.000000

      205500 -- [-1936.065] (-1933.850) (-1934.111) (-1935.200) * (-1932.569) (-1935.218) (-1928.378) [-1934.484] -- 0:02:42
      206000 -- (-1939.538) [-1931.092] (-1941.240) (-1931.728) * (-1934.961) [-1936.675] (-1932.955) (-1936.525) -- 0:02:45
      206500 -- (-1941.596) (-1936.694) (-1934.769) [-1932.509] * (-1941.476) (-1935.233) (-1940.270) [-1937.411] -- 0:02:45
      207000 -- (-1940.523) [-1936.530] (-1938.159) (-1939.907) * (-1936.722) [-1934.269] (-1932.684) (-1934.020) -- 0:02:44
      207500 -- (-1938.705) (-1936.615) [-1933.189] (-1938.507) * (-1933.544) (-1936.394) [-1944.323] (-1940.802) -- 0:02:44
      208000 -- (-1942.588) [-1936.279] (-1938.197) (-1934.025) * (-1936.795) [-1938.745] (-1940.827) (-1937.283) -- 0:02:43
      208500 -- (-1943.750) (-1934.572) (-1932.695) [-1934.285] * [-1936.466] (-1937.252) (-1936.261) (-1934.062) -- 0:02:43
      209000 -- (-1952.101) [-1938.853] (-1938.516) (-1937.449) * (-1935.623) [-1934.647] (-1940.392) (-1937.340) -- 0:02:42
      209500 -- (-1941.009) (-1935.677) [-1940.538] (-1933.700) * (-1939.494) [-1929.850] (-1944.112) (-1936.732) -- 0:02:42
      210000 -- (-1939.724) [-1937.678] (-1934.532) (-1948.485) * (-1936.916) [-1932.678] (-1934.178) (-1937.958) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-1941.460) (-1938.692) [-1934.118] (-1933.603) * [-1936.065] (-1939.932) (-1933.416) (-1935.757) -- 0:02:41
      211000 -- [-1943.110] (-1940.906) (-1932.635) (-1935.168) * (-1936.391) (-1937.070) (-1942.845) [-1932.683] -- 0:02:44
      211500 -- (-1937.191) (-1941.807) (-1936.198) [-1935.978] * (-1941.814) (-1935.735) (-1937.178) [-1939.225] -- 0:02:44
      212000 -- (-1936.794) (-1937.551) (-1935.647) [-1934.059] * (-1945.071) [-1938.650] (-1938.169) (-1939.464) -- 0:02:43
      212500 -- [-1936.050] (-1937.928) (-1932.576) (-1933.432) * (-1935.179) (-1939.631) (-1932.880) [-1934.337] -- 0:02:43
      213000 -- (-1942.210) (-1939.555) [-1933.279] (-1937.728) * (-1935.463) (-1940.354) [-1935.892] (-1940.130) -- 0:02:42
      213500 -- (-1937.283) (-1934.026) [-1940.007] (-1931.185) * [-1945.647] (-1932.206) (-1934.025) (-1930.292) -- 0:02:42
      214000 -- [-1936.651] (-1937.377) (-1939.022) (-1940.232) * (-1942.225) [-1935.598] (-1939.691) (-1933.468) -- 0:02:41
      214500 -- (-1931.602) [-1938.755] (-1933.148) (-1937.841) * (-1941.536) (-1933.543) (-1936.622) [-1937.471] -- 0:02:41
      215000 -- [-1934.867] (-1934.992) (-1945.433) (-1935.352) * (-1934.954) [-1933.124] (-1936.656) (-1935.499) -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-1935.461) [-1934.548] (-1942.430) (-1935.913) * (-1938.845) [-1935.235] (-1934.757) (-1935.913) -- 0:02:40
      216000 -- (-1936.673) (-1937.304) (-1940.006) [-1932.293] * (-1939.047) [-1936.432] (-1939.409) (-1934.846) -- 0:02:43
      216500 -- (-1931.752) (-1936.486) (-1938.287) [-1942.300] * [-1936.264] (-1933.325) (-1935.624) (-1938.781) -- 0:02:42
      217000 -- [-1937.384] (-1933.520) (-1938.844) (-1937.607) * [-1935.856] (-1931.888) (-1940.043) (-1938.354) -- 0:02:42
      217500 -- (-1934.794) [-1932.307] (-1941.442) (-1935.280) * (-1942.294) (-1937.853) [-1943.542] (-1934.820) -- 0:02:41
      218000 -- [-1930.138] (-1935.420) (-1935.198) (-1937.022) * (-1938.267) [-1931.277] (-1939.917) (-1936.697) -- 0:02:41
      218500 -- (-1932.530) [-1934.167] (-1936.301) (-1939.229) * (-1936.731) (-1937.173) [-1933.502] (-1933.949) -- 0:02:40
      219000 -- [-1934.640] (-1930.924) (-1937.339) (-1936.078) * (-1939.243) (-1936.530) [-1936.961] (-1937.022) -- 0:02:40
      219500 -- (-1937.619) (-1934.526) (-1935.062) [-1934.633] * (-1937.461) (-1936.908) [-1935.335] (-1930.377) -- 0:02:40
      220000 -- (-1940.693) [-1930.482] (-1942.003) (-1942.516) * (-1934.851) [-1933.110] (-1937.935) (-1930.851) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-1945.828) [-1936.214] (-1945.409) (-1939.621) * (-1935.207) (-1931.853) (-1938.558) [-1936.810] -- 0:02:39
      221000 -- (-1942.487) (-1938.605) [-1938.267] (-1934.902) * [-1941.260] (-1935.132) (-1931.614) (-1937.729) -- 0:02:42
      221500 -- [-1933.824] (-1941.003) (-1940.486) (-1935.458) * (-1934.648) [-1931.146] (-1940.468) (-1939.431) -- 0:02:41
      222000 -- (-1936.804) (-1936.616) (-1939.281) [-1936.451] * [-1931.762] (-1936.193) (-1944.125) (-1941.046) -- 0:02:41
      222500 -- [-1934.957] (-1937.901) (-1938.321) (-1934.560) * [-1932.841] (-1952.430) (-1934.536) (-1940.703) -- 0:02:40
      223000 -- (-1934.060) [-1938.113] (-1937.949) (-1936.606) * (-1937.089) (-1941.614) (-1931.444) [-1933.247] -- 0:02:40
      223500 -- (-1935.493) (-1942.585) [-1932.999] (-1939.961) * [-1933.283] (-1945.354) (-1932.375) (-1933.304) -- 0:02:39
      224000 -- [-1934.808] (-1944.471) (-1934.923) (-1938.051) * [-1931.694] (-1935.715) (-1932.245) (-1939.255) -- 0:02:39
      224500 -- [-1937.166] (-1941.678) (-1934.506) (-1937.914) * [-1934.361] (-1938.659) (-1934.596) (-1935.211) -- 0:02:38
      225000 -- [-1941.850] (-1942.584) (-1932.627) (-1939.785) * (-1942.283) [-1936.220] (-1934.500) (-1940.355) -- 0:02:38

      Average standard deviation of split frequencies: 0.000000

      225500 -- [-1938.407] (-1938.715) (-1934.384) (-1942.541) * (-1937.931) [-1937.397] (-1936.944) (-1933.971) -- 0:02:37
      226000 -- [-1936.803] (-1937.713) (-1935.904) (-1938.590) * (-1939.712) (-1942.761) [-1932.209] (-1936.025) -- 0:02:40
      226500 -- (-1936.062) [-1939.993] (-1941.582) (-1935.942) * (-1931.983) (-1937.162) [-1933.849] (-1931.032) -- 0:02:40
      227000 -- (-1941.171) (-1933.590) (-1935.514) [-1935.912] * [-1935.728] (-1934.330) (-1939.756) (-1940.533) -- 0:02:40
      227500 -- (-1940.199) (-1934.331) [-1932.893] (-1936.339) * (-1937.230) (-1935.547) (-1933.078) [-1935.291] -- 0:02:39
      228000 -- (-1938.191) (-1933.616) [-1935.525] (-1933.506) * (-1935.127) [-1931.633] (-1933.494) (-1938.540) -- 0:02:39
      228500 -- (-1934.840) (-1935.711) (-1937.320) [-1936.492] * [-1932.946] (-1934.623) (-1930.496) (-1935.880) -- 0:02:38
      229000 -- [-1930.838] (-1936.572) (-1938.608) (-1929.763) * (-1938.085) (-1934.980) (-1932.860) [-1933.674] -- 0:02:38
      229500 -- [-1934.040] (-1932.712) (-1937.823) (-1934.503) * [-1938.074] (-1934.109) (-1929.634) (-1939.771) -- 0:02:37
      230000 -- (-1937.870) [-1935.893] (-1938.757) (-1945.324) * (-1936.447) [-1937.876] (-1936.209) (-1941.506) -- 0:02:37

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-1934.332) (-1930.450) [-1943.617] (-1933.767) * [-1939.794] (-1937.278) (-1938.566) (-1935.426) -- 0:02:36
      231000 -- (-1939.647) [-1934.026] (-1950.976) (-1941.731) * (-1934.460) (-1930.885) [-1935.352] (-1934.190) -- 0:02:39
      231500 -- (-1933.036) (-1935.563) [-1935.864] (-1940.216) * (-1944.630) [-1934.621] (-1935.663) (-1931.703) -- 0:02:39
      232000 -- [-1935.090] (-1934.907) (-1934.031) (-1933.347) * (-1933.598) (-1940.390) (-1936.546) [-1934.761] -- 0:02:38
      232500 -- (-1932.992) (-1935.353) [-1932.319] (-1937.985) * (-1928.313) [-1939.035] (-1942.064) (-1935.405) -- 0:02:38
      233000 -- (-1932.440) (-1935.599) [-1931.999] (-1933.620) * (-1937.850) [-1932.920] (-1939.974) (-1936.958) -- 0:02:38
      233500 -- (-1934.303) [-1934.360] (-1935.126) (-1941.379) * [-1932.864] (-1933.771) (-1935.773) (-1931.316) -- 0:02:37
      234000 -- (-1936.962) [-1937.588] (-1936.599) (-1937.311) * [-1934.110] (-1932.004) (-1932.897) (-1931.868) -- 0:02:37
      234500 -- (-1935.272) (-1943.401) (-1933.521) [-1937.298] * (-1943.332) [-1932.764] (-1936.721) (-1934.695) -- 0:02:36
      235000 -- (-1934.200) [-1936.180] (-1937.679) (-1945.290) * [-1935.906] (-1940.135) (-1942.322) (-1941.075) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-1935.370) (-1933.287) [-1932.153] (-1935.943) * (-1943.317) (-1932.707) [-1935.354] (-1939.889) -- 0:02:39
      236000 -- (-1941.382) (-1935.232) [-1930.085] (-1940.722) * [-1933.093] (-1935.680) (-1939.631) (-1937.347) -- 0:02:38
      236500 -- (-1936.338) (-1935.951) [-1931.460] (-1941.680) * (-1934.753) [-1933.684] (-1938.250) (-1935.195) -- 0:02:38
      237000 -- [-1939.816] (-1933.737) (-1938.974) (-1935.829) * (-1934.067) (-1936.007) (-1938.949) [-1932.525] -- 0:02:37
      237500 -- (-1936.738) (-1941.583) (-1944.745) [-1933.802] * (-1939.104) (-1935.507) (-1943.323) [-1936.793] -- 0:02:37
      238000 -- (-1933.431) [-1944.918] (-1940.772) (-1931.621) * (-1931.300) (-1934.904) (-1938.209) [-1936.351] -- 0:02:36
      238500 -- (-1936.963) [-1937.626] (-1937.461) (-1933.592) * [-1937.812] (-1934.305) (-1935.776) (-1934.738) -- 0:02:36
      239000 -- (-1936.636) (-1936.186) (-1938.130) [-1935.720] * (-1937.740) [-1933.366] (-1937.152) (-1942.422) -- 0:02:36
      239500 -- (-1932.952) (-1934.804) [-1936.371] (-1936.530) * (-1935.832) (-1930.331) [-1932.920] (-1937.023) -- 0:02:35
      240000 -- (-1932.039) (-1936.926) [-1935.530] (-1936.774) * (-1938.316) (-1932.313) (-1936.828) [-1931.836] -- 0:02:35

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-1936.202) [-1937.676] (-1938.710) (-1935.924) * (-1936.245) (-1943.228) [-1937.566] (-1935.425) -- 0:02:37
      241000 -- [-1938.459] (-1936.800) (-1947.538) (-1938.414) * (-1936.585) (-1933.837) (-1944.842) [-1933.712] -- 0:02:37
      241500 -- (-1934.385) (-1940.528) [-1936.439] (-1945.610) * (-1936.230) (-1934.631) [-1932.601] (-1942.284) -- 0:02:37
      242000 -- (-1934.933) [-1938.127] (-1938.441) (-1939.767) * (-1933.082) (-1933.687) [-1935.039] (-1934.890) -- 0:02:36
      242500 -- (-1936.210) (-1933.773) [-1934.688] (-1941.075) * (-1935.084) (-1939.112) [-1935.160] (-1937.583) -- 0:02:36
      243000 -- [-1934.011] (-1934.235) (-1937.931) (-1931.422) * (-1940.067) [-1934.988] (-1939.824) (-1938.622) -- 0:02:35
      243500 -- [-1938.522] (-1939.360) (-1934.723) (-1935.546) * (-1943.835) (-1930.228) (-1933.161) [-1931.929] -- 0:02:35
      244000 -- (-1934.397) (-1933.060) (-1941.763) [-1935.710] * (-1939.319) (-1934.268) [-1932.252] (-1933.039) -- 0:02:34
      244500 -- (-1937.898) [-1932.552] (-1940.890) (-1934.362) * [-1933.638] (-1938.467) (-1934.524) (-1935.997) -- 0:02:34
      245000 -- (-1935.827) (-1936.446) (-1932.101) [-1932.691] * (-1934.714) (-1938.641) (-1935.232) [-1936.185] -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-1940.968) (-1933.523) [-1934.009] (-1941.556) * [-1932.929] (-1941.878) (-1932.819) (-1936.814) -- 0:02:36
      246000 -- (-1931.572) [-1934.656] (-1934.338) (-1936.054) * [-1940.876] (-1935.806) (-1936.140) (-1933.535) -- 0:02:36
      246500 -- [-1931.817] (-1933.217) (-1938.317) (-1934.503) * (-1932.459) [-1935.403] (-1939.470) (-1933.693) -- 0:02:35
      247000 -- (-1931.682) [-1931.774] (-1935.094) (-1935.813) * (-1931.895) [-1938.159] (-1931.716) (-1929.821) -- 0:02:35
      247500 -- (-1943.284) (-1934.419) (-1933.503) [-1938.258] * (-1939.258) [-1934.169] (-1936.005) (-1935.879) -- 0:02:35
      248000 -- (-1940.117) (-1935.934) [-1936.207] (-1937.493) * (-1937.695) [-1935.741] (-1942.615) (-1935.703) -- 0:02:34
      248500 -- (-1942.283) [-1934.126] (-1938.402) (-1940.181) * (-1938.476) (-1935.715) [-1942.695] (-1932.399) -- 0:02:34
      249000 -- [-1936.140] (-1937.450) (-1934.788) (-1935.012) * (-1937.876) (-1934.897) (-1937.333) [-1934.197] -- 0:02:33
      249500 -- (-1934.313) (-1934.837) [-1935.708] (-1931.924) * (-1937.442) (-1938.401) (-1941.732) [-1934.822] -- 0:02:33
      250000 -- (-1933.275) [-1931.512] (-1936.836) (-1942.852) * [-1935.748] (-1944.879) (-1934.565) (-1933.647) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-1936.726) (-1936.029) (-1934.052) [-1932.507] * (-1931.785) (-1939.048) [-1935.165] (-1937.724) -- 0:02:35
      251000 -- (-1936.690) (-1939.094) [-1930.641] (-1939.428) * (-1933.598) (-1940.266) [-1934.916] (-1940.509) -- 0:02:35
      251500 -- (-1930.951) (-1933.418) (-1930.873) [-1938.087] * (-1933.859) (-1935.148) (-1937.507) [-1937.383] -- 0:02:34
      252000 -- [-1933.876] (-1931.843) (-1935.512) (-1937.921) * [-1934.235] (-1935.285) (-1936.100) (-1935.336) -- 0:02:34
      252500 -- [-1933.982] (-1931.638) (-1940.763) (-1941.648) * (-1934.421) [-1932.795] (-1931.939) (-1934.142) -- 0:02:33
      253000 -- (-1935.510) [-1930.209] (-1945.514) (-1943.042) * (-1942.765) (-1935.818) (-1932.818) [-1933.665] -- 0:02:33
      253500 -- (-1933.830) [-1933.681] (-1941.788) (-1941.873) * (-1939.225) [-1932.889] (-1934.792) (-1931.898) -- 0:02:33
      254000 -- (-1938.637) [-1938.502] (-1939.180) (-1934.206) * (-1937.376) (-1935.117) (-1936.506) [-1936.956] -- 0:02:32
      254500 -- (-1938.771) [-1932.711] (-1941.632) (-1939.192) * [-1934.420] (-1935.969) (-1936.287) (-1933.237) -- 0:02:32
      255000 -- [-1937.483] (-1939.639) (-1936.956) (-1934.295) * (-1930.994) [-1931.407] (-1938.642) (-1933.543) -- 0:02:31

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-1936.871) [-1938.540] (-1934.525) (-1937.778) * [-1934.351] (-1938.700) (-1938.878) (-1931.705) -- 0:02:34
      256000 -- (-1934.530) (-1934.763) (-1936.855) [-1934.971] * (-1930.190) (-1944.094) (-1943.613) [-1933.974] -- 0:02:34
      256500 -- (-1931.831) [-1931.431] (-1931.639) (-1938.894) * [-1940.614] (-1938.922) (-1933.984) (-1934.298) -- 0:02:33
      257000 -- (-1937.322) [-1931.856] (-1938.831) (-1934.041) * (-1940.170) (-1938.191) [-1934.236] (-1932.957) -- 0:02:33
      257500 -- (-1934.235) (-1939.837) (-1938.399) [-1932.018] * [-1939.799] (-1941.351) (-1932.320) (-1936.202) -- 0:02:32
      258000 -- [-1930.935] (-1933.203) (-1937.404) (-1932.570) * (-1940.436) [-1939.862] (-1935.944) (-1939.118) -- 0:02:32
      258500 -- (-1933.244) (-1934.165) (-1932.951) [-1937.759] * (-1941.314) (-1939.851) [-1934.664] (-1935.119) -- 0:02:32
      259000 -- (-1932.845) (-1937.505) [-1935.977] (-1942.864) * [-1932.489] (-1933.547) (-1935.534) (-1931.840) -- 0:02:31
      259500 -- (-1936.839) (-1949.822) (-1936.748) [-1932.640] * (-1934.919) [-1932.216] (-1936.415) (-1936.950) -- 0:02:31
      260000 -- (-1936.210) [-1937.609] (-1938.533) (-1941.526) * (-1936.818) [-1934.022] (-1940.317) (-1937.808) -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      260500 -- [-1933.005] (-1934.025) (-1933.837) (-1945.387) * (-1931.880) [-1930.388] (-1942.023) (-1935.132) -- 0:02:33
      261000 -- (-1939.929) (-1938.683) (-1933.979) [-1933.683] * [-1937.891] (-1936.375) (-1938.970) (-1931.636) -- 0:02:32
      261500 -- (-1942.864) [-1941.743] (-1931.694) (-1936.467) * (-1933.213) (-1936.863) (-1934.783) [-1935.729] -- 0:02:32
      262000 -- (-1942.092) (-1943.649) [-1932.805] (-1942.147) * (-1934.832) (-1935.367) [-1935.952] (-1935.682) -- 0:02:32
      262500 -- (-1950.731) (-1946.001) (-1932.369) [-1932.286] * (-1932.950) (-1936.596) [-1939.127] (-1937.599) -- 0:02:31
      263000 -- (-1957.777) [-1940.249] (-1931.463) (-1939.520) * (-1935.770) (-1937.377) (-1937.310) [-1934.701] -- 0:02:31
      263500 -- (-1944.468) (-1933.266) [-1937.821] (-1943.615) * (-1942.032) (-1938.757) (-1930.459) [-1935.491] -- 0:02:30
      264000 -- (-1945.498) [-1936.817] (-1940.051) (-1935.130) * (-1933.638) [-1937.636] (-1931.241) (-1937.148) -- 0:02:30
      264500 -- (-1930.565) (-1935.770) (-1940.947) [-1937.630] * [-1938.467] (-1940.141) (-1935.592) (-1938.299) -- 0:02:30
      265000 -- (-1932.037) (-1936.064) [-1933.878] (-1936.311) * (-1938.728) (-1946.711) [-1935.930] (-1935.878) -- 0:02:29

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-1932.772) (-1942.303) (-1936.544) [-1934.733] * (-1942.210) (-1939.871) [-1936.113] (-1934.556) -- 0:02:32
      266000 -- [-1935.718] (-1937.611) (-1938.674) (-1939.062) * (-1934.805) [-1937.685] (-1932.012) (-1934.950) -- 0:02:31
      266500 -- [-1932.086] (-1934.267) (-1938.402) (-1931.235) * [-1931.827] (-1935.445) (-1937.491) (-1936.059) -- 0:02:31
      267000 -- (-1940.167) (-1931.689) (-1944.269) [-1938.588] * (-1934.831) (-1934.511) (-1939.913) [-1931.261] -- 0:02:30
      267500 -- (-1934.680) (-1934.784) [-1944.288] (-1932.751) * (-1935.350) (-1934.112) [-1933.189] (-1936.910) -- 0:02:30
      268000 -- [-1932.782] (-1933.466) (-1936.621) (-1936.623) * (-1935.842) [-1931.207] (-1939.408) (-1933.079) -- 0:02:30
      268500 -- (-1934.571) [-1930.968] (-1944.785) (-1933.061) * (-1934.812) (-1933.360) (-1931.469) [-1936.912] -- 0:02:29
      269000 -- (-1937.256) [-1934.046] (-1940.546) (-1933.035) * (-1938.152) [-1933.280] (-1936.355) (-1940.278) -- 0:02:29
      269500 -- (-1938.178) (-1942.949) [-1937.311] (-1937.031) * [-1941.192] (-1932.164) (-1935.810) (-1931.391) -- 0:02:29
      270000 -- (-1950.791) (-1939.731) [-1935.095] (-1944.256) * [-1935.999] (-1935.276) (-1936.001) (-1933.001) -- 0:02:28

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-1941.491) (-1937.115) [-1933.784] (-1943.337) * [-1936.473] (-1939.538) (-1940.102) (-1934.804) -- 0:02:31
      271000 -- (-1937.765) [-1934.251] (-1930.815) (-1936.369) * (-1936.950) (-1934.468) [-1935.873] (-1940.186) -- 0:02:30
      271500 -- (-1937.703) (-1938.985) [-1939.122] (-1934.242) * (-1937.444) (-1937.281) (-1938.048) [-1938.302] -- 0:02:30
      272000 -- (-1938.299) (-1929.890) (-1933.144) [-1929.183] * [-1932.915] (-1936.266) (-1943.706) (-1933.593) -- 0:02:29
      272500 -- (-1935.702) [-1935.718] (-1935.775) (-1932.592) * (-1937.787) (-1941.462) [-1932.337] (-1943.449) -- 0:02:29
      273000 -- (-1933.760) (-1934.449) [-1934.675] (-1938.845) * (-1938.080) (-1934.597) [-1936.480] (-1933.223) -- 0:02:29
      273500 -- (-1937.379) (-1932.979) [-1932.955] (-1934.621) * (-1938.766) [-1929.950] (-1941.772) (-1933.955) -- 0:02:28
      274000 -- (-1934.539) (-1932.053) [-1934.162] (-1938.042) * [-1932.226] (-1933.218) (-1935.022) (-1934.596) -- 0:02:28
      274500 -- (-1938.072) (-1931.157) (-1932.257) [-1934.889] * (-1933.596) [-1938.520] (-1933.326) (-1931.228) -- 0:02:28
      275000 -- [-1937.151] (-1940.849) (-1937.022) (-1934.886) * (-1934.510) [-1930.099] (-1933.410) (-1936.000) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-1935.487] (-1936.221) (-1942.967) (-1938.676) * (-1935.173) (-1933.430) (-1937.017) [-1930.864] -- 0:02:29
      276000 -- (-1934.101) (-1938.062) (-1943.222) [-1939.751] * (-1936.377) [-1936.069] (-1937.186) (-1931.379) -- 0:02:29
      276500 -- (-1936.476) (-1943.632) (-1935.075) [-1933.057] * (-1932.327) (-1931.997) (-1940.417) [-1930.441] -- 0:02:29
      277000 -- (-1934.446) [-1933.840] (-1936.852) (-1933.905) * (-1935.136) (-1941.448) [-1933.286] (-1934.293) -- 0:02:28
      277500 -- (-1942.292) [-1936.493] (-1936.636) (-1934.102) * (-1946.782) (-1937.059) (-1932.385) [-1933.342] -- 0:02:28
      278000 -- (-1938.004) (-1932.330) [-1940.473] (-1934.303) * [-1941.978] (-1935.527) (-1934.343) (-1935.140) -- 0:02:28
      278500 -- (-1932.699) [-1936.764] (-1940.057) (-1933.498) * [-1938.155] (-1937.510) (-1935.245) (-1941.025) -- 0:02:27
      279000 -- (-1937.924) (-1931.198) [-1934.291] (-1942.715) * (-1938.770) (-1945.966) (-1935.061) [-1940.192] -- 0:02:27
      279500 -- (-1932.899) [-1930.993] (-1939.645) (-1941.933) * (-1938.512) [-1938.443] (-1935.473) (-1945.485) -- 0:02:26
      280000 -- (-1933.414) (-1934.135) (-1940.289) [-1935.726] * [-1942.558] (-1936.768) (-1937.964) (-1933.577) -- 0:02:26

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-1934.614) [-1933.091] (-1932.492) (-1932.373) * [-1936.941] (-1939.626) (-1942.165) (-1931.315) -- 0:02:28
      281000 -- (-1939.282) [-1932.418] (-1933.994) (-1931.271) * (-1933.135) (-1937.664) [-1936.729] (-1935.130) -- 0:02:28
      281500 -- [-1939.240] (-1938.236) (-1935.567) (-1933.385) * [-1932.281] (-1939.396) (-1938.945) (-1935.939) -- 0:02:28
      282000 -- (-1932.286) (-1937.463) [-1936.494] (-1936.380) * [-1937.915] (-1931.976) (-1938.441) (-1934.836) -- 0:02:27
      282500 -- (-1934.118) (-1941.784) [-1937.518] (-1933.046) * (-1938.804) (-1933.300) (-1937.046) [-1934.884] -- 0:02:27
      283000 -- [-1935.499] (-1943.159) (-1936.652) (-1936.273) * (-1936.687) [-1935.167] (-1937.646) (-1936.854) -- 0:02:26
      283500 -- (-1932.604) (-1934.748) (-1936.714) [-1936.198] * [-1937.986] (-1936.747) (-1953.724) (-1938.193) -- 0:02:26
      284000 -- (-1933.655) (-1934.218) (-1937.304) [-1934.526] * (-1943.318) (-1934.369) [-1934.570] (-1941.860) -- 0:02:26
      284500 -- [-1932.456] (-1933.896) (-1936.207) (-1933.075) * [-1939.698] (-1931.898) (-1934.380) (-1939.309) -- 0:02:25
      285000 -- (-1933.547) [-1935.368] (-1937.080) (-1932.205) * [-1942.902] (-1941.274) (-1941.363) (-1936.252) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-1937.507) (-1936.282) (-1938.346) [-1934.602] * (-1940.839) (-1939.681) (-1934.799) [-1935.100] -- 0:02:27
      286000 -- (-1939.990) (-1935.549) (-1936.676) [-1931.526] * (-1929.404) (-1931.587) (-1936.214) [-1934.884] -- 0:02:27
      286500 -- (-1944.532) [-1935.041] (-1939.320) (-1935.648) * (-1936.378) [-1930.056] (-1934.993) (-1930.915) -- 0:02:26
      287000 -- (-1942.081) (-1935.312) [-1934.685] (-1931.454) * (-1936.212) [-1935.142] (-1932.042) (-1933.549) -- 0:02:26
      287500 -- [-1932.258] (-1934.520) (-1931.622) (-1933.398) * (-1937.316) [-1932.488] (-1936.230) (-1932.535) -- 0:02:26
      288000 -- (-1933.530) (-1939.496) (-1935.367) [-1933.533] * [-1937.624] (-1937.779) (-1933.518) (-1940.795) -- 0:02:25
      288500 -- (-1935.202) (-1941.577) (-1939.229) [-1933.003] * (-1939.864) (-1933.797) (-1937.863) [-1937.254] -- 0:02:25
      289000 -- (-1935.122) (-1936.506) [-1933.228] (-1932.059) * (-1933.146) [-1934.937] (-1935.561) (-1939.958) -- 0:02:25
      289500 -- [-1936.003] (-1933.306) (-1935.921) (-1937.952) * [-1936.403] (-1934.524) (-1934.547) (-1934.094) -- 0:02:24
      290000 -- (-1935.867) [-1934.774] (-1939.104) (-1938.343) * (-1937.189) [-1935.038] (-1933.422) (-1940.844) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-1936.211) (-1930.870) (-1930.342) [-1933.196] * (-1935.035) [-1939.830] (-1933.103) (-1936.305) -- 0:02:26
      291000 -- (-1936.012) (-1938.244) (-1937.595) [-1935.540] * [-1934.753] (-1932.499) (-1937.770) (-1933.692) -- 0:02:26
      291500 -- (-1931.558) [-1935.628] (-1936.633) (-1933.638) * [-1938.235] (-1942.592) (-1945.839) (-1937.747) -- 0:02:25
      292000 -- (-1938.751) (-1936.142) [-1929.873] (-1935.406) * (-1939.522) (-1932.551) [-1935.392] (-1933.287) -- 0:02:25
      292500 -- [-1940.665] (-1932.300) (-1943.186) (-1942.453) * (-1939.272) [-1931.478] (-1936.344) (-1940.658) -- 0:02:25
      293000 -- (-1937.778) [-1931.306] (-1939.750) (-1938.566) * [-1935.971] (-1930.798) (-1933.454) (-1940.558) -- 0:02:24
      293500 -- (-1936.435) (-1934.380) (-1936.913) [-1937.592] * (-1937.247) (-1934.650) [-1936.016] (-1937.301) -- 0:02:24
      294000 -- (-1937.728) (-1931.374) (-1939.287) [-1936.895] * (-1934.172) (-1934.230) [-1936.544] (-1938.925) -- 0:02:24
      294500 -- [-1933.427] (-1931.778) (-1947.293) (-1932.212) * (-1933.577) (-1934.097) (-1934.897) [-1936.318] -- 0:02:23
      295000 -- (-1933.563) [-1933.331] (-1945.186) (-1930.544) * (-1937.136) (-1934.282) (-1936.594) [-1933.316] -- 0:02:23

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-1937.586) (-1934.203) [-1941.404] (-1932.187) * (-1939.245) (-1934.110) (-1939.866) [-1935.245] -- 0:02:25
      296000 -- (-1935.532) (-1931.666) (-1938.887) [-1934.514] * [-1932.996] (-1930.810) (-1942.390) (-1943.407) -- 0:02:25
      296500 -- (-1939.234) [-1932.269] (-1938.822) (-1933.167) * [-1934.942] (-1938.678) (-1937.769) (-1931.208) -- 0:02:24
      297000 -- (-1940.344) [-1935.986] (-1944.443) (-1941.145) * (-1937.261) [-1934.085] (-1935.726) (-1934.502) -- 0:02:24
      297500 -- (-1938.960) [-1932.258] (-1942.718) (-1932.133) * (-1934.648) [-1936.672] (-1930.367) (-1934.241) -- 0:02:24
      298000 -- (-1936.012) [-1932.437] (-1938.622) (-1937.902) * [-1932.099] (-1934.531) (-1936.627) (-1938.082) -- 0:02:23
      298500 -- [-1936.989] (-1935.571) (-1938.043) (-1934.263) * (-1939.596) (-1933.697) (-1935.405) [-1930.331] -- 0:02:23
      299000 -- (-1940.907) (-1931.193) [-1939.825] (-1933.769) * (-1938.604) [-1934.782] (-1935.521) (-1939.346) -- 0:02:23
      299500 -- (-1938.353) [-1929.465] (-1938.946) (-1935.053) * (-1940.616) [-1932.140] (-1940.728) (-1935.836) -- 0:02:22
      300000 -- (-1937.074) (-1937.854) (-1942.895) [-1933.609] * [-1930.452] (-1936.788) (-1937.384) (-1940.748) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-1937.551) [-1930.232] (-1941.732) (-1938.424) * (-1941.006) (-1946.687) (-1937.214) [-1937.025] -- 0:02:24
      301000 -- (-1930.649) (-1931.950) [-1934.654] (-1940.589) * [-1937.179] (-1937.292) (-1935.066) (-1937.017) -- 0:02:23
      301500 -- (-1935.702) (-1937.640) (-1933.605) [-1935.104] * (-1946.120) (-1938.216) (-1934.273) [-1935.584] -- 0:02:23
      302000 -- (-1934.445) (-1931.698) (-1931.789) [-1934.252] * (-1943.302) (-1937.092) [-1930.459] (-1933.792) -- 0:02:23
      302500 -- [-1931.166] (-1931.471) (-1935.739) (-1930.859) * (-1934.297) (-1938.547) (-1932.173) [-1932.299] -- 0:02:22
      303000 -- (-1932.904) (-1936.770) (-1935.638) [-1936.249] * (-1933.334) (-1938.109) (-1941.693) [-1941.531] -- 0:02:22
      303500 -- [-1935.744] (-1937.476) (-1934.669) (-1941.293) * (-1932.840) (-1935.973) (-1934.062) [-1937.592] -- 0:02:22
      304000 -- (-1938.781) (-1937.302) (-1940.494) [-1937.538] * (-1935.892) (-1933.829) [-1940.130] (-1939.608) -- 0:02:21
      304500 -- [-1937.586] (-1937.144) (-1947.456) (-1936.304) * [-1933.354] (-1935.859) (-1932.683) (-1938.038) -- 0:02:21
      305000 -- (-1936.530) [-1935.244] (-1936.899) (-1936.817) * (-1936.762) [-1938.529] (-1938.717) (-1935.429) -- 0:02:23

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-1940.297) [-1931.640] (-1933.995) (-1936.045) * (-1937.734) [-1933.608] (-1937.573) (-1944.960) -- 0:02:23
      306000 -- [-1938.080] (-1936.224) (-1945.009) (-1935.553) * (-1939.626) [-1933.573] (-1934.087) (-1932.769) -- 0:02:22
      306500 -- (-1938.442) [-1933.558] (-1935.364) (-1932.698) * (-1938.011) (-1936.606) (-1936.441) [-1931.492] -- 0:02:22
      307000 -- (-1933.803) (-1936.269) (-1938.220) [-1936.920] * (-1939.166) (-1943.761) [-1933.292] (-1935.454) -- 0:02:22
      307500 -- [-1932.990] (-1934.065) (-1936.101) (-1935.095) * (-1939.962) [-1943.557] (-1931.314) (-1935.229) -- 0:02:21
      308000 -- (-1933.470) [-1930.141] (-1941.572) (-1935.373) * [-1934.989] (-1935.981) (-1939.408) (-1934.641) -- 0:02:21
      308500 -- [-1933.029] (-1931.011) (-1939.227) (-1938.179) * (-1939.460) (-1934.576) [-1933.562] (-1942.337) -- 0:02:21
      309000 -- [-1937.763] (-1934.041) (-1935.190) (-1931.885) * [-1935.928] (-1933.453) (-1938.298) (-1944.138) -- 0:02:20
      309500 -- (-1947.197) [-1935.130] (-1929.031) (-1935.532) * (-1936.427) [-1933.763] (-1935.125) (-1931.705) -- 0:02:20
      310000 -- (-1937.218) (-1942.182) [-1931.673] (-1934.146) * (-1931.136) (-1931.751) [-1933.837] (-1937.222) -- 0:02:22

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-1932.853) (-1933.019) [-1931.654] (-1939.077) * (-1935.746) (-1936.856) (-1940.648) [-1934.819] -- 0:02:22
      311000 -- (-1933.989) [-1931.016] (-1937.392) (-1933.353) * (-1932.364) [-1935.423] (-1938.051) (-1932.507) -- 0:02:21
      311500 -- (-1937.925) (-1938.294) [-1934.726] (-1932.601) * (-1933.212) (-1934.045) [-1934.433] (-1934.166) -- 0:02:21
      312000 -- (-1937.545) (-1932.997) (-1932.306) [-1932.150] * [-1930.229] (-1932.881) (-1941.051) (-1932.807) -- 0:02:21
      312500 -- (-1935.420) (-1935.328) (-1933.690) [-1930.667] * [-1935.134] (-1937.715) (-1937.097) (-1941.023) -- 0:02:20
      313000 -- [-1935.910] (-1937.074) (-1942.267) (-1935.072) * (-1935.844) (-1936.089) (-1934.585) [-1932.586] -- 0:02:20
      313500 -- (-1932.943) (-1937.893) [-1930.579] (-1936.815) * (-1934.077) (-1932.977) [-1932.905] (-1933.350) -- 0:02:20
      314000 -- [-1932.462] (-1940.040) (-1932.764) (-1931.266) * (-1932.879) (-1935.153) [-1933.322] (-1937.954) -- 0:02:19
      314500 -- (-1935.350) (-1938.359) [-1937.468] (-1941.005) * (-1935.182) (-1939.553) (-1935.294) [-1933.251] -- 0:02:19
      315000 -- (-1932.245) (-1933.129) (-1939.412) [-1932.528] * (-1934.644) [-1937.602] (-1940.248) (-1938.569) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-1937.857) (-1942.802) (-1939.052) [-1933.803] * (-1938.551) [-1935.243] (-1940.092) (-1934.680) -- 0:02:21
      316000 -- (-1938.050) (-1932.982) (-1935.086) [-1934.676] * (-1930.956) [-1938.838] (-1945.822) (-1937.716) -- 0:02:20
      316500 -- (-1937.718) (-1935.388) (-1933.334) [-1931.549] * (-1943.938) (-1937.843) (-1947.105) [-1936.665] -- 0:02:20
      317000 -- (-1934.997) [-1943.223] (-1931.079) (-1937.943) * (-1940.079) [-1936.860] (-1937.626) (-1939.578) -- 0:02:20
      317500 -- (-1932.463) (-1939.839) (-1933.007) [-1943.696] * (-1936.320) (-1932.784) [-1933.544] (-1937.951) -- 0:02:19
      318000 -- (-1931.576) [-1939.091] (-1938.013) (-1940.137) * (-1937.530) [-1939.201] (-1932.690) (-1936.565) -- 0:02:19
      318500 -- (-1934.040) [-1931.912] (-1937.265) (-1932.107) * (-1932.204) (-1940.076) [-1932.026] (-1944.903) -- 0:02:19
      319000 -- (-1935.268) [-1931.862] (-1936.085) (-1935.550) * (-1936.885) (-1934.946) [-1934.192] (-1936.610) -- 0:02:18
      319500 -- (-1946.084) (-1940.975) [-1935.236] (-1932.432) * [-1935.192] (-1941.447) (-1935.661) (-1938.613) -- 0:02:18
      320000 -- [-1932.608] (-1939.124) (-1934.033) (-1945.641) * (-1930.554) (-1934.210) (-1933.602) [-1937.710] -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-1931.723) (-1934.819) (-1934.838) [-1935.708] * (-1935.894) (-1936.780) (-1931.159) [-1938.094] -- 0:02:19
      321000 -- (-1942.094) (-1936.851) (-1930.382) [-1931.151] * (-1937.140) (-1939.112) (-1934.512) [-1936.584] -- 0:02:19
      321500 -- (-1939.727) [-1934.459] (-1940.808) (-1933.666) * [-1932.435] (-1945.549) (-1941.637) (-1936.346) -- 0:02:19
      322000 -- (-1931.999) (-1934.809) [-1936.166] (-1941.389) * (-1938.932) (-1938.717) [-1935.667] (-1936.476) -- 0:02:18
      322500 -- [-1929.564] (-1939.650) (-1935.878) (-1935.734) * (-1939.620) (-1931.525) [-1933.261] (-1933.224) -- 0:02:18
      323000 -- (-1934.682) [-1935.231] (-1936.785) (-1942.034) * (-1938.384) [-1936.066] (-1935.473) (-1937.648) -- 0:02:18
      323500 -- [-1938.963] (-1935.152) (-1934.427) (-1935.589) * (-1935.824) [-1929.653] (-1932.276) (-1938.449) -- 0:02:18
      324000 -- (-1939.476) [-1932.785] (-1935.734) (-1940.951) * (-1933.352) [-1932.838] (-1933.336) (-1933.566) -- 0:02:17
      324500 -- (-1942.736) (-1935.556) [-1934.502] (-1930.565) * (-1936.138) (-1936.480) [-1931.009] (-1935.034) -- 0:02:17
      325000 -- (-1932.050) (-1933.846) [-1936.350] (-1933.667) * [-1937.285] (-1946.899) (-1937.380) (-1935.351) -- 0:02:19

      Average standard deviation of split frequencies: 0.000000

      325500 -- [-1932.807] (-1934.960) (-1931.872) (-1933.535) * (-1931.683) (-1934.551) [-1932.152] (-1933.700) -- 0:02:18
      326000 -- [-1941.088] (-1931.515) (-1939.637) (-1935.272) * (-1934.698) (-1935.418) (-1934.962) [-1934.620] -- 0:02:18
      326500 -- [-1930.707] (-1934.434) (-1937.766) (-1939.902) * (-1931.886) (-1933.014) [-1933.066] (-1931.453) -- 0:02:18
      327000 -- (-1935.427) (-1936.158) [-1942.727] (-1941.073) * (-1936.051) (-1940.058) (-1938.921) [-1935.081] -- 0:02:17
      327500 -- [-1933.709] (-1934.944) (-1936.750) (-1937.013) * [-1934.069] (-1940.305) (-1942.610) (-1933.484) -- 0:02:17
      328000 -- [-1934.178] (-1934.742) (-1931.995) (-1939.947) * [-1932.183] (-1933.435) (-1944.284) (-1934.990) -- 0:02:17
      328500 -- (-1936.719) [-1938.632] (-1930.935) (-1943.971) * (-1935.666) [-1930.691] (-1934.757) (-1941.166) -- 0:02:16
      329000 -- (-1935.666) (-1934.613) [-1939.646] (-1939.396) * (-1931.606) [-1932.959] (-1935.181) (-1940.215) -- 0:02:16
      329500 -- (-1940.705) (-1936.750) [-1940.215] (-1938.340) * [-1933.232] (-1934.420) (-1935.682) (-1934.753) -- 0:02:16
      330000 -- (-1932.329) (-1937.031) (-1930.723) [-1933.931] * [-1935.040] (-1933.792) (-1932.573) (-1941.446) -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-1941.901) (-1932.069) [-1937.421] (-1935.922) * (-1940.574) (-1940.610) (-1937.615) [-1931.203] -- 0:02:17
      331000 -- (-1933.381) [-1931.820] (-1935.361) (-1932.180) * (-1937.216) [-1935.911] (-1937.906) (-1935.221) -- 0:02:17
      331500 -- (-1935.479) (-1939.793) [-1936.539] (-1937.228) * [-1934.161] (-1937.726) (-1938.104) (-1939.718) -- 0:02:17
      332000 -- (-1940.578) (-1931.588) (-1937.828) [-1934.692] * (-1934.116) (-1935.178) [-1930.198] (-1934.890) -- 0:02:16
      332500 -- (-1938.224) (-1931.946) [-1937.628] (-1936.290) * (-1938.066) [-1938.132] (-1933.409) (-1941.621) -- 0:02:16
      333000 -- (-1951.546) (-1935.840) [-1936.346] (-1934.520) * [-1936.416] (-1936.368) (-1939.538) (-1938.317) -- 0:02:16
      333500 -- (-1939.250) [-1933.796] (-1939.478) (-1939.090) * (-1936.468) (-1939.674) (-1936.335) [-1934.488] -- 0:02:15
      334000 -- [-1938.196] (-1932.518) (-1935.491) (-1936.965) * [-1934.400] (-1931.284) (-1937.074) (-1932.881) -- 0:02:15
      334500 -- [-1930.813] (-1936.197) (-1934.507) (-1935.256) * (-1940.633) [-1932.378] (-1934.321) (-1935.476) -- 0:02:15
      335000 -- (-1940.251) [-1937.395] (-1933.094) (-1935.291) * (-1938.996) (-1938.694) (-1930.792) [-1935.662] -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-1931.602) (-1943.600) [-1935.142] (-1934.082) * (-1940.011) [-1932.825] (-1933.856) (-1932.183) -- 0:02:16
      336000 -- (-1931.892) (-1938.925) (-1943.882) [-1937.298] * (-1941.721) (-1935.389) [-1934.056] (-1932.019) -- 0:02:16
      336500 -- (-1933.960) (-1940.312) (-1943.237) [-1939.874] * [-1935.775] (-1945.835) (-1938.628) (-1932.236) -- 0:02:16
      337000 -- (-1933.220) [-1936.735] (-1938.660) (-1931.126) * (-1939.083) (-1936.749) (-1936.479) [-1931.767] -- 0:02:15
      337500 -- [-1939.042] (-1941.463) (-1937.971) (-1939.665) * (-1937.240) (-1931.321) (-1931.838) [-1933.183] -- 0:02:15
      338000 -- (-1937.816) (-1935.042) (-1935.333) [-1934.439] * [-1941.839] (-1936.969) (-1936.299) (-1934.337) -- 0:02:15
      338500 -- (-1932.047) (-1935.070) [-1932.492] (-1931.947) * (-1936.623) (-1940.427) (-1936.099) [-1944.165] -- 0:02:14
      339000 -- (-1932.200) (-1937.242) [-1933.254] (-1932.134) * (-1936.356) (-1937.143) (-1930.921) [-1931.370] -- 0:02:14
      339500 -- (-1933.510) (-1937.082) (-1930.459) [-1931.961] * (-1937.891) (-1942.749) (-1934.276) [-1932.185] -- 0:02:14
      340000 -- (-1941.346) (-1938.741) (-1931.162) [-1938.886] * [-1933.167] (-1933.938) (-1941.553) (-1938.047) -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-1933.180] (-1934.192) (-1931.998) (-1937.531) * [-1935.773] (-1935.611) (-1942.650) (-1935.425) -- 0:02:15
      341000 -- (-1942.950) (-1937.083) [-1932.204] (-1945.378) * [-1936.287] (-1938.418) (-1950.237) (-1935.078) -- 0:02:15
      341500 -- (-1937.508) (-1938.911) [-1935.872] (-1940.122) * (-1945.189) [-1937.418] (-1945.595) (-1937.702) -- 0:02:14
      342000 -- (-1936.037) [-1935.789] (-1941.079) (-1932.893) * (-1935.960) [-1932.379] (-1936.549) (-1934.813) -- 0:02:14
      342500 -- (-1939.661) (-1931.192) (-1938.456) [-1934.700] * (-1941.137) [-1930.154] (-1936.477) (-1933.427) -- 0:02:14
      343000 -- (-1937.377) [-1932.089] (-1934.819) (-1934.211) * [-1938.607] (-1937.408) (-1938.564) (-1934.090) -- 0:02:14
      343500 -- (-1934.536) [-1937.982] (-1940.201) (-1938.727) * (-1931.112) [-1931.627] (-1936.189) (-1935.308) -- 0:02:13
      344000 -- (-1934.013) (-1930.030) (-1937.686) [-1935.890] * (-1936.185) (-1931.449) [-1937.902] (-1940.464) -- 0:02:13
      344500 -- (-1937.555) [-1935.950] (-1937.607) (-1935.233) * [-1930.734] (-1933.539) (-1937.294) (-1933.434) -- 0:02:13
      345000 -- (-1934.857) (-1945.275) [-1934.130] (-1935.156) * (-1933.968) (-1939.904) (-1935.572) [-1934.822] -- 0:02:14

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-1938.640) (-1935.825) (-1935.772) [-1939.364] * (-1935.637) (-1941.918) (-1937.146) [-1938.877] -- 0:02:14
      346000 -- (-1937.354) (-1931.295) [-1937.037] (-1935.396) * (-1935.435) (-1934.452) [-1934.438] (-1946.701) -- 0:02:14
      346500 -- (-1930.785) [-1938.860] (-1937.507) (-1934.064) * [-1936.754] (-1931.758) (-1936.569) (-1938.071) -- 0:02:13
      347000 -- (-1934.048) (-1932.970) (-1938.398) [-1931.347] * [-1932.186] (-1934.762) (-1937.915) (-1940.251) -- 0:02:13
      347500 -- (-1936.174) [-1932.563] (-1937.243) (-1933.916) * [-1935.975] (-1928.609) (-1932.642) (-1930.026) -- 0:02:13
      348000 -- [-1931.219] (-1939.638) (-1935.977) (-1940.662) * (-1932.897) (-1936.790) (-1932.515) [-1932.098] -- 0:02:13
      348500 -- (-1938.303) (-1934.774) (-1935.218) [-1934.036] * (-1933.568) (-1931.646) (-1934.321) [-1935.631] -- 0:02:12
      349000 -- (-1936.333) (-1933.740) [-1933.228] (-1938.236) * (-1938.355) (-1935.016) [-1935.135] (-1939.117) -- 0:02:12
      349500 -- (-1939.544) [-1935.596] (-1940.147) (-1942.233) * (-1931.772) (-1936.131) [-1934.141] (-1935.273) -- 0:02:12
      350000 -- (-1936.078) (-1933.554) (-1937.712) [-1937.914] * (-1940.894) (-1929.184) (-1939.705) [-1936.149] -- 0:02:13

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-1934.470) (-1937.169) [-1932.722] (-1935.915) * (-1941.005) [-1933.712] (-1933.839) (-1941.506) -- 0:02:13
      351000 -- (-1936.906) (-1940.895) (-1938.230) [-1936.246] * (-1939.348) [-1937.752] (-1934.846) (-1930.764) -- 0:02:13
      351500 -- (-1937.724) [-1929.765] (-1938.999) (-1942.912) * [-1937.379] (-1932.495) (-1943.480) (-1934.283) -- 0:02:12
      352000 -- (-1936.284) (-1935.118) (-1938.642) [-1932.712] * (-1936.651) (-1940.600) (-1946.637) [-1933.031] -- 0:02:12
      352500 -- (-1936.819) [-1935.977] (-1930.206) (-1933.776) * [-1938.469] (-1935.856) (-1936.472) (-1942.907) -- 0:02:12
      353000 -- [-1932.779] (-1940.296) (-1933.385) (-1935.242) * (-1934.197) (-1934.539) [-1935.292] (-1944.019) -- 0:02:11
      353500 -- [-1932.203] (-1943.388) (-1935.548) (-1935.289) * [-1933.086] (-1934.911) (-1936.060) (-1939.398) -- 0:02:11
      354000 -- (-1930.937) (-1946.858) [-1933.164] (-1940.326) * (-1934.182) (-1938.485) [-1935.082] (-1938.112) -- 0:02:11
      354500 -- (-1933.004) [-1940.474] (-1938.168) (-1934.409) * (-1934.347) [-1938.380] (-1941.119) (-1934.907) -- 0:02:11
      355000 -- (-1932.264) (-1938.043) [-1936.877] (-1932.933) * (-1931.885) [-1940.229] (-1937.720) (-1935.720) -- 0:02:12

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-1934.716) [-1934.884] (-1939.344) (-1931.218) * [-1935.794] (-1936.543) (-1934.667) (-1936.858) -- 0:02:12
      356000 -- (-1938.520) [-1936.008] (-1934.417) (-1935.166) * (-1933.820) (-1935.795) (-1937.539) [-1932.585] -- 0:02:12
      356500 -- (-1935.343) (-1935.956) [-1936.083] (-1938.053) * (-1935.854) (-1934.916) [-1934.544] (-1933.078) -- 0:02:11
      357000 -- (-1931.765) [-1935.978] (-1940.504) (-1945.646) * (-1931.381) (-1934.443) (-1931.528) [-1944.063] -- 0:02:11
      357500 -- [-1931.781] (-1947.623) (-1932.146) (-1938.116) * (-1933.866) (-1938.685) [-1929.341] (-1933.440) -- 0:02:11
      358000 -- (-1940.804) (-1932.978) (-1941.577) [-1934.062] * (-1936.741) (-1942.682) (-1934.356) [-1935.503] -- 0:02:10
      358500 -- [-1931.057] (-1944.164) (-1939.678) (-1933.588) * (-1938.109) (-1932.398) (-1932.499) [-1932.261] -- 0:02:10
      359000 -- [-1932.250] (-1938.366) (-1941.060) (-1935.590) * (-1937.908) (-1934.609) [-1933.778] (-1937.901) -- 0:02:10
      359500 -- [-1937.122] (-1943.326) (-1934.759) (-1931.868) * (-1936.069) (-1936.626) (-1939.483) [-1934.638] -- 0:02:10
      360000 -- (-1942.769) [-1944.433] (-1937.395) (-1938.327) * (-1942.956) [-1939.052] (-1935.063) (-1934.569) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      360500 -- [-1934.828] (-1941.912) (-1940.103) (-1936.427) * (-1935.788) (-1935.105) [-1931.519] (-1936.144) -- 0:02:11
      361000 -- [-1934.706] (-1937.358) (-1943.044) (-1942.221) * (-1944.005) [-1932.400] (-1937.498) (-1935.908) -- 0:02:10
      361500 -- (-1940.345) (-1933.187) (-1935.407) [-1937.298] * (-1940.703) (-1939.235) [-1934.529] (-1936.733) -- 0:02:10
      362000 -- (-1935.579) (-1935.187) [-1935.522] (-1937.097) * (-1942.367) [-1940.433] (-1941.068) (-1939.826) -- 0:02:10
      362500 -- (-1933.912) (-1944.258) (-1937.990) [-1934.478] * (-1938.378) [-1937.908] (-1932.211) (-1937.955) -- 0:02:10
      363000 -- (-1937.187) (-1935.826) [-1935.764] (-1940.108) * (-1939.827) (-1936.892) [-1936.392] (-1937.845) -- 0:02:09
      363500 -- (-1934.258) (-1932.311) (-1931.059) [-1930.146] * (-1935.499) (-1936.051) [-1934.659] (-1936.843) -- 0:02:09
      364000 -- [-1941.494] (-1935.393) (-1942.845) (-1943.104) * (-1935.793) (-1935.150) [-1933.433] (-1938.365) -- 0:02:09
      364500 -- [-1936.266] (-1937.586) (-1937.622) (-1931.474) * (-1938.459) [-1933.121] (-1933.967) (-1933.899) -- 0:02:09
      365000 -- (-1934.008) [-1931.941] (-1933.709) (-1933.718) * (-1939.398) (-1936.664) [-1934.321] (-1932.018) -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-1937.204) (-1931.539) (-1936.102) [-1939.609] * [-1943.626] (-1937.255) (-1936.921) (-1933.630) -- 0:02:10
      366000 -- [-1934.432] (-1941.760) (-1937.013) (-1934.880) * (-1935.173) (-1937.906) [-1933.575] (-1934.597) -- 0:02:09
      366500 -- [-1935.534] (-1935.266) (-1938.762) (-1934.126) * (-1933.228) (-1940.723) [-1936.240] (-1933.372) -- 0:02:09
      367000 -- (-1936.113) (-1933.502) (-1941.825) [-1934.569] * (-1946.722) (-1936.546) (-1935.142) [-1933.714] -- 0:02:09
      367500 -- [-1932.568] (-1935.754) (-1934.994) (-1933.479) * (-1952.458) (-1940.509) [-1930.293] (-1931.100) -- 0:02:09
      368000 -- (-1936.104) [-1932.994] (-1932.866) (-1938.706) * [-1942.262] (-1933.915) (-1940.705) (-1939.035) -- 0:02:08
      368500 -- (-1938.041) (-1933.133) [-1936.069] (-1932.847) * (-1940.697) [-1935.355] (-1939.264) (-1933.614) -- 0:02:08
      369000 -- (-1934.523) (-1933.432) [-1934.350] (-1932.849) * [-1934.773] (-1937.575) (-1935.948) (-1931.740) -- 0:02:08
      369500 -- [-1933.025] (-1932.438) (-1937.722) (-1932.373) * (-1934.362) [-1935.858] (-1940.181) (-1941.888) -- 0:02:07
      370000 -- (-1943.340) (-1937.086) (-1934.069) [-1931.398] * (-1934.847) (-1933.918) [-1932.196] (-1939.481) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-1933.530) (-1942.284) (-1944.860) [-1935.556] * [-1933.031] (-1933.594) (-1934.583) (-1936.887) -- 0:02:09
      371000 -- [-1933.965] (-1939.914) (-1931.913) (-1934.332) * (-1930.821) (-1939.324) [-1929.901] (-1937.243) -- 0:02:08
      371500 -- [-1937.479] (-1942.006) (-1939.063) (-1935.580) * (-1933.464) (-1937.017) (-1939.021) [-1931.407] -- 0:02:08
      372000 -- (-1934.702) [-1936.445] (-1938.771) (-1931.370) * (-1934.032) (-1934.503) (-1932.729) [-1934.082] -- 0:02:08
      372500 -- [-1939.611] (-1941.008) (-1938.481) (-1932.980) * (-1934.068) [-1934.977] (-1935.006) (-1936.170) -- 0:02:08
      373000 -- (-1935.887) (-1939.846) [-1938.808] (-1934.215) * [-1933.842] (-1933.837) (-1934.577) (-1934.552) -- 0:02:07
      373500 -- (-1930.985) [-1934.689] (-1936.640) (-1938.422) * (-1940.573) (-1931.898) (-1953.251) [-1928.781] -- 0:02:07
      374000 -- (-1934.276) [-1934.783] (-1936.473) (-1935.365) * (-1932.894) [-1933.845] (-1936.505) (-1934.999) -- 0:02:07
      374500 -- [-1935.177] (-1935.211) (-1939.135) (-1935.569) * (-1933.275) (-1931.794) [-1936.184] (-1932.518) -- 0:02:06
      375000 -- (-1938.116) (-1937.085) (-1944.467) [-1932.078] * (-1933.133) (-1936.819) [-1937.484] (-1933.103) -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      375500 -- [-1933.121] (-1932.583) (-1936.320) (-1935.796) * (-1940.604) (-1940.373) (-1937.606) [-1934.181] -- 0:02:08
      376000 -- (-1931.692) (-1933.674) (-1936.401) [-1936.875] * (-1937.857) [-1940.769] (-1935.620) (-1930.335) -- 0:02:07
      376500 -- (-1935.567) (-1932.879) (-1935.314) [-1933.512] * (-1928.806) (-1939.265) [-1933.037] (-1933.671) -- 0:02:07
      377000 -- (-1934.878) (-1937.477) [-1935.227] (-1936.889) * (-1940.993) (-1937.084) [-1934.303] (-1939.675) -- 0:02:07
      377500 -- (-1936.444) (-1948.124) [-1932.895] (-1933.361) * [-1942.867] (-1938.494) (-1936.097) (-1937.033) -- 0:02:06
      378000 -- (-1930.218) (-1942.783) (-1932.112) [-1933.315] * (-1939.679) [-1935.305] (-1929.908) (-1943.918) -- 0:02:06
      378500 -- (-1936.257) [-1940.834] (-1934.584) (-1934.595) * (-1932.347) [-1933.234] (-1932.250) (-1936.268) -- 0:02:06
      379000 -- (-1938.511) [-1934.315] (-1935.076) (-1934.557) * [-1935.243] (-1935.432) (-1941.705) (-1937.034) -- 0:02:06
      379500 -- [-1943.971] (-1935.427) (-1931.243) (-1936.140) * (-1934.081) (-1939.963) [-1933.704] (-1945.532) -- 0:02:05
      380000 -- [-1935.241] (-1934.323) (-1933.611) (-1933.418) * (-1935.892) (-1935.189) [-1937.832] (-1936.921) -- 0:02:07

      Average standard deviation of split frequencies: 0.000000

      380500 -- [-1936.204] (-1935.507) (-1930.308) (-1936.605) * [-1938.211] (-1940.220) (-1943.744) (-1934.691) -- 0:02:06
      381000 -- (-1933.268) (-1939.825) (-1938.179) [-1936.870] * (-1937.380) [-1937.727] (-1940.790) (-1938.377) -- 0:02:06
      381500 -- [-1933.514] (-1940.440) (-1940.584) (-1934.374) * (-1935.802) (-1938.231) (-1950.769) [-1938.548] -- 0:02:06
      382000 -- (-1934.073) [-1933.320] (-1937.906) (-1937.161) * (-1937.142) [-1932.207] (-1945.763) (-1935.437) -- 0:02:06
      382500 -- (-1936.367) [-1934.281] (-1936.360) (-1936.167) * (-1937.307) (-1936.914) (-1941.058) [-1938.241] -- 0:02:05
      383000 -- [-1938.127] (-1933.463) (-1944.266) (-1935.720) * (-1938.980) [-1933.849] (-1941.677) (-1934.079) -- 0:02:05
      383500 -- (-1936.038) [-1932.256] (-1931.295) (-1933.686) * (-1940.747) (-1934.751) (-1936.008) [-1935.910] -- 0:02:05
      384000 -- (-1935.756) (-1940.278) [-1935.983] (-1934.123) * (-1942.169) (-1940.240) [-1939.636] (-1932.397) -- 0:02:05
      384500 -- (-1939.615) (-1944.629) [-1938.279] (-1935.826) * [-1937.912] (-1944.920) (-1934.541) (-1935.347) -- 0:02:04
      385000 -- (-1937.571) (-1940.049) [-1930.761] (-1935.400) * (-1942.282) [-1939.267] (-1936.824) (-1941.147) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      385500 -- (-1935.632) (-1938.214) (-1936.349) [-1934.425] * (-1941.986) [-1940.362] (-1943.438) (-1943.545) -- 0:02:05
      386000 -- (-1932.827) [-1934.473] (-1937.756) (-1937.570) * (-1932.460) (-1937.242) [-1944.221] (-1942.734) -- 0:02:05
      386500 -- (-1934.160) (-1936.138) [-1935.364] (-1941.248) * [-1930.238] (-1935.805) (-1951.445) (-1939.654) -- 0:02:05
      387000 -- [-1932.745] (-1936.747) (-1933.215) (-1936.302) * (-1941.160) (-1930.130) (-1950.260) [-1936.227] -- 0:02:05
      387500 -- (-1939.389) [-1933.340] (-1931.989) (-1937.258) * (-1936.074) (-1929.854) (-1937.065) [-1933.126] -- 0:02:04
      388000 -- [-1940.423] (-1933.080) (-1933.879) (-1934.548) * (-1941.471) [-1935.111] (-1932.046) (-1940.560) -- 0:02:04
      388500 -- (-1931.621) [-1933.337] (-1933.433) (-1936.092) * (-1940.661) (-1932.294) (-1935.774) [-1940.193] -- 0:02:04
      389000 -- (-1933.980) (-1940.277) (-1938.973) [-1937.761] * (-1939.238) (-1939.889) [-1934.058] (-1930.770) -- 0:02:04
      389500 -- [-1931.359] (-1937.708) (-1935.427) (-1944.344) * (-1939.229) (-1939.165) (-1931.313) [-1936.041] -- 0:02:03
      390000 -- (-1938.089) (-1929.566) [-1935.595] (-1937.767) * [-1933.725] (-1943.386) (-1931.216) (-1935.697) -- 0:02:05

      Average standard deviation of split frequencies: 0.000000

      390500 -- (-1942.079) (-1934.097) (-1933.723) [-1937.708] * (-1937.635) [-1931.296] (-1939.190) (-1931.821) -- 0:02:04
      391000 -- (-1934.167) (-1934.402) (-1933.690) [-1937.742] * [-1939.689] (-1936.279) (-1932.061) (-1931.709) -- 0:02:04
      391500 -- [-1932.986] (-1933.246) (-1933.953) (-1934.026) * (-1945.042) [-1934.725] (-1933.676) (-1936.995) -- 0:02:04
      392000 -- (-1933.703) [-1935.090] (-1939.706) (-1932.615) * (-1939.040) (-1939.409) (-1941.095) [-1933.634] -- 0:02:04
      392500 -- (-1936.862) (-1941.896) (-1936.770) [-1934.053] * (-1930.750) (-1935.353) [-1936.361] (-1935.242) -- 0:02:03
      393000 -- (-1932.291) [-1934.941] (-1936.761) (-1940.622) * (-1932.304) (-1935.271) (-1934.993) [-1934.102] -- 0:02:03
      393500 -- (-1930.992) (-1935.817) (-1933.862) [-1941.970] * (-1938.376) (-1937.290) [-1934.932] (-1935.881) -- 0:02:03
      394000 -- [-1932.923] (-1935.886) (-1931.233) (-1936.746) * [-1934.230] (-1935.121) (-1937.752) (-1934.991) -- 0:02:03
      394500 -- (-1942.846) [-1934.496] (-1934.474) (-1935.384) * (-1935.897) [-1939.934] (-1934.816) (-1936.679) -- 0:02:02
      395000 -- (-1939.619) [-1934.349] (-1942.894) (-1935.462) * [-1932.474] (-1936.720) (-1929.535) (-1936.028) -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-1935.598) (-1937.669) [-1938.613] (-1942.180) * (-1930.584) (-1941.668) [-1931.122] (-1933.888) -- 0:02:03
      396000 -- (-1935.934) [-1933.042] (-1940.782) (-1934.610) * (-1934.583) (-1932.481) [-1932.956] (-1934.716) -- 0:02:03
      396500 -- (-1933.378) [-1935.127] (-1935.621) (-1937.716) * (-1934.856) (-1943.889) (-1938.458) [-1933.813] -- 0:02:03
      397000 -- (-1935.680) (-1939.066) (-1931.757) [-1940.749] * [-1929.134] (-1940.128) (-1936.736) (-1936.499) -- 0:02:03
      397500 -- (-1937.126) (-1935.751) [-1935.735] (-1941.040) * (-1934.120) (-1940.934) [-1938.176] (-1936.122) -- 0:02:02
      398000 -- (-1937.190) (-1937.396) [-1938.158] (-1934.599) * (-1932.240) (-1941.278) [-1939.015] (-1939.667) -- 0:02:02
      398500 -- (-1939.134) [-1934.523] (-1947.599) (-1934.453) * (-1936.663) [-1936.761] (-1934.422) (-1932.959) -- 0:02:02
      399000 -- (-1936.005) (-1935.598) (-1938.806) [-1934.260] * (-1936.166) (-1938.302) (-1937.543) [-1932.494] -- 0:02:02
      399500 -- (-1935.744) (-1935.590) [-1936.261] (-1940.315) * (-1936.899) [-1936.014] (-1940.966) (-1936.407) -- 0:02:01
      400000 -- [-1930.802] (-1939.067) (-1936.840) (-1933.337) * (-1932.917) (-1941.784) (-1932.450) [-1935.624] -- 0:02:03

      Average standard deviation of split frequencies: 0.000000

      400500 -- (-1932.771) (-1939.570) [-1933.732] (-1932.996) * (-1939.788) (-1943.753) (-1939.533) [-1937.627] -- 0:02:02
      401000 -- (-1934.583) (-1938.242) [-1941.308] (-1935.936) * (-1939.631) [-1940.309] (-1941.785) (-1932.698) -- 0:02:02
      401500 -- [-1934.975] (-1939.151) (-1936.048) (-1936.321) * (-1930.549) [-1931.798] (-1934.668) (-1933.594) -- 0:02:02
      402000 -- (-1936.266) (-1946.843) [-1930.879] (-1934.897) * (-1937.617) [-1933.672] (-1934.579) (-1938.176) -- 0:02:01
      402500 -- [-1938.582] (-1941.470) (-1931.761) (-1931.866) * (-1934.047) (-1931.819) [-1929.840] (-1933.951) -- 0:02:01
      403000 -- (-1939.353) (-1942.922) (-1935.971) [-1932.422] * (-1940.877) (-1932.859) (-1931.755) [-1935.050] -- 0:02:01
      403500 -- (-1932.616) (-1931.398) (-1938.518) [-1931.024] * (-1932.845) (-1934.778) (-1930.605) [-1934.281] -- 0:02:01
      404000 -- (-1934.022) (-1941.830) (-1936.108) [-1936.554] * (-1937.543) (-1943.642) [-1936.583] (-1933.946) -- 0:02:00
      404500 -- (-1937.675) (-1935.668) (-1935.862) [-1935.743] * (-1937.194) (-1940.024) [-1937.718] (-1935.147) -- 0:02:00
      405000 -- (-1934.952) [-1932.941] (-1935.044) (-1936.970) * [-1930.024] (-1935.544) (-1942.491) (-1931.006) -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-1941.331) (-1937.938) (-1939.463) [-1936.605] * (-1934.782) (-1938.264) (-1936.440) [-1934.211] -- 0:02:01
      406000 -- (-1937.376) (-1939.623) [-1936.080] (-1934.964) * (-1938.470) (-1937.059) (-1937.663) [-1934.927] -- 0:02:01
      406500 -- (-1934.244) (-1933.652) [-1937.736] (-1935.767) * [-1935.585] (-1939.029) (-1937.457) (-1932.774) -- 0:02:01
      407000 -- (-1941.354) (-1940.270) [-1933.154] (-1942.200) * (-1940.440) (-1944.947) [-1933.571] (-1936.657) -- 0:02:00
      407500 -- [-1935.340] (-1935.388) (-1941.274) (-1930.733) * [-1936.160] (-1940.946) (-1941.411) (-1941.146) -- 0:02:00
      408000 -- (-1937.374) (-1938.206) [-1932.331] (-1931.463) * [-1938.932] (-1939.256) (-1937.130) (-1934.515) -- 0:02:00
      408500 -- [-1936.442] (-1935.361) (-1932.958) (-1935.637) * (-1935.292) [-1934.750] (-1934.284) (-1936.897) -- 0:02:00
      409000 -- (-1935.795) [-1934.279] (-1935.091) (-1941.673) * (-1937.349) (-1937.582) (-1932.717) [-1932.665] -- 0:01:59
      409500 -- [-1933.690] (-1933.412) (-1933.074) (-1933.962) * (-1928.449) (-1933.591) [-1930.263] (-1937.703) -- 0:01:59
      410000 -- [-1934.596] (-1938.656) (-1934.818) (-1931.503) * (-1940.758) (-1935.660) (-1935.260) [-1931.450] -- 0:02:00

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-1933.674) (-1938.908) (-1935.439) [-1934.268] * [-1930.756] (-1936.572) (-1937.613) (-1936.278) -- 0:02:00
      411000 -- [-1938.044] (-1936.445) (-1937.789) (-1941.641) * (-1939.048) (-1941.038) [-1938.106] (-1937.735) -- 0:02:00
      411500 -- (-1939.729) [-1932.085] (-1937.807) (-1934.118) * (-1939.579) (-1945.414) [-1933.096] (-1933.993) -- 0:02:00
      412000 -- [-1931.096] (-1934.454) (-1942.640) (-1935.135) * [-1937.703] (-1942.436) (-1938.203) (-1944.202) -- 0:01:59
      412500 -- (-1944.515) [-1931.467] (-1936.308) (-1938.415) * (-1937.333) [-1941.130] (-1935.362) (-1938.435) -- 0:01:59
      413000 -- (-1937.325) [-1934.072] (-1937.859) (-1940.462) * (-1937.406) [-1937.578] (-1939.993) (-1937.356) -- 0:01:59
      413500 -- (-1934.728) (-1928.817) [-1939.152] (-1946.656) * [-1935.420] (-1936.085) (-1937.268) (-1940.197) -- 0:01:59
      414000 -- (-1935.887) (-1934.726) [-1933.494] (-1942.131) * (-1932.047) [-1937.427] (-1939.610) (-1938.833) -- 0:01:58
      414500 -- [-1930.350] (-1933.267) (-1935.571) (-1940.025) * (-1936.952) (-1942.171) [-1937.088] (-1936.828) -- 0:01:58
      415000 -- [-1929.911] (-1932.117) (-1934.152) (-1934.023) * (-1933.040) [-1933.309] (-1938.143) (-1941.049) -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      415500 -- [-1938.147] (-1935.228) (-1935.741) (-1930.631) * (-1939.910) (-1932.807) [-1936.154] (-1933.288) -- 0:01:59
      416000 -- (-1937.150) [-1930.743] (-1933.089) (-1931.342) * (-1933.089) [-1939.514] (-1942.535) (-1933.081) -- 0:01:59
      416500 -- (-1932.736) (-1929.454) (-1938.249) [-1931.024] * (-1933.669) [-1937.074] (-1947.271) (-1936.150) -- 0:01:59
      417000 -- (-1939.178) [-1932.758] (-1937.927) (-1930.755) * [-1937.187] (-1937.342) (-1933.502) (-1935.263) -- 0:01:58
      417500 -- (-1936.422) (-1937.548) [-1937.425] (-1941.111) * [-1932.843] (-1935.596) (-1931.852) (-1932.565) -- 0:01:58
      418000 -- (-1934.988) [-1937.428] (-1941.711) (-1935.608) * [-1930.938] (-1935.007) (-1936.338) (-1936.735) -- 0:01:58
      418500 -- (-1937.792) [-1939.358] (-1947.097) (-1936.932) * (-1931.628) (-1936.940) [-1936.230] (-1930.107) -- 0:01:58
      419000 -- (-1937.510) (-1936.285) (-1933.367) [-1937.297] * [-1933.033] (-1938.368) (-1936.040) (-1934.588) -- 0:01:57
      419500 -- (-1935.252) (-1931.838) [-1940.324] (-1940.293) * (-1933.997) [-1935.450] (-1940.827) (-1935.804) -- 0:01:57
      420000 -- (-1935.454) [-1937.531] (-1933.104) (-1934.130) * [-1934.328] (-1933.095) (-1934.681) (-1938.233) -- 0:01:58

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-1941.015) (-1937.062) [-1932.721] (-1932.491) * (-1940.791) (-1940.954) [-1934.966] (-1938.596) -- 0:01:58
      421000 -- (-1941.711) (-1941.487) [-1937.452] (-1936.777) * [-1935.151] (-1939.424) (-1933.256) (-1931.937) -- 0:01:58
      421500 -- (-1938.183) (-1946.894) [-1934.599] (-1938.419) * (-1934.260) (-1938.544) [-1931.584] (-1936.163) -- 0:01:58
      422000 -- [-1937.037] (-1939.006) (-1935.220) (-1932.716) * (-1935.053) (-1937.410) (-1931.192) [-1933.338] -- 0:01:57
      422500 -- (-1937.451) (-1938.095) [-1929.392] (-1932.245) * (-1931.496) (-1931.994) [-1931.515] (-1942.444) -- 0:01:57
      423000 -- (-1937.963) [-1935.052] (-1936.535) (-1941.598) * [-1930.920] (-1934.145) (-1936.335) (-1935.876) -- 0:01:57
      423500 -- (-1931.846) [-1938.197] (-1931.229) (-1934.456) * (-1930.027) (-1939.451) (-1937.298) [-1941.366] -- 0:01:57
      424000 -- (-1937.860) (-1936.393) [-1932.837] (-1942.799) * (-1935.061) (-1931.971) (-1938.687) [-1931.129] -- 0:01:56
      424500 -- (-1932.959) (-1934.451) [-1933.426] (-1932.069) * (-1933.222) [-1931.504] (-1932.832) (-1935.247) -- 0:01:56
      425000 -- (-1931.655) (-1936.271) (-1935.307) [-1931.192] * (-1937.012) [-1935.017] (-1934.077) (-1932.806) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      425500 -- [-1933.072] (-1935.058) (-1935.218) (-1930.590) * (-1936.726) (-1939.024) [-1930.042] (-1934.024) -- 0:01:57
      426000 -- (-1934.859) (-1936.240) (-1934.157) [-1934.220] * (-1940.910) [-1934.612] (-1937.069) (-1936.583) -- 0:01:57
      426500 -- (-1933.054) [-1937.102] (-1938.768) (-1932.955) * [-1935.030] (-1936.218) (-1934.036) (-1935.707) -- 0:01:56
      427000 -- (-1932.661) [-1933.082] (-1928.689) (-1937.914) * (-1934.205) (-1934.185) [-1932.164] (-1939.231) -- 0:01:56
      427500 -- (-1938.204) [-1937.380] (-1933.978) (-1939.267) * (-1940.465) (-1938.644) (-1933.801) [-1930.636] -- 0:01:56
      428000 -- (-1936.580) [-1934.879] (-1937.885) (-1936.947) * (-1941.682) (-1938.200) [-1931.416] (-1937.506) -- 0:01:56
      428500 -- (-1937.474) (-1934.974) [-1938.871] (-1937.331) * (-1936.446) (-1934.798) (-1934.792) [-1938.866] -- 0:01:57
      429000 -- [-1935.202] (-1932.066) (-1931.656) (-1945.910) * (-1939.637) (-1933.290) (-1931.911) [-1947.292] -- 0:01:57
      429500 -- (-1936.159) (-1931.809) (-1934.517) [-1935.886] * (-1938.072) (-1929.160) [-1937.307] (-1935.191) -- 0:01:56
      430000 -- (-1935.834) [-1937.099] (-1934.254) (-1940.313) * (-1934.955) (-1936.690) [-1939.036] (-1936.010) -- 0:01:56

      Average standard deviation of split frequencies: 0.000000

      430500 -- [-1938.408] (-1938.865) (-1935.841) (-1939.247) * (-1931.453) (-1932.294) (-1941.202) [-1930.332] -- 0:01:56
      431000 -- [-1935.734] (-1944.423) (-1933.066) (-1939.518) * [-1935.987] (-1935.095) (-1932.807) (-1936.137) -- 0:01:56
      431500 -- [-1932.389] (-1938.290) (-1936.482) (-1938.384) * (-1931.682) (-1939.698) [-1937.433] (-1938.632) -- 0:01:55
      432000 -- (-1936.178) (-1938.754) [-1939.241] (-1933.368) * (-1933.751) (-1937.128) [-1932.362] (-1938.350) -- 0:01:55
      432500 -- (-1934.960) (-1934.465) (-1933.411) [-1939.278] * (-1942.063) (-1938.703) [-1932.161] (-1930.061) -- 0:01:55
      433000 -- [-1933.409] (-1933.963) (-1934.110) (-1940.255) * (-1939.852) (-1936.777) [-1936.601] (-1935.576) -- 0:01:55
      433500 -- [-1938.838] (-1934.217) (-1937.062) (-1937.877) * (-1936.296) (-1941.383) (-1942.899) [-1932.896] -- 0:01:56
      434000 -- [-1931.685] (-1934.572) (-1935.392) (-1947.343) * [-1932.719] (-1938.027) (-1937.988) (-1940.873) -- 0:01:56
      434500 -- (-1936.807) (-1938.497) [-1935.007] (-1936.939) * (-1937.562) (-1936.120) [-1945.436] (-1940.080) -- 0:01:55
      435000 -- (-1933.598) [-1933.189] (-1938.027) (-1941.130) * (-1935.082) [-1933.702] (-1953.963) (-1937.948) -- 0:01:55

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-1930.967) (-1935.176) (-1936.510) [-1939.166] * (-1937.375) (-1931.981) [-1934.076] (-1937.762) -- 0:01:55
      436000 -- (-1934.285) (-1945.572) (-1933.568) [-1941.026] * (-1936.228) (-1931.895) [-1938.432] (-1938.204) -- 0:01:55
      436500 -- (-1938.283) (-1943.408) [-1930.999] (-1935.829) * (-1934.269) (-1935.348) [-1935.573] (-1933.468) -- 0:01:54
      437000 -- [-1935.938] (-1936.370) (-1936.888) (-1931.540) * (-1934.149) (-1942.900) (-1932.891) [-1934.160] -- 0:01:54
      437500 -- (-1933.062) (-1933.355) (-1942.236) [-1937.645] * (-1939.340) (-1935.533) [-1936.031] (-1938.794) -- 0:01:54
      438000 -- (-1937.657) [-1937.063] (-1937.147) (-1942.153) * [-1933.250] (-1937.951) (-1936.806) (-1933.770) -- 0:01:55
      438500 -- [-1942.566] (-1937.977) (-1936.524) (-1934.921) * (-1938.930) (-1932.623) (-1933.056) [-1934.846] -- 0:01:55
      439000 -- [-1937.357] (-1934.419) (-1928.559) (-1933.947) * [-1936.727] (-1931.988) (-1933.273) (-1937.239) -- 0:01:55
      439500 -- (-1946.267) (-1932.233) [-1932.766] (-1938.527) * (-1933.730) [-1933.331] (-1937.329) (-1938.027) -- 0:01:54
      440000 -- [-1938.938] (-1933.445) (-1938.355) (-1940.893) * (-1938.337) (-1935.122) [-1934.559] (-1948.046) -- 0:01:54

      Average standard deviation of split frequencies: 0.000000

      440500 -- (-1940.733) (-1936.078) [-1929.359] (-1937.698) * (-1938.441) (-1930.517) [-1934.911] (-1950.771) -- 0:01:54
      441000 -- (-1935.117) [-1936.109] (-1938.469) (-1933.956) * (-1941.363) [-1933.146] (-1932.121) (-1938.223) -- 0:01:54
      441500 -- (-1936.438) (-1934.466) [-1936.189] (-1936.506) * (-1935.961) [-1932.733] (-1939.716) (-1941.897) -- 0:01:53
      442000 -- (-1941.146) [-1934.000] (-1937.333) (-1942.914) * (-1930.518) (-1941.474) (-1933.406) [-1942.611] -- 0:01:53
      442500 -- (-1942.812) (-1936.409) [-1933.733] (-1938.336) * (-1932.380) (-1941.008) [-1943.251] (-1936.257) -- 0:01:53
      443000 -- (-1935.237) [-1932.948] (-1936.535) (-1933.091) * [-1939.849] (-1946.149) (-1936.553) (-1936.171) -- 0:01:54
      443500 -- (-1933.495) [-1940.869] (-1941.381) (-1935.821) * (-1940.501) (-1936.590) [-1932.597] (-1937.098) -- 0:01:54
      444000 -- (-1936.282) [-1931.830] (-1939.758) (-1933.868) * [-1938.632] (-1939.412) (-1933.642) (-1935.085) -- 0:01:53
      444500 -- (-1930.751) [-1934.253] (-1936.214) (-1936.713) * (-1941.918) (-1933.476) [-1933.911] (-1934.246) -- 0:01:53
      445000 -- (-1936.580) [-1946.169] (-1933.273) (-1937.136) * (-1940.126) (-1936.291) (-1934.572) [-1936.642] -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-1934.240) [-1940.320] (-1934.152) (-1940.217) * (-1936.073) [-1929.449] (-1950.262) (-1939.369) -- 0:01:53
      446000 -- (-1936.805) [-1933.115] (-1930.915) (-1936.745) * (-1938.831) (-1935.751) (-1944.460) [-1942.600] -- 0:01:53
      446500 -- (-1937.929) (-1938.487) [-1931.873] (-1935.705) * (-1944.125) (-1939.522) [-1933.431] (-1933.942) -- 0:01:52
      447000 -- (-1933.578) (-1936.882) [-1932.487] (-1936.762) * (-1935.055) (-1937.906) [-1930.626] (-1936.194) -- 0:01:52
      447500 -- [-1931.518] (-1934.200) (-1939.188) (-1939.253) * [-1933.140] (-1936.352) (-1946.067) (-1939.383) -- 0:01:53
      448000 -- [-1931.603] (-1939.102) (-1934.318) (-1934.571) * [-1931.256] (-1934.581) (-1937.626) (-1938.366) -- 0:01:53
      448500 -- (-1934.163) [-1939.292] (-1934.644) (-1934.766) * [-1934.127] (-1942.510) (-1947.849) (-1941.610) -- 0:01:53
      449000 -- (-1932.079) (-1936.336) (-1930.403) [-1931.723] * (-1942.165) (-1942.042) [-1931.703] (-1945.746) -- 0:01:52
      449500 -- [-1933.722] (-1940.494) (-1937.420) (-1935.361) * (-1937.511) (-1935.779) (-1936.803) [-1936.488] -- 0:01:52
      450000 -- (-1932.648) (-1943.481) [-1936.611] (-1940.712) * (-1936.854) [-1935.984] (-1939.734) (-1934.855) -- 0:01:52

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-1933.962) [-1934.792] (-1931.650) (-1942.295) * (-1934.303) (-1937.785) (-1934.982) [-1934.940] -- 0:01:52
      451000 -- [-1938.323] (-1937.391) (-1941.053) (-1937.425) * (-1933.183) (-1940.472) [-1933.405] (-1933.166) -- 0:01:51
      451500 -- (-1940.701) (-1935.819) (-1940.971) [-1937.384] * [-1934.625] (-1939.274) (-1932.392) (-1934.016) -- 0:01:51
      452000 -- (-1940.602) (-1936.583) [-1940.175] (-1931.266) * (-1934.515) (-1931.466) [-1937.973] (-1937.771) -- 0:01:51
      452500 -- [-1936.099] (-1942.863) (-1938.760) (-1934.561) * (-1939.971) (-1934.712) (-1932.973) [-1933.724] -- 0:01:52
      453000 -- (-1936.125) [-1934.549] (-1937.404) (-1937.824) * (-1942.051) (-1933.309) [-1933.042] (-1932.262) -- 0:01:52
      453500 -- [-1933.809] (-1940.883) (-1935.267) (-1940.754) * (-1944.718) (-1932.799) (-1933.078) [-1933.901] -- 0:01:52
      454000 -- [-1933.286] (-1941.622) (-1935.654) (-1936.186) * (-1937.402) (-1936.400) [-1933.882] (-1938.853) -- 0:01:51
      454500 -- (-1934.347) (-1936.319) [-1931.981] (-1935.730) * [-1936.375] (-1935.766) (-1936.760) (-1936.713) -- 0:01:51
      455000 -- (-1937.880) (-1936.258) (-1937.197) [-1932.500] * (-1935.360) [-1939.070] (-1933.590) (-1941.913) -- 0:01:51

      Average standard deviation of split frequencies: 0.000000

      455500 -- (-1933.839) [-1936.487] (-1940.512) (-1936.734) * (-1933.703) (-1936.497) (-1936.384) [-1930.026] -- 0:01:51
      456000 -- (-1931.919) (-1931.413) (-1936.239) [-1941.449] * (-1936.190) (-1935.802) (-1935.325) [-1936.813] -- 0:01:50
      456500 -- (-1936.180) (-1933.713) (-1942.854) [-1932.803] * (-1940.124) (-1936.123) [-1940.211] (-1938.186) -- 0:01:50
      457000 -- [-1930.865] (-1933.358) (-1934.753) (-1932.501) * (-1932.434) (-1931.768) [-1930.847] (-1935.482) -- 0:01:51
      457500 -- (-1937.097) (-1933.825) (-1934.529) [-1929.309] * (-1935.888) (-1941.314) [-1939.186] (-1941.005) -- 0:01:51
      458000 -- [-1932.417] (-1937.764) (-1932.617) (-1934.118) * (-1933.120) (-1939.894) [-1931.189] (-1936.225) -- 0:01:51
      458500 -- [-1935.620] (-1931.871) (-1930.082) (-1930.855) * (-1935.538) (-1935.783) (-1939.746) [-1936.130] -- 0:01:51
      459000 -- (-1936.063) [-1932.876] (-1934.338) (-1934.805) * (-1938.697) (-1936.102) [-1937.847] (-1929.744) -- 0:01:50
      459500 -- (-1936.713) (-1933.514) [-1934.194] (-1936.723) * [-1937.064] (-1933.777) (-1943.295) (-1933.820) -- 0:01:50
      460000 -- (-1938.175) (-1937.593) (-1935.814) [-1936.551] * (-1933.332) (-1939.446) (-1934.474) [-1935.198] -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      460500 -- [-1936.316] (-1935.032) (-1938.794) (-1936.369) * (-1934.347) (-1934.164) [-1937.876] (-1939.871) -- 0:01:50
      461000 -- (-1936.704) (-1936.781) (-1938.210) [-1933.366] * (-1934.823) (-1934.599) (-1933.958) [-1942.402] -- 0:01:49
      461500 -- (-1934.028) [-1937.253] (-1943.121) (-1935.238) * (-1938.263) [-1935.561] (-1933.240) (-1941.497) -- 0:01:49
      462000 -- (-1935.969) (-1934.353) (-1935.104) [-1931.990] * [-1939.184] (-1938.526) (-1936.371) (-1937.486) -- 0:01:50
      462500 -- (-1935.458) (-1936.903) (-1932.558) [-1941.573] * (-1936.636) (-1940.999) [-1933.605] (-1942.093) -- 0:01:50
      463000 -- [-1933.823] (-1940.023) (-1938.583) (-1941.074) * (-1931.925) [-1937.224] (-1935.715) (-1937.661) -- 0:01:50
      463500 -- (-1933.601) (-1932.021) [-1933.034] (-1945.693) * [-1932.529] (-1937.052) (-1934.002) (-1934.809) -- 0:01:49
      464000 -- (-1936.617) (-1933.227) [-1934.787] (-1934.127) * (-1937.661) [-1932.944] (-1935.315) (-1935.484) -- 0:01:49
      464500 -- (-1939.933) [-1939.616] (-1938.692) (-1936.292) * (-1937.544) [-1933.508] (-1936.647) (-1936.966) -- 0:01:49
      465000 -- (-1936.396) [-1931.795] (-1934.841) (-1932.601) * (-1932.247) (-1934.884) (-1939.444) [-1943.638] -- 0:01:49

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-1936.359) (-1937.070) [-1934.465] (-1935.539) * (-1932.857) (-1933.825) (-1940.838) [-1936.349] -- 0:01:50
      466000 -- (-1935.457) [-1933.483] (-1936.938) (-1936.382) * (-1936.850) (-1933.634) [-1934.946] (-1934.033) -- 0:01:50
      466500 -- [-1937.239] (-1937.111) (-1935.429) (-1931.096) * (-1935.576) [-1932.742] (-1938.835) (-1932.777) -- 0:01:49
      467000 -- (-1936.222) (-1942.369) (-1941.255) [-1935.067] * (-1937.603) (-1929.677) (-1940.503) [-1935.521] -- 0:01:49
      467500 -- (-1934.679) [-1933.083] (-1950.085) (-1935.814) * (-1931.329) (-1937.821) (-1931.283) [-1934.262] -- 0:01:49
      468000 -- (-1935.407) [-1934.255] (-1937.768) (-1938.869) * (-1933.964) (-1935.530) [-1939.008] (-1940.997) -- 0:01:49
      468500 -- [-1932.653] (-1934.435) (-1933.017) (-1936.139) * (-1938.330) (-1929.675) (-1939.595) [-1934.310] -- 0:01:48
      469000 -- (-1941.111) (-1939.117) (-1933.157) [-1940.229] * [-1934.488] (-1931.052) (-1947.187) (-1930.727) -- 0:01:48
      469500 -- [-1929.302] (-1933.864) (-1935.563) (-1937.549) * (-1937.431) (-1933.317) (-1942.674) [-1932.427] -- 0:01:48
      470000 -- (-1941.525) (-1937.972) [-1936.257] (-1935.052) * (-1933.774) (-1937.048) (-1938.108) [-1933.935] -- 0:01:48

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-1933.745) (-1933.438) (-1936.713) [-1932.748] * (-1935.145) (-1938.651) [-1939.804] (-1939.246) -- 0:01:49
      471000 -- (-1940.034) (-1936.213) (-1935.963) [-1932.703] * (-1933.068) (-1941.146) [-1932.826] (-1937.722) -- 0:01:48
      471500 -- (-1935.263) (-1937.217) [-1935.643] (-1933.693) * (-1934.342) (-1935.812) (-1945.861) [-1936.432] -- 0:01:48
      472000 -- (-1936.224) (-1937.366) [-1937.325] (-1940.107) * [-1942.768] (-1934.415) (-1937.793) (-1930.682) -- 0:01:48
      472500 -- (-1943.820) (-1936.830) (-1941.237) [-1931.926] * (-1934.613) (-1936.935) (-1934.084) [-1936.409] -- 0:01:48
      473000 -- (-1933.286) (-1951.629) [-1932.895] (-1932.172) * (-1935.939) [-1935.144] (-1939.686) (-1931.731) -- 0:01:48
      473500 -- [-1930.813] (-1933.030) (-1937.479) (-1932.890) * (-1932.792) [-1933.402] (-1937.878) (-1939.818) -- 0:01:47
      474000 -- [-1933.051] (-1935.215) (-1935.686) (-1941.652) * (-1937.510) [-1935.032] (-1941.545) (-1932.536) -- 0:01:47
      474500 -- (-1937.600) [-1936.496] (-1930.300) (-1936.735) * [-1932.270] (-1938.794) (-1940.347) (-1940.041) -- 0:01:47
      475000 -- (-1937.407) (-1934.525) (-1940.322) [-1935.869] * (-1934.654) (-1936.262) (-1938.700) [-1936.907] -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-1945.569) (-1936.541) (-1935.434) [-1935.145] * (-1933.694) [-1932.193] (-1934.304) (-1932.822) -- 0:01:48
      476000 -- (-1941.898) (-1933.966) (-1936.578) [-1931.852] * [-1932.994] (-1935.077) (-1935.046) (-1941.268) -- 0:01:47
      476500 -- (-1940.132) (-1933.325) [-1935.688] (-1931.015) * (-1935.327) (-1936.478) (-1940.110) [-1938.436] -- 0:01:47
      477000 -- [-1932.013] (-1931.421) (-1938.209) (-1938.347) * (-1935.512) (-1938.419) (-1943.481) [-1939.978] -- 0:01:47
      477500 -- (-1937.395) (-1931.415) (-1939.814) [-1936.692] * [-1934.174] (-1937.102) (-1940.226) (-1945.939) -- 0:01:47
      478000 -- [-1933.036] (-1942.083) (-1939.132) (-1940.241) * (-1934.051) [-1934.207] (-1936.535) (-1939.181) -- 0:01:47
      478500 -- [-1933.423] (-1935.633) (-1940.115) (-1939.091) * (-1932.595) (-1937.963) [-1937.467] (-1931.601) -- 0:01:46
      479000 -- (-1937.929) [-1937.918] (-1935.937) (-1941.816) * [-1934.385] (-1936.059) (-1932.993) (-1929.322) -- 0:01:46
      479500 -- (-1932.483) (-1936.030) (-1936.803) [-1933.937] * (-1933.641) (-1932.948) [-1937.007] (-1931.520) -- 0:01:46
      480000 -- (-1938.340) (-1937.330) [-1942.119] (-1937.162) * (-1936.358) [-1932.993] (-1937.831) (-1935.136) -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-1938.471) (-1933.497) (-1935.499) [-1934.774] * [-1943.006] (-1937.737) (-1933.662) (-1933.099) -- 0:01:47
      481000 -- (-1932.378) (-1933.861) [-1935.576] (-1932.949) * [-1941.882] (-1937.178) (-1930.357) (-1938.692) -- 0:01:46
      481500 -- (-1939.695) (-1931.870) (-1937.858) [-1935.742] * (-1945.795) (-1942.205) (-1938.179) [-1940.101] -- 0:01:46
      482000 -- (-1934.988) [-1934.950] (-1939.515) (-1936.006) * [-1939.368] (-1930.885) (-1932.649) (-1937.124) -- 0:01:46
      482500 -- (-1932.751) (-1941.104) [-1936.719] (-1939.825) * (-1940.399) [-1933.677] (-1932.734) (-1941.316) -- 0:01:46
      483000 -- [-1935.170] (-1937.482) (-1940.292) (-1945.829) * (-1938.275) (-1935.276) [-1934.653] (-1943.212) -- 0:01:45
      483500 -- (-1937.646) [-1932.160] (-1932.625) (-1940.817) * (-1934.098) [-1933.613] (-1936.227) (-1936.743) -- 0:01:45
      484000 -- (-1934.637) (-1933.905) (-1932.319) [-1938.452] * [-1936.991] (-1935.146) (-1942.324) (-1942.661) -- 0:01:45
      484500 -- (-1936.875) (-1935.237) [-1939.781] (-1940.613) * (-1937.688) [-1933.872] (-1940.896) (-1933.804) -- 0:01:45
      485000 -- (-1939.302) [-1934.219] (-1933.888) (-1932.220) * (-1935.138) (-1932.208) (-1938.660) [-1933.085] -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      485500 -- [-1932.009] (-1932.651) (-1933.981) (-1938.471) * [-1930.517] (-1938.141) (-1942.866) (-1936.731) -- 0:01:45
      486000 -- [-1938.973] (-1937.584) (-1937.588) (-1937.968) * [-1935.833] (-1936.245) (-1948.411) (-1935.239) -- 0:01:45
      486500 -- (-1936.046) (-1937.420) (-1936.604) [-1934.728] * (-1931.608) (-1935.144) (-1938.774) [-1937.300] -- 0:01:45
      487000 -- (-1936.394) (-1931.899) [-1931.855] (-1936.820) * (-1935.708) (-1936.745) [-1934.690] (-1937.162) -- 0:01:45
      487500 -- (-1937.571) (-1934.452) (-1938.258) [-1932.972] * (-1940.692) (-1938.609) (-1935.088) [-1936.471] -- 0:01:45
      488000 -- (-1938.943) (-1939.601) [-1935.690] (-1936.639) * (-1938.985) (-1936.423) [-1933.732] (-1935.500) -- 0:01:44
      488500 -- [-1931.723] (-1942.667) (-1935.214) (-1933.480) * (-1941.748) [-1933.584] (-1936.711) (-1939.881) -- 0:01:44
      489000 -- (-1933.163) (-1947.445) (-1940.125) [-1936.394] * (-1934.272) (-1936.635) (-1939.583) [-1940.376] -- 0:01:44
      489500 -- (-1936.889) (-1934.398) (-1937.390) [-1934.282] * (-1938.772) (-1940.082) [-1934.969] (-1937.521) -- 0:01:44
      490000 -- (-1934.577) (-1940.500) [-1934.595] (-1934.765) * [-1935.736] (-1935.518) (-1939.195) (-1931.192) -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      490500 -- [-1933.940] (-1933.707) (-1932.848) (-1942.630) * (-1938.782) [-1938.878] (-1936.600) (-1939.256) -- 0:01:44
      491000 -- [-1935.691] (-1929.564) (-1938.407) (-1938.733) * [-1935.018] (-1933.557) (-1938.730) (-1932.440) -- 0:01:44
      491500 -- (-1932.641) [-1930.199] (-1930.553) (-1931.560) * (-1940.490) [-1936.174] (-1932.509) (-1935.138) -- 0:01:44
      492000 -- (-1936.853) [-1939.870] (-1936.855) (-1936.637) * (-1934.448) (-1938.334) (-1942.464) [-1934.299] -- 0:01:44
      492500 -- (-1938.365) [-1938.179] (-1935.976) (-1935.562) * (-1936.789) (-1942.100) (-1937.897) [-1933.738] -- 0:01:44
      493000 -- (-1941.137) (-1938.983) (-1934.256) [-1934.059] * (-1935.933) (-1937.428) (-1939.356) [-1936.608] -- 0:01:43
      493500 -- (-1937.346) (-1942.832) [-1939.726] (-1935.842) * [-1933.624] (-1932.445) (-1933.347) (-1941.263) -- 0:01:43
      494000 -- [-1935.671] (-1940.865) (-1938.532) (-1937.710) * (-1933.210) (-1931.176) [-1933.996] (-1939.596) -- 0:01:43
      494500 -- (-1934.727) (-1941.306) [-1933.271] (-1939.786) * [-1935.444] (-1935.005) (-1932.118) (-1932.181) -- 0:01:44
      495000 -- [-1932.145] (-1941.215) (-1941.243) (-1937.397) * (-1930.620) [-1936.474] (-1930.603) (-1938.015) -- 0:01:44

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-1934.314) (-1931.710) [-1933.107] (-1938.552) * (-1932.463) (-1933.151) [-1937.876] (-1942.753) -- 0:01:43
      496000 -- (-1936.621) (-1938.386) (-1933.009) [-1934.608] * [-1937.016] (-1937.222) (-1939.426) (-1930.609) -- 0:01:43
      496500 -- (-1934.213) [-1932.189] (-1931.134) (-1937.662) * (-1935.980) [-1937.082] (-1939.755) (-1936.864) -- 0:01:43
      497000 -- (-1934.416) [-1934.778] (-1929.657) (-1939.628) * (-1938.603) [-1933.992] (-1941.899) (-1933.375) -- 0:01:43
      497500 -- (-1933.729) [-1936.772] (-1936.304) (-1939.610) * (-1944.678) [-1934.759] (-1936.392) (-1928.920) -- 0:01:43
      498000 -- [-1932.695] (-1934.313) (-1942.658) (-1931.965) * (-1940.336) (-1939.737) [-1934.712] (-1931.480) -- 0:01:43
      498500 -- (-1931.813) (-1944.808) (-1941.681) [-1935.476] * (-1937.784) (-1935.073) [-1934.363] (-1937.427) -- 0:01:43
      499000 -- (-1934.842) (-1938.786) (-1934.029) [-1930.426] * (-1937.006) [-1935.277] (-1938.119) (-1935.566) -- 0:01:43
      499500 -- [-1935.926] (-1935.485) (-1929.268) (-1933.065) * (-1937.996) (-1931.424) [-1930.508] (-1934.173) -- 0:01:43
      500000 -- (-1935.512) (-1935.086) (-1933.052) [-1934.164] * (-1941.044) (-1930.941) (-1937.453) [-1931.793] -- 0:01:43

      Average standard deviation of split frequencies: 0.000000

      500500 -- [-1934.781] (-1941.821) (-1934.095) (-1932.574) * (-1938.400) (-1932.176) [-1936.644] (-1938.289) -- 0:01:42
      501000 -- (-1936.199) (-1934.053) (-1941.163) [-1931.905] * (-1936.784) (-1932.112) (-1937.375) [-1938.113] -- 0:01:42
      501500 -- (-1932.968) [-1934.436] (-1934.430) (-1944.539) * (-1939.636) (-1937.766) (-1939.494) [-1930.127] -- 0:01:42
      502000 -- [-1932.196] (-1937.687) (-1938.721) (-1931.870) * (-1934.656) [-1929.974] (-1935.572) (-1931.399) -- 0:01:42
      502500 -- [-1931.401] (-1932.108) (-1930.432) (-1937.288) * [-1935.556] (-1932.869) (-1937.027) (-1944.063) -- 0:01:41
      503000 -- (-1929.548) (-1933.835) (-1938.561) [-1929.092] * [-1938.577] (-1933.611) (-1937.278) (-1941.713) -- 0:01:42
      503500 -- (-1934.330) [-1936.855] (-1931.170) (-1935.125) * (-1936.716) (-1934.911) (-1938.081) [-1935.637] -- 0:01:42
      504000 -- (-1934.067) (-1940.526) [-1932.726] (-1939.638) * (-1934.570) [-1939.829] (-1942.495) (-1930.823) -- 0:01:42
      504500 -- [-1939.830] (-1940.277) (-1940.246) (-1937.905) * (-1937.896) [-1934.923] (-1934.844) (-1934.195) -- 0:01:42
      505000 -- (-1941.855) (-1937.911) (-1935.568) [-1933.814] * (-1936.136) (-1940.252) (-1940.731) [-1933.425] -- 0:01:41

      Average standard deviation of split frequencies: 0.000000

      505500 -- (-1933.985) [-1934.848] (-1931.723) (-1936.741) * (-1939.053) [-1933.314] (-1942.141) (-1938.435) -- 0:01:41
      506000 -- (-1934.560) (-1948.395) [-1929.859] (-1936.432) * [-1937.752] (-1940.077) (-1934.060) (-1938.676) -- 0:01:41
      506500 -- (-1939.178) (-1934.018) [-1931.231] (-1932.276) * (-1933.483) (-1943.188) (-1940.240) [-1931.791] -- 0:01:41
      507000 -- (-1938.622) (-1939.232) [-1931.542] (-1937.728) * (-1938.930) [-1934.179] (-1940.332) (-1934.348) -- 0:01:41
      507500 -- (-1934.323) [-1937.653] (-1934.583) (-1935.908) * (-1941.152) (-1940.321) (-1938.953) [-1933.980] -- 0:01:41
      508000 -- [-1934.784] (-1936.783) (-1935.646) (-1937.689) * [-1933.992] (-1938.702) (-1936.300) (-1934.874) -- 0:01:41
      508500 -- [-1930.953] (-1930.074) (-1933.870) (-1933.965) * [-1934.829] (-1935.851) (-1936.070) (-1937.985) -- 0:01:41
      509000 -- [-1930.189] (-1932.168) (-1933.881) (-1936.714) * (-1933.731) (-1935.556) [-1934.904] (-1935.424) -- 0:01:41
      509500 -- (-1935.925) (-1937.723) [-1935.918] (-1941.702) * [-1935.154] (-1939.408) (-1934.333) (-1934.678) -- 0:01:41
      510000 -- (-1930.501) (-1937.169) [-1936.350] (-1932.365) * [-1940.376] (-1932.393) (-1937.769) (-1938.295) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      510500 -- (-1931.495) [-1937.501] (-1933.251) (-1935.236) * (-1933.005) (-1932.100) (-1937.368) [-1937.960] -- 0:01:40
      511000 -- (-1934.321) (-1935.762) (-1936.812) [-1933.985] * [-1934.110] (-1931.690) (-1932.148) (-1937.587) -- 0:01:40
      511500 -- (-1938.018) [-1934.559] (-1934.937) (-1941.834) * (-1941.796) [-1944.541] (-1933.625) (-1939.455) -- 0:01:40
      512000 -- (-1932.482) [-1936.659] (-1935.034) (-1940.330) * (-1935.852) (-1936.274) (-1949.426) [-1936.354] -- 0:01:40
      512500 -- [-1933.599] (-1937.065) (-1937.573) (-1941.958) * [-1941.308] (-1937.948) (-1936.823) (-1942.912) -- 0:01:40
      513000 -- [-1935.647] (-1947.638) (-1932.092) (-1937.544) * [-1934.658] (-1935.936) (-1939.748) (-1936.177) -- 0:01:40
      513500 -- (-1943.505) [-1936.179] (-1933.377) (-1930.241) * [-1933.221] (-1934.081) (-1940.267) (-1936.982) -- 0:01:40
      514000 -- (-1934.618) (-1933.339) [-1936.361] (-1936.234) * (-1937.028) [-1933.693] (-1941.004) (-1934.301) -- 0:01:40
      514500 -- (-1935.373) (-1943.230) [-1938.710] (-1929.767) * (-1939.465) (-1937.823) (-1939.460) [-1933.976] -- 0:01:40
      515000 -- (-1935.044) (-1937.858) (-1945.395) [-1931.953] * (-1939.294) [-1933.386] (-1940.143) (-1936.971) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-1929.945) [-1936.437] (-1935.401) (-1933.449) * (-1944.222) (-1939.441) [-1932.340] (-1934.708) -- 0:01:39
      516000 -- [-1934.441] (-1935.387) (-1937.034) (-1936.194) * (-1935.514) (-1938.052) [-1934.780] (-1930.748) -- 0:01:39
      516500 -- (-1935.924) (-1944.112) [-1938.025] (-1937.114) * (-1935.034) (-1946.205) (-1935.290) [-1932.909] -- 0:01:39
      517000 -- (-1938.222) [-1938.931] (-1931.984) (-1936.014) * (-1941.052) (-1936.289) [-1933.394] (-1935.565) -- 0:01:39
      517500 -- [-1937.816] (-1932.708) (-1934.189) (-1936.107) * [-1934.750] (-1939.614) (-1934.762) (-1933.025) -- 0:01:39
      518000 -- [-1938.778] (-1938.052) (-1936.934) (-1939.067) * (-1934.768) (-1942.847) (-1934.112) [-1934.583] -- 0:01:39
      518500 -- (-1938.303) (-1933.185) (-1942.212) [-1937.358] * (-1936.761) (-1935.512) [-1929.469] (-1933.897) -- 0:01:39
      519000 -- (-1931.371) (-1934.333) (-1931.796) [-1939.528] * (-1932.925) (-1941.116) (-1932.559) [-1937.517] -- 0:01:39
      519500 -- (-1935.247) (-1935.884) (-1935.528) [-1935.995] * (-1935.107) (-1936.763) (-1940.868) [-1934.641] -- 0:01:38
      520000 -- (-1934.536) (-1942.846) (-1939.873) [-1937.675] * [-1933.581] (-1938.698) (-1937.603) (-1936.482) -- 0:01:38

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-1935.070) (-1941.205) (-1935.346) [-1933.556] * (-1934.534) (-1932.822) (-1941.002) [-1933.972] -- 0:01:38
      521000 -- (-1937.685) (-1939.490) [-1936.682] (-1951.110) * (-1933.116) [-1933.852] (-1936.760) (-1936.610) -- 0:01:38
      521500 -- (-1939.843) (-1937.535) (-1934.867) [-1939.952] * (-1933.176) [-1938.565] (-1935.701) (-1940.726) -- 0:01:38
      522000 -- (-1946.318) [-1939.437] (-1931.425) (-1936.374) * (-1934.597) (-1936.291) [-1938.112] (-1933.532) -- 0:01:38
      522500 -- (-1937.443) (-1941.974) (-1934.817) [-1933.080] * (-1932.328) (-1941.176) [-1935.759] (-1938.629) -- 0:01:38
      523000 -- (-1940.120) (-1940.442) [-1933.187] (-1935.653) * (-1942.121) (-1939.253) [-1935.666] (-1934.246) -- 0:01:38
      523500 -- (-1936.763) (-1941.309) (-1939.885) [-1932.937] * [-1931.822] (-1946.247) (-1933.832) (-1933.676) -- 0:01:38
      524000 -- (-1936.553) (-1935.733) (-1936.220) [-1934.181] * [-1935.094] (-1942.869) (-1944.559) (-1939.298) -- 0:01:38
      524500 -- (-1936.048) (-1936.602) (-1939.343) [-1935.035] * [-1935.866] (-1944.905) (-1935.572) (-1935.059) -- 0:01:37
      525000 -- [-1930.688] (-1932.788) (-1936.395) (-1938.175) * [-1936.431] (-1947.980) (-1934.453) (-1935.913) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-1934.740) (-1939.333) (-1941.436) [-1933.384] * (-1931.357) [-1941.141] (-1932.756) (-1930.447) -- 0:01:37
      526000 -- (-1934.426) (-1937.824) (-1937.517) [-1936.389] * (-1936.719) (-1939.286) (-1929.550) [-1936.166] -- 0:01:37
      526500 -- (-1933.829) [-1931.146] (-1930.499) (-1934.805) * (-1931.309) (-1937.888) (-1938.208) [-1931.752] -- 0:01:38
      527000 -- (-1931.065) (-1939.357) [-1932.132] (-1935.978) * [-1934.917] (-1933.408) (-1934.821) (-1932.186) -- 0:01:37
      527500 -- (-1932.834) (-1939.243) [-1930.699] (-1937.500) * (-1937.880) (-1932.892) [-1935.285] (-1933.155) -- 0:01:37
      528000 -- (-1939.207) [-1933.650] (-1938.746) (-1933.224) * [-1939.230] (-1935.455) (-1934.802) (-1937.690) -- 0:01:37
      528500 -- (-1935.008) [-1934.057] (-1941.158) (-1938.952) * (-1940.724) [-1936.954] (-1941.864) (-1934.516) -- 0:01:37
      529000 -- (-1935.544) (-1934.712) (-1935.435) [-1935.500] * [-1933.918] (-1938.417) (-1935.288) (-1937.985) -- 0:01:37
      529500 -- (-1940.189) [-1934.071] (-1944.340) (-1937.421) * [-1933.569] (-1938.117) (-1937.694) (-1940.960) -- 0:01:36
      530000 -- (-1936.605) (-1936.317) [-1936.141] (-1937.485) * (-1938.781) (-1935.811) (-1934.886) [-1929.847] -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-1947.767) (-1939.811) (-1948.949) [-1935.760] * (-1932.416) (-1934.359) [-1934.258] (-1933.457) -- 0:01:36
      531000 -- (-1934.597) (-1941.230) (-1938.163) [-1931.841] * (-1937.014) [-1933.757] (-1936.909) (-1933.326) -- 0:01:36
      531500 -- [-1934.498] (-1940.207) (-1936.889) (-1942.718) * (-1934.204) [-1931.370] (-1937.665) (-1931.013) -- 0:01:36
      532000 -- (-1934.908) (-1929.537) [-1934.330] (-1936.071) * (-1937.423) [-1936.989] (-1936.034) (-1932.195) -- 0:01:36
      532500 -- [-1930.816] (-1931.791) (-1932.516) (-1934.783) * [-1934.984] (-1938.490) (-1939.339) (-1937.132) -- 0:01:36
      533000 -- (-1937.688) [-1934.431] (-1936.211) (-1939.216) * (-1934.720) (-1940.135) (-1938.439) [-1933.518] -- 0:01:36
      533500 -- (-1935.660) (-1935.554) (-1931.976) [-1933.065] * (-1939.534) [-1935.714] (-1938.444) (-1932.052) -- 0:01:36
      534000 -- [-1938.871] (-1935.520) (-1931.650) (-1939.919) * (-1935.072) (-1941.940) [-1939.777] (-1934.834) -- 0:01:35
      534500 -- (-1937.308) (-1938.057) [-1936.412] (-1935.334) * [-1937.386] (-1938.065) (-1939.922) (-1940.247) -- 0:01:35
      535000 -- (-1938.604) [-1938.645] (-1934.481) (-1930.777) * (-1940.682) (-1933.026) (-1945.945) [-1934.123] -- 0:01:35

      Average standard deviation of split frequencies: 0.000000

      535500 -- (-1936.154) [-1934.153] (-1936.611) (-1938.114) * [-1935.607] (-1944.318) (-1932.090) (-1935.398) -- 0:01:35
      536000 -- (-1936.909) (-1930.810) [-1939.144] (-1931.834) * [-1935.121] (-1936.348) (-1932.193) (-1932.323) -- 0:01:36
      536500 -- (-1933.327) (-1939.339) [-1937.696] (-1935.026) * [-1931.490] (-1939.474) (-1941.026) (-1936.343) -- 0:01:35
      537000 -- (-1934.922) (-1939.548) (-1937.084) [-1931.388] * (-1938.276) (-1931.239) [-1937.718] (-1944.137) -- 0:01:35
      537500 -- (-1932.613) [-1931.599] (-1933.943) (-1934.387) * (-1941.486) (-1940.507) (-1934.275) [-1931.102] -- 0:01:35
      538000 -- (-1941.622) (-1942.005) (-1943.678) [-1935.487] * (-1933.754) (-1940.869) [-1933.450] (-1936.132) -- 0:01:35
      538500 -- (-1933.402) [-1930.854] (-1939.385) (-1934.631) * [-1935.028] (-1932.767) (-1934.871) (-1933.240) -- 0:01:35
      539000 -- [-1932.679] (-1932.851) (-1930.274) (-1939.015) * (-1935.784) [-1940.240] (-1934.678) (-1943.237) -- 0:01:34
      539500 -- [-1933.087] (-1935.164) (-1934.852) (-1933.412) * [-1930.444] (-1935.829) (-1938.437) (-1933.002) -- 0:01:34
      540000 -- (-1943.588) [-1937.631] (-1935.664) (-1933.125) * [-1936.196] (-1938.648) (-1948.538) (-1932.560) -- 0:01:34

      Average standard deviation of split frequencies: 0.000000

      540500 -- [-1932.445] (-1935.892) (-1936.615) (-1937.876) * [-1934.371] (-1936.722) (-1943.576) (-1938.905) -- 0:01:34
      541000 -- (-1933.156) (-1937.742) [-1935.367] (-1936.191) * (-1939.065) [-1933.912] (-1935.555) (-1935.940) -- 0:01:35
      541500 -- (-1940.123) (-1935.170) (-1934.117) [-1931.019] * [-1936.805] (-1934.179) (-1939.909) (-1934.218) -- 0:01:34
      542000 -- (-1934.808) [-1936.547] (-1937.190) (-1935.478) * [-1934.756] (-1938.185) (-1935.267) (-1934.627) -- 0:01:34
      542500 -- (-1934.717) (-1943.192) (-1941.565) [-1934.134] * (-1932.551) (-1935.637) [-1935.787] (-1933.080) -- 0:01:34
      543000 -- (-1934.670) (-1939.572) (-1933.757) [-1934.806] * (-1945.063) (-1932.641) [-1939.014] (-1937.879) -- 0:01:34
      543500 -- [-1931.930] (-1940.258) (-1935.922) (-1942.409) * (-1936.155) (-1934.592) [-1936.300] (-1935.764) -- 0:01:34
      544000 -- (-1938.439) (-1935.771) [-1940.723] (-1935.210) * (-1936.017) (-1938.454) [-1935.037] (-1935.851) -- 0:01:33
      544500 -- (-1940.053) [-1932.892] (-1936.283) (-1937.354) * (-1936.955) (-1937.527) (-1936.058) [-1934.824] -- 0:01:33
      545000 -- (-1938.957) (-1936.441) [-1940.895] (-1938.958) * (-1934.500) (-1941.054) [-1939.620] (-1933.874) -- 0:01:33

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-1938.512) (-1937.029) (-1937.267) [-1936.971] * [-1934.571] (-1940.251) (-1937.873) (-1935.545) -- 0:01:34
      546000 -- [-1941.611] (-1933.785) (-1939.258) (-1934.683) * (-1938.052) [-1934.755] (-1931.904) (-1938.007) -- 0:01:33
      546500 -- (-1943.071) (-1939.992) (-1939.134) [-1933.585] * (-1932.181) (-1934.514) (-1935.184) [-1934.402] -- 0:01:33
      547000 -- (-1934.378) [-1933.685] (-1940.298) (-1931.099) * (-1938.773) (-1935.531) (-1935.624) [-1938.921] -- 0:01:33
      547500 -- (-1934.226) (-1933.683) [-1937.127] (-1931.773) * (-1936.803) (-1928.454) (-1935.394) [-1932.882] -- 0:01:33
      548000 -- [-1939.821] (-1937.851) (-1934.619) (-1934.052) * [-1933.457] (-1931.795) (-1935.125) (-1935.339) -- 0:01:33
      548500 -- (-1934.316) [-1936.365] (-1934.097) (-1939.795) * [-1937.171] (-1931.505) (-1931.487) (-1935.593) -- 0:01:33
      549000 -- (-1932.961) (-1936.384) [-1932.057] (-1941.177) * (-1941.056) [-1935.806] (-1934.770) (-1943.583) -- 0:01:32
      549500 -- (-1938.621) [-1930.819] (-1937.024) (-1943.420) * (-1940.182) [-1933.458] (-1941.261) (-1934.705) -- 0:01:32
      550000 -- [-1933.025] (-1932.969) (-1933.858) (-1946.195) * (-1937.240) (-1940.611) [-1938.730] (-1933.709) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      550500 -- (-1934.312) [-1935.972] (-1934.666) (-1939.760) * (-1941.201) [-1937.174] (-1943.400) (-1933.305) -- 0:01:33
      551000 -- [-1934.527] (-1937.542) (-1932.934) (-1942.729) * (-1932.129) (-1936.270) (-1934.913) [-1935.774] -- 0:01:32
      551500 -- [-1933.125] (-1943.672) (-1936.100) (-1938.966) * [-1933.919] (-1939.273) (-1937.370) (-1931.024) -- 0:01:32
      552000 -- (-1936.096) (-1934.321) [-1936.156] (-1938.171) * [-1935.398] (-1938.786) (-1941.103) (-1936.270) -- 0:01:32
      552500 -- (-1939.372) (-1945.455) [-1932.838] (-1939.668) * [-1934.319] (-1933.121) (-1938.703) (-1940.272) -- 0:01:32
      553000 -- (-1936.701) (-1941.242) [-1934.400] (-1943.052) * (-1935.896) (-1935.135) (-1937.764) [-1936.453] -- 0:01:32
      553500 -- (-1947.211) (-1946.370) (-1934.667) [-1934.591] * [-1939.908] (-1933.910) (-1934.468) (-1936.503) -- 0:01:31
      554000 -- (-1935.789) (-1940.426) [-1936.404] (-1943.676) * [-1931.786] (-1934.037) (-1935.931) (-1941.824) -- 0:01:31
      554500 -- [-1937.652] (-1935.214) (-1938.963) (-1939.263) * (-1938.628) [-1932.630] (-1931.412) (-1941.870) -- 0:01:31
      555000 -- (-1939.612) (-1937.570) (-1933.714) [-1936.584] * (-1930.878) [-1935.955] (-1935.674) (-1939.014) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      555500 -- (-1939.002) (-1936.816) [-1931.143] (-1931.568) * (-1942.987) (-1935.163) (-1933.184) [-1935.532] -- 0:01:32
      556000 -- (-1942.810) [-1934.648] (-1934.198) (-1936.811) * (-1953.093) (-1935.756) (-1945.270) [-1935.071] -- 0:01:31
      556500 -- (-1945.226) (-1933.761) (-1936.417) [-1936.201] * (-1939.538) (-1939.680) (-1937.899) [-1933.393] -- 0:01:31
      557000 -- [-1938.628] (-1936.404) (-1933.192) (-1933.556) * (-1938.268) (-1936.046) (-1941.593) [-1934.894] -- 0:01:31
      557500 -- (-1933.773) [-1935.062] (-1940.311) (-1939.031) * (-1941.592) (-1934.391) [-1931.081] (-1935.319) -- 0:01:31
      558000 -- (-1936.179) (-1936.724) (-1937.286) [-1929.713] * (-1942.404) [-1934.277] (-1934.447) (-1936.885) -- 0:01:31
      558500 -- (-1935.495) [-1933.315] (-1937.301) (-1938.451) * (-1939.401) [-1933.807] (-1933.870) (-1940.650) -- 0:01:30
      559000 -- (-1938.094) [-1930.830] (-1934.370) (-1949.296) * (-1935.079) (-1932.601) (-1934.377) [-1932.322] -- 0:01:30
      559500 -- (-1933.480) (-1936.895) [-1935.235] (-1937.455) * [-1932.130] (-1934.371) (-1935.853) (-1935.279) -- 0:01:31
      560000 -- (-1933.960) (-1938.181) (-1936.038) [-1934.138] * (-1932.903) (-1934.526) (-1935.274) [-1932.680] -- 0:01:31

      Average standard deviation of split frequencies: 0.000000

      560500 -- (-1930.424) [-1934.223] (-1937.759) (-1937.422) * [-1937.340] (-1936.998) (-1938.748) (-1940.600) -- 0:01:30
      561000 -- (-1944.494) [-1935.467] (-1935.939) (-1935.118) * (-1936.678) (-1935.992) (-1937.168) [-1932.818] -- 0:01:30
      561500 -- (-1938.850) (-1934.736) (-1937.523) [-1933.618] * (-1940.437) [-1936.652] (-1937.827) (-1936.510) -- 0:01:30
      562000 -- (-1939.501) [-1931.492] (-1930.353) (-1936.771) * (-1943.529) [-1934.481] (-1938.145) (-1931.886) -- 0:01:30
      562500 -- (-1934.743) (-1935.720) [-1934.621] (-1941.441) * [-1936.230] (-1933.122) (-1936.243) (-1936.136) -- 0:01:30
      563000 -- (-1933.916) [-1938.312] (-1935.482) (-1942.999) * (-1932.284) [-1933.180] (-1935.213) (-1939.418) -- 0:01:30
      563500 -- (-1936.256) [-1939.714] (-1938.756) (-1933.928) * (-1936.682) (-1932.042) [-1936.753] (-1938.123) -- 0:01:29
      564000 -- (-1931.534) (-1937.734) [-1937.368] (-1933.706) * [-1934.997] (-1934.799) (-1931.500) (-1943.496) -- 0:01:29
      564500 -- (-1933.906) (-1935.010) (-1938.641) [-1939.273] * (-1930.367) (-1941.982) [-1934.073] (-1938.849) -- 0:01:30
      565000 -- [-1934.547] (-1938.509) (-1938.974) (-1934.910) * (-1935.831) (-1938.075) (-1935.356) [-1933.794] -- 0:01:30

      Average standard deviation of split frequencies: 0.000000

      565500 -- (-1941.512) [-1937.904] (-1944.246) (-1936.119) * (-1933.214) (-1941.710) [-1933.714] (-1934.333) -- 0:01:29
      566000 -- (-1933.700) (-1937.130) (-1942.572) [-1934.633] * (-1941.079) (-1935.931) (-1934.083) [-1937.735] -- 0:01:29
      566500 -- (-1934.492) (-1934.044) [-1936.934] (-1932.953) * [-1931.568] (-1939.247) (-1938.243) (-1930.691) -- 0:01:29
      567000 -- (-1934.438) (-1932.816) (-1936.570) [-1935.508] * (-1936.833) (-1934.620) (-1942.994) [-1932.418] -- 0:01:29
      567500 -- (-1935.078) [-1937.079] (-1939.030) (-1935.585) * (-1933.186) (-1939.344) (-1938.782) [-1932.728] -- 0:01:29
      568000 -- (-1939.556) [-1936.316] (-1940.817) (-1941.156) * (-1935.113) (-1937.581) (-1931.303) [-1939.657] -- 0:01:28
      568500 -- (-1935.911) [-1934.760] (-1943.570) (-1937.666) * (-1938.091) (-1934.464) (-1932.376) [-1936.478] -- 0:01:28
      569000 -- [-1932.947] (-1934.709) (-1934.133) (-1940.080) * [-1935.467] (-1930.495) (-1934.727) (-1935.538) -- 0:01:28
      569500 -- (-1933.306) [-1930.593] (-1943.842) (-1936.608) * (-1931.147) (-1940.119) [-1931.775] (-1938.325) -- 0:01:29
      570000 -- [-1934.086] (-1935.315) (-1930.836) (-1934.531) * (-1942.277) (-1936.381) (-1939.039) [-1931.215] -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      570500 -- (-1934.395) (-1945.709) [-1935.078] (-1935.970) * (-1942.670) [-1939.272] (-1932.888) (-1929.860) -- 0:01:28
      571000 -- [-1932.164] (-1938.628) (-1933.514) (-1940.385) * (-1932.650) (-1935.359) [-1932.222] (-1932.458) -- 0:01:28
      571500 -- (-1933.135) (-1932.626) [-1938.413] (-1941.013) * (-1933.397) (-1937.382) (-1934.346) [-1940.461] -- 0:01:28
      572000 -- [-1933.860] (-1934.217) (-1936.410) (-1934.656) * (-1935.985) [-1931.158] (-1943.993) (-1931.442) -- 0:01:28
      572500 -- (-1932.381) [-1930.318] (-1938.004) (-1934.744) * (-1940.137) (-1935.588) [-1937.728] (-1935.025) -- 0:01:28
      573000 -- [-1931.825] (-1939.990) (-1935.394) (-1933.375) * (-1934.421) [-1940.087] (-1939.535) (-1940.330) -- 0:01:27
      573500 -- (-1935.950) [-1941.123] (-1936.069) (-1932.159) * [-1939.504] (-1934.040) (-1936.474) (-1948.069) -- 0:01:27
      574000 -- (-1932.789) [-1935.207] (-1932.452) (-1947.277) * (-1936.787) (-1931.484) (-1936.229) [-1934.755] -- 0:01:27
      574500 -- (-1935.301) [-1933.208] (-1930.350) (-1940.440) * (-1931.704) (-1934.663) (-1934.299) [-1935.043] -- 0:01:28
      575000 -- (-1941.145) [-1932.902] (-1929.842) (-1938.592) * (-1941.623) (-1932.984) (-1939.440) [-1931.597] -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-1934.609) (-1936.351) (-1931.931) [-1937.309] * (-1937.624) (-1933.898) (-1939.622) [-1939.731] -- 0:01:27
      576000 -- [-1934.284] (-1931.745) (-1935.030) (-1934.562) * (-1934.210) [-1933.475] (-1935.484) (-1942.995) -- 0:01:27
      576500 -- [-1940.044] (-1935.016) (-1932.618) (-1939.895) * (-1938.684) [-1934.846] (-1937.818) (-1932.168) -- 0:01:27
      577000 -- (-1945.506) [-1931.127] (-1934.818) (-1935.955) * (-1935.342) [-1932.961] (-1940.757) (-1936.280) -- 0:01:27
      577500 -- (-1946.473) (-1933.264) (-1932.457) [-1930.514] * (-1940.024) [-1935.493] (-1937.512) (-1932.929) -- 0:01:27
      578000 -- (-1942.961) (-1941.227) (-1935.606) [-1936.076] * [-1935.627] (-1943.674) (-1934.687) (-1938.082) -- 0:01:26
      578500 -- (-1935.085) (-1941.145) [-1936.992] (-1932.606) * [-1935.491] (-1940.472) (-1934.820) (-1934.364) -- 0:01:26
      579000 -- (-1934.678) [-1938.842] (-1934.824) (-1934.045) * (-1936.192) (-1942.482) [-1938.376] (-1934.460) -- 0:01:27
      579500 -- (-1939.171) (-1933.308) (-1930.220) [-1937.509] * (-1933.694) (-1936.281) [-1934.260] (-1937.732) -- 0:01:27
      580000 -- (-1932.787) (-1933.578) (-1933.050) [-1931.774] * (-1938.750) (-1931.624) [-1935.299] (-1934.880) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-1939.849) (-1932.566) (-1934.073) [-1938.679] * (-1937.586) (-1930.644) [-1934.437] (-1939.363) -- 0:01:26
      581000 -- (-1940.596) (-1935.825) (-1931.072) [-1934.107] * (-1937.911) [-1934.284] (-1936.910) (-1937.240) -- 0:01:26
      581500 -- [-1940.120] (-1932.762) (-1936.418) (-1942.457) * (-1935.390) (-1934.655) [-1932.821] (-1933.933) -- 0:01:26
      582000 -- (-1936.194) (-1938.507) (-1934.588) [-1936.351] * (-1935.303) (-1933.633) [-1935.615] (-1939.294) -- 0:01:26
      582500 -- (-1933.433) (-1935.613) [-1935.004] (-1931.942) * [-1936.665] (-1932.585) (-1940.360) (-1934.423) -- 0:01:26
      583000 -- (-1940.352) (-1934.776) [-1939.512] (-1937.980) * [-1931.207] (-1931.421) (-1937.403) (-1938.806) -- 0:01:25
      583500 -- (-1930.522) (-1932.981) [-1937.932] (-1936.747) * [-1933.993] (-1933.913) (-1940.960) (-1933.008) -- 0:01:25
      584000 -- [-1933.053] (-1934.658) (-1933.719) (-1931.136) * [-1932.815] (-1929.890) (-1939.450) (-1935.109) -- 0:01:26
      584500 -- (-1934.940) (-1935.202) (-1931.268) [-1936.156] * (-1935.939) [-1936.525] (-1940.142) (-1934.620) -- 0:01:26
      585000 -- [-1936.105] (-1934.279) (-1933.555) (-1930.747) * [-1941.518] (-1942.102) (-1934.023) (-1939.578) -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      585500 -- [-1933.940] (-1935.139) (-1935.197) (-1934.364) * [-1932.821] (-1939.778) (-1945.508) (-1938.387) -- 0:01:25
      586000 -- (-1936.117) [-1935.804] (-1938.599) (-1938.750) * (-1937.428) (-1935.542) (-1935.426) [-1939.009] -- 0:01:25
      586500 -- (-1938.730) [-1933.736] (-1935.274) (-1936.378) * (-1936.639) (-1938.221) (-1932.828) [-1941.999] -- 0:01:25
      587000 -- (-1943.009) (-1939.971) [-1934.207] (-1937.392) * [-1932.059] (-1934.514) (-1937.308) (-1933.701) -- 0:01:25
      587500 -- (-1942.669) (-1939.433) [-1935.441] (-1937.483) * (-1932.480) (-1935.293) (-1938.856) [-1940.754] -- 0:01:24
      588000 -- [-1941.832] (-1933.602) (-1937.043) (-1933.572) * [-1936.268] (-1936.776) (-1941.589) (-1938.402) -- 0:01:24
      588500 -- (-1939.919) (-1931.972) [-1934.323] (-1936.338) * (-1939.408) (-1933.702) (-1935.158) [-1934.782] -- 0:01:24
      589000 -- (-1937.415) (-1939.780) (-1939.953) [-1941.207] * [-1934.267] (-1934.764) (-1933.190) (-1935.487) -- 0:01:25
      589500 -- (-1935.041) [-1931.035] (-1936.362) (-1934.123) * (-1934.636) (-1937.172) (-1932.016) [-1936.452] -- 0:01:24
      590000 -- [-1932.789] (-1935.800) (-1932.412) (-1933.932) * (-1932.871) (-1936.757) [-1933.643] (-1936.947) -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-1938.910) (-1938.871) (-1934.325) [-1938.054] * (-1938.019) [-1933.285] (-1935.592) (-1937.102) -- 0:01:24
      591000 -- [-1931.893] (-1933.831) (-1939.667) (-1935.895) * (-1932.735) (-1937.319) (-1939.767) [-1931.990] -- 0:01:24
      591500 -- (-1936.382) (-1937.137) [-1942.142] (-1935.711) * [-1934.390] (-1934.544) (-1935.777) (-1936.372) -- 0:01:24
      592000 -- (-1940.603) (-1934.705) [-1935.333] (-1939.726) * (-1936.986) [-1936.407] (-1944.818) (-1937.382) -- 0:01:24
      592500 -- (-1932.514) (-1934.803) [-1936.061] (-1937.915) * (-1936.360) (-1941.059) (-1936.472) [-1936.575] -- 0:01:23
      593000 -- (-1933.352) (-1940.944) (-1937.741) [-1939.266] * (-1935.355) (-1937.999) (-1929.997) [-1930.079] -- 0:01:23
      593500 -- (-1935.727) (-1932.957) (-1939.898) [-1940.473] * [-1932.478] (-1938.723) (-1934.368) (-1933.131) -- 0:01:23
      594000 -- (-1939.347) (-1945.980) (-1936.200) [-1935.287] * (-1937.415) (-1937.656) [-1931.626] (-1932.425) -- 0:01:24
      594500 -- (-1940.537) (-1944.926) (-1945.808) [-1929.758] * (-1936.711) (-1938.459) (-1939.352) [-1930.452] -- 0:01:23
      595000 -- (-1941.320) (-1935.968) (-1934.274) [-1931.065] * [-1936.201] (-1950.023) (-1940.000) (-1936.957) -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-1938.535) [-1934.625] (-1934.518) (-1932.198) * [-1935.482] (-1936.930) (-1936.766) (-1940.358) -- 0:01:23
      596000 -- (-1934.245) (-1937.641) (-1935.941) [-1936.277] * [-1934.618] (-1943.558) (-1936.603) (-1936.394) -- 0:01:23
      596500 -- (-1939.583) (-1936.593) [-1941.658] (-1934.507) * [-1931.777] (-1943.059) (-1935.270) (-1937.946) -- 0:01:23
      597000 -- (-1931.828) [-1936.148] (-1935.320) (-1935.806) * (-1938.162) (-1939.108) (-1935.132) [-1934.279] -- 0:01:23
      597500 -- (-1931.709) [-1932.048] (-1944.330) (-1939.330) * (-1934.541) [-1935.508] (-1933.691) (-1935.293) -- 0:01:22
      598000 -- (-1932.143) (-1938.822) (-1938.745) [-1939.372] * (-1943.090) [-1934.391] (-1933.259) (-1935.663) -- 0:01:22
      598500 -- (-1933.662) [-1933.859] (-1935.433) (-1935.557) * (-1938.527) [-1937.087] (-1938.992) (-1930.176) -- 0:01:22
      599000 -- (-1931.216) (-1936.746) [-1934.004] (-1939.491) * [-1934.864] (-1932.101) (-1935.381) (-1931.370) -- 0:01:23
      599500 -- [-1929.954] (-1935.046) (-1935.811) (-1932.315) * [-1935.407] (-1948.342) (-1934.827) (-1934.146) -- 0:01:22
      600000 -- (-1932.772) (-1935.994) [-1935.294] (-1938.980) * [-1932.386] (-1936.092) (-1943.888) (-1942.892) -- 0:01:22

      Average standard deviation of split frequencies: 0.000000

      600500 -- (-1936.808) (-1937.232) (-1933.826) [-1933.773] * [-1931.658] (-1934.008) (-1936.910) (-1936.552) -- 0:01:22
      601000 -- (-1937.346) (-1932.452) (-1935.520) [-1936.503] * [-1935.112] (-1937.403) (-1935.479) (-1934.709) -- 0:01:22
      601500 -- (-1932.591) (-1941.844) [-1933.575] (-1937.369) * (-1944.762) [-1937.279] (-1942.996) (-1932.818) -- 0:01:22
      602000 -- [-1931.023] (-1935.683) (-1938.146) (-1933.827) * (-1933.262) (-1932.964) (-1932.604) [-1931.741] -- 0:01:21
      602500 -- (-1939.013) (-1933.211) (-1939.631) [-1933.409] * [-1935.136] (-1937.851) (-1935.872) (-1937.764) -- 0:01:21
      603000 -- (-1936.945) (-1936.315) [-1934.881] (-1933.424) * (-1936.803) [-1934.970] (-1937.262) (-1932.887) -- 0:01:22
      603500 -- (-1936.667) (-1938.255) [-1936.151] (-1935.469) * (-1941.495) [-1933.057] (-1932.888) (-1930.910) -- 0:01:22
      604000 -- (-1935.122) (-1936.894) (-1941.033) [-1933.045] * (-1937.971) (-1934.733) [-1933.371] (-1933.653) -- 0:01:21
      604500 -- (-1934.979) (-1939.394) (-1935.646) [-1932.756] * (-1939.192) [-1934.462] (-1936.450) (-1934.585) -- 0:01:21
      605000 -- [-1933.543] (-1937.599) (-1939.081) (-1936.505) * [-1929.222] (-1938.718) (-1949.147) (-1936.945) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      605500 -- [-1934.926] (-1933.062) (-1938.592) (-1933.185) * [-1937.222] (-1937.313) (-1937.975) (-1938.473) -- 0:01:21
      606000 -- (-1935.228) (-1937.671) (-1937.484) [-1935.618] * [-1932.988] (-1936.090) (-1935.969) (-1935.839) -- 0:01:21
      606500 -- (-1937.254) (-1937.300) (-1939.353) [-1934.573] * (-1933.385) [-1938.414] (-1939.998) (-1935.593) -- 0:01:21
      607000 -- (-1942.516) [-1934.684] (-1940.340) (-1933.165) * (-1936.728) (-1939.776) (-1933.899) [-1932.937] -- 0:01:20
      607500 -- (-1939.629) (-1937.325) (-1939.650) [-1939.905] * (-1932.861) (-1938.633) (-1939.198) [-1934.195] -- 0:01:21
      608000 -- (-1938.065) [-1936.690] (-1936.262) (-1935.744) * [-1932.256] (-1933.206) (-1937.882) (-1943.507) -- 0:01:21
      608500 -- (-1935.247) (-1943.524) (-1934.594) [-1932.202] * (-1932.882) (-1938.404) [-1935.801] (-1937.252) -- 0:01:21
      609000 -- [-1933.751] (-1942.551) (-1934.868) (-1933.380) * (-1937.649) [-1937.724] (-1939.391) (-1931.480) -- 0:01:20
      609500 -- [-1934.181] (-1932.909) (-1934.920) (-1938.966) * (-1935.262) (-1940.980) [-1934.191] (-1935.322) -- 0:01:20
      610000 -- (-1938.449) (-1935.584) (-1938.690) [-1935.583] * (-1930.232) (-1936.605) (-1933.104) [-1941.799] -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      610500 -- [-1937.161] (-1934.330) (-1940.505) (-1934.624) * (-1934.930) (-1936.911) (-1938.051) [-1940.138] -- 0:01:20
      611000 -- (-1940.278) (-1932.735) [-1936.226] (-1936.598) * (-1934.677) (-1934.491) (-1934.039) [-1932.403] -- 0:01:20
      611500 -- (-1938.483) (-1941.265) (-1936.085) [-1932.857] * (-1936.069) (-1940.927) [-1936.565] (-1932.190) -- 0:01:20
      612000 -- [-1937.828] (-1939.415) (-1933.304) (-1934.773) * (-1935.636) [-1940.810] (-1933.507) (-1935.870) -- 0:01:20
      612500 -- (-1935.086) (-1933.661) [-1937.611] (-1933.406) * (-1941.206) (-1938.691) (-1933.819) [-1932.921] -- 0:01:20
      613000 -- (-1933.809) (-1937.929) (-1931.986) [-1932.938] * [-1932.210] (-1931.275) (-1932.784) (-1935.235) -- 0:01:20
      613500 -- (-1935.089) (-1936.295) (-1934.931) [-1936.869] * [-1940.802] (-1932.758) (-1937.945) (-1942.425) -- 0:01:20
      614000 -- (-1935.751) [-1935.375] (-1937.295) (-1936.210) * [-1931.067] (-1936.222) (-1936.511) (-1937.282) -- 0:01:19
      614500 -- (-1939.189) [-1933.182] (-1941.062) (-1939.662) * (-1932.163) [-1929.642] (-1937.976) (-1939.860) -- 0:01:19
      615000 -- [-1932.474] (-1934.572) (-1930.497) (-1938.429) * [-1930.268] (-1939.947) (-1931.960) (-1939.012) -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      615500 -- (-1934.592) (-1942.213) (-1936.793) [-1933.218] * (-1935.131) (-1941.616) (-1940.130) [-1936.146] -- 0:01:19
      616000 -- (-1936.183) (-1938.078) (-1937.547) [-1940.388] * (-1932.404) (-1934.041) [-1933.187] (-1936.521) -- 0:01:19
      616500 -- (-1935.211) [-1931.028] (-1933.007) (-1942.107) * (-1940.846) (-1937.587) [-1934.592] (-1933.491) -- 0:01:19
      617000 -- [-1935.900] (-1936.631) (-1935.348) (-1939.626) * (-1938.010) [-1936.179] (-1934.045) (-1932.323) -- 0:01:19
      617500 -- (-1939.339) (-1940.840) [-1935.569] (-1940.178) * (-1936.407) [-1934.963] (-1940.483) (-1935.645) -- 0:01:19
      618000 -- (-1935.646) (-1937.055) [-1933.744] (-1937.929) * (-1934.718) (-1940.199) (-1940.279) [-1934.936] -- 0:01:19
      618500 -- (-1936.266) (-1931.152) (-1933.368) [-1940.371] * (-1938.224) (-1934.786) (-1934.562) [-1934.171] -- 0:01:18
      619000 -- (-1939.063) [-1932.928] (-1932.939) (-1937.825) * (-1938.022) (-1935.320) (-1941.307) [-1937.278] -- 0:01:18
      619500 -- (-1935.114) (-1938.857) [-1933.475] (-1934.113) * (-1940.916) (-1939.566) (-1941.662) [-1933.564] -- 0:01:18
      620000 -- (-1931.537) [-1935.016] (-1934.359) (-1936.148) * [-1938.318] (-1934.450) (-1941.334) (-1933.086) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-1931.725) (-1933.128) [-1937.878] (-1935.668) * (-1933.521) [-1933.737] (-1933.153) (-1931.865) -- 0:01:18
      621000 -- (-1940.499) (-1934.836) (-1935.101) [-1933.398] * (-1932.654) [-1934.277] (-1931.934) (-1930.878) -- 0:01:18
      621500 -- (-1933.731) (-1939.576) (-1939.234) [-1933.665] * (-1933.217) (-1940.735) [-1939.755] (-1935.895) -- 0:01:18
      622000 -- [-1930.005] (-1940.904) (-1948.835) (-1938.859) * (-1938.050) (-1938.050) (-1931.438) [-1934.230] -- 0:01:18
      622500 -- (-1934.236) [-1934.098] (-1935.810) (-1941.180) * (-1948.173) (-1935.344) [-1942.816] (-1938.918) -- 0:01:18
      623000 -- [-1934.379] (-1935.642) (-1938.213) (-1937.295) * [-1939.900] (-1935.404) (-1943.124) (-1938.910) -- 0:01:18
      623500 -- [-1932.041] (-1938.800) (-1937.740) (-1939.162) * (-1933.168) (-1936.003) (-1935.014) [-1938.006] -- 0:01:17
      624000 -- (-1937.375) (-1936.376) (-1932.964) [-1934.772] * (-1933.330) [-1934.209] (-1941.852) (-1938.231) -- 0:01:17
      624500 -- (-1930.569) (-1936.241) [-1934.761] (-1936.332) * (-1939.475) (-1932.234) (-1939.196) [-1934.950] -- 0:01:17
      625000 -- [-1933.683] (-1933.522) (-1933.796) (-1939.740) * [-1930.704] (-1938.098) (-1941.925) (-1942.565) -- 0:01:17

      Average standard deviation of split frequencies: 0.000000

      625500 -- (-1935.512) (-1931.067) (-1935.593) [-1937.429] * [-1934.968] (-1933.852) (-1937.084) (-1937.727) -- 0:01:17
      626000 -- (-1938.672) (-1929.637) [-1935.948] (-1942.039) * [-1934.869] (-1939.317) (-1934.274) (-1935.677) -- 0:01:17
      626500 -- [-1933.731] (-1931.795) (-1940.358) (-1932.693) * [-1936.674] (-1938.724) (-1931.323) (-1941.856) -- 0:01:17
      627000 -- (-1938.151) (-1937.568) (-1936.012) [-1938.599] * (-1937.136) [-1931.683] (-1934.958) (-1939.457) -- 0:01:17
      627500 -- (-1934.865) (-1944.460) [-1934.119] (-1941.074) * (-1938.499) (-1934.656) [-1934.265] (-1935.772) -- 0:01:17
      628000 -- (-1932.145) (-1937.608) (-1937.003) [-1935.618] * [-1936.114] (-1933.608) (-1935.182) (-1938.220) -- 0:01:17
      628500 -- [-1936.270] (-1932.272) (-1933.589) (-1934.225) * (-1933.812) (-1937.402) (-1935.526) [-1931.975] -- 0:01:16
      629000 -- (-1943.931) (-1933.416) [-1934.570] (-1935.757) * (-1932.812) (-1930.425) (-1948.076) [-1935.045] -- 0:01:16
      629500 -- (-1933.293) (-1933.653) (-1938.579) [-1938.750] * (-1935.480) (-1934.233) [-1934.330] (-1937.446) -- 0:01:17
      630000 -- (-1943.418) (-1934.458) [-1937.607] (-1936.224) * (-1942.379) (-1933.850) (-1942.514) [-1935.838] -- 0:01:16

      Average standard deviation of split frequencies: 0.000000

      630500 -- (-1932.926) [-1933.760] (-1934.280) (-1936.504) * [-1932.551] (-1940.351) (-1931.408) (-1932.390) -- 0:01:16
      631000 -- (-1939.914) [-1933.995] (-1933.835) (-1932.972) * (-1936.425) (-1936.359) (-1933.980) [-1938.563] -- 0:01:16
      631500 -- (-1936.169) (-1932.846) [-1937.133] (-1939.883) * (-1939.289) (-1934.032) (-1935.921) [-1930.592] -- 0:01:16
      632000 -- [-1934.862] (-1935.984) (-1938.235) (-1933.413) * (-1932.785) (-1933.996) (-1932.841) [-1930.722] -- 0:01:16
      632500 -- [-1938.960] (-1936.516) (-1940.798) (-1941.165) * (-1936.862) (-1938.677) [-1935.587] (-1935.969) -- 0:01:16
      633000 -- (-1938.087) [-1934.334] (-1938.486) (-1940.880) * (-1935.074) (-1935.171) (-1941.340) [-1933.848] -- 0:01:15
      633500 -- (-1933.655) (-1940.160) [-1933.576] (-1933.686) * (-1938.913) (-1934.984) (-1935.741) [-1934.222] -- 0:01:15
      634000 -- (-1939.596) [-1934.748] (-1932.631) (-1940.333) * (-1932.848) (-1934.111) [-1932.293] (-1937.128) -- 0:01:16
      634500 -- (-1936.337) (-1937.147) (-1940.284) [-1937.995] * [-1936.394] (-1940.495) (-1934.999) (-1931.746) -- 0:01:16
      635000 -- (-1937.321) [-1932.287] (-1936.850) (-1934.053) * (-1932.947) [-1937.657] (-1939.674) (-1935.377) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      635500 -- (-1937.451) [-1935.523] (-1931.132) (-1939.026) * [-1933.918] (-1935.436) (-1932.714) (-1933.683) -- 0:01:15
      636000 -- [-1933.691] (-1937.033) (-1938.468) (-1938.138) * (-1933.969) (-1937.105) [-1938.705] (-1943.919) -- 0:01:15
      636500 -- (-1932.117) [-1940.193] (-1940.306) (-1939.372) * (-1936.648) (-1932.395) [-1930.884] (-1937.414) -- 0:01:15
      637000 -- (-1933.313) (-1933.967) [-1935.035] (-1937.963) * [-1937.924] (-1934.585) (-1934.752) (-1937.448) -- 0:01:15
      637500 -- (-1932.412) (-1935.663) [-1931.269] (-1930.391) * (-1939.846) [-1932.493] (-1946.360) (-1938.773) -- 0:01:15
      638000 -- (-1939.729) [-1937.486] (-1937.128) (-1940.032) * [-1934.770] (-1936.321) (-1944.003) (-1935.552) -- 0:01:14
      638500 -- (-1934.658) (-1935.138) (-1941.142) [-1934.741] * (-1936.654) (-1941.031) (-1934.300) [-1941.921] -- 0:01:15
      639000 -- (-1940.098) [-1935.188] (-1935.357) (-1930.733) * (-1933.798) [-1938.492] (-1934.039) (-1935.325) -- 0:01:15
      639500 -- [-1932.085] (-1937.316) (-1935.973) (-1936.373) * [-1931.985] (-1938.225) (-1932.780) (-1933.533) -- 0:01:14
      640000 -- (-1937.645) (-1933.750) [-1939.918] (-1939.171) * (-1934.310) (-1939.278) [-1934.067] (-1937.755) -- 0:01:14

      Average standard deviation of split frequencies: 0.000000

      640500 -- (-1937.934) [-1932.871] (-1942.109) (-1936.869) * (-1931.809) (-1933.969) [-1935.067] (-1934.880) -- 0:01:14
      641000 -- (-1932.574) (-1930.707) [-1934.430] (-1939.828) * [-1931.847] (-1931.325) (-1932.559) (-1942.232) -- 0:01:14
      641500 -- (-1940.592) [-1930.441] (-1936.465) (-1936.806) * (-1940.453) (-1936.614) [-1937.907] (-1935.337) -- 0:01:14
      642000 -- (-1936.370) (-1938.121) [-1933.144] (-1937.672) * (-1930.597) (-1933.166) [-1936.337] (-1942.031) -- 0:01:14
      642500 -- (-1940.491) [-1939.078] (-1939.970) (-1934.566) * (-1933.860) (-1934.013) [-1934.350] (-1933.918) -- 0:01:14
      643000 -- [-1935.524] (-1936.640) (-1941.910) (-1940.915) * (-1935.128) (-1936.964) (-1936.744) [-1935.990] -- 0:01:13
      643500 -- (-1941.054) [-1931.650] (-1933.729) (-1936.601) * [-1932.151] (-1944.946) (-1932.370) (-1939.308) -- 0:01:14
      644000 -- (-1932.608) (-1935.174) (-1929.923) [-1933.757] * (-1935.739) (-1937.982) [-1933.480] (-1941.227) -- 0:01:14
      644500 -- (-1936.305) (-1940.215) [-1931.490] (-1937.343) * (-1939.564) [-1939.731] (-1936.366) (-1943.977) -- 0:01:13
      645000 -- (-1942.311) (-1932.980) [-1934.582] (-1932.707) * [-1937.043] (-1946.460) (-1943.205) (-1937.014) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      645500 -- (-1934.106) (-1935.766) [-1934.128] (-1935.810) * [-1934.660] (-1937.241) (-1933.968) (-1933.765) -- 0:01:13
      646000 -- (-1934.260) [-1935.297] (-1934.719) (-1931.913) * (-1934.853) (-1939.151) (-1932.130) [-1936.044] -- 0:01:13
      646500 -- (-1939.247) (-1933.611) (-1936.148) [-1940.065] * (-1937.622) (-1937.828) [-1939.560] (-1932.655) -- 0:01:13
      647000 -- [-1933.915] (-1934.810) (-1941.449) (-1935.950) * [-1935.981] (-1933.204) (-1933.439) (-1937.106) -- 0:01:13
      647500 -- [-1931.904] (-1936.174) (-1934.622) (-1934.795) * (-1935.416) [-1937.937] (-1929.769) (-1934.931) -- 0:01:12
      648000 -- (-1933.357) [-1934.038] (-1940.190) (-1935.049) * (-1937.538) [-1931.905] (-1940.777) (-1938.315) -- 0:01:13
      648500 -- (-1939.362) [-1937.158] (-1935.509) (-1939.833) * (-1933.116) (-1932.459) [-1936.286] (-1942.485) -- 0:01:13
      649000 -- [-1934.766] (-1936.731) (-1936.329) (-1945.782) * (-1935.425) [-1936.283] (-1935.688) (-1936.464) -- 0:01:13
      649500 -- (-1935.590) (-1939.817) (-1931.263) [-1937.070] * (-1934.020) [-1933.182] (-1931.888) (-1934.879) -- 0:01:12
      650000 -- [-1933.476] (-1941.813) (-1934.451) (-1933.795) * (-1938.357) [-1933.494] (-1935.088) (-1943.019) -- 0:01:12

      Average standard deviation of split frequencies: 0.000000

      650500 -- [-1932.922] (-1936.372) (-1929.314) (-1932.809) * (-1939.260) (-1933.058) [-1937.021] (-1940.028) -- 0:01:12
      651000 -- (-1933.552) (-1942.348) (-1935.362) [-1931.735] * (-1939.781) [-1935.264] (-1935.374) (-1937.033) -- 0:01:12
      651500 -- (-1938.577) (-1938.739) [-1937.052] (-1933.678) * [-1935.849] (-1936.108) (-1933.906) (-1936.074) -- 0:01:12
      652000 -- (-1931.562) (-1933.441) (-1934.626) [-1939.705] * (-1934.468) (-1934.676) (-1936.712) [-1943.037] -- 0:01:12
      652500 -- (-1941.197) [-1931.886] (-1935.508) (-1932.857) * (-1936.788) (-1933.165) [-1941.981] (-1940.160) -- 0:01:12
      653000 -- (-1937.358) (-1944.033) [-1937.097] (-1934.288) * (-1935.187) [-1933.347] (-1935.083) (-1932.799) -- 0:01:12
      653500 -- [-1933.802] (-1938.278) (-1932.519) (-1938.042) * (-1931.072) (-1935.341) (-1938.684) [-1932.837] -- 0:01:12
      654000 -- [-1936.013] (-1935.017) (-1940.244) (-1936.334) * (-1941.487) [-1933.542] (-1935.213) (-1934.924) -- 0:01:11
      654500 -- (-1937.632) [-1932.184] (-1933.777) (-1937.492) * (-1938.215) [-1932.590] (-1934.258) (-1939.427) -- 0:01:11
      655000 -- (-1932.761) (-1933.607) [-1935.284] (-1930.945) * (-1934.552) (-1933.840) (-1938.211) [-1934.612] -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      655500 -- [-1940.241] (-1937.233) (-1929.347) (-1928.859) * (-1939.226) [-1935.711] (-1935.650) (-1942.457) -- 0:01:11
      656000 -- (-1935.837) (-1945.120) (-1931.025) [-1935.410] * [-1935.103] (-1938.761) (-1935.467) (-1935.218) -- 0:01:11
      656500 -- [-1932.915] (-1947.335) (-1933.295) (-1939.576) * [-1939.998] (-1939.021) (-1933.193) (-1934.737) -- 0:01:11
      657000 -- (-1931.795) (-1937.806) [-1936.630] (-1935.117) * (-1940.284) (-1935.852) (-1932.666) [-1938.363] -- 0:01:11
      657500 -- (-1936.081) (-1936.358) [-1938.126] (-1934.884) * (-1934.621) (-1934.359) (-1934.735) [-1934.404] -- 0:01:11
      658000 -- (-1938.662) (-1936.088) [-1935.814] (-1938.140) * [-1938.722] (-1937.689) (-1936.420) (-1933.728) -- 0:01:11
      658500 -- (-1934.907) [-1935.911] (-1944.139) (-1934.348) * (-1940.145) (-1935.464) [-1936.712] (-1934.366) -- 0:01:11
      659000 -- (-1936.116) (-1947.769) [-1933.656] (-1937.089) * (-1936.550) (-1934.816) [-1935.184] (-1937.803) -- 0:01:10
      659500 -- (-1940.713) (-1935.527) [-1933.558] (-1934.156) * (-1932.297) (-1938.539) [-1934.243] (-1937.975) -- 0:01:10
      660000 -- (-1938.026) [-1940.157] (-1933.148) (-1933.093) * (-1940.581) [-1936.090] (-1934.077) (-1934.616) -- 0:01:10

      Average standard deviation of split frequencies: 0.000000

      660500 -- (-1942.905) [-1936.145] (-1935.956) (-1935.645) * [-1931.395] (-1936.542) (-1937.925) (-1939.366) -- 0:01:10
      661000 -- (-1933.658) (-1937.082) (-1932.307) [-1942.281] * [-1935.007] (-1935.045) (-1938.546) (-1935.174) -- 0:01:10
      661500 -- (-1934.990) [-1935.470] (-1936.112) (-1941.215) * [-1931.514] (-1932.826) (-1936.836) (-1934.806) -- 0:01:10
      662000 -- (-1938.513) (-1939.474) (-1937.552) [-1934.073] * (-1936.707) (-1936.490) (-1934.329) [-1941.619] -- 0:01:09
      662500 -- (-1939.437) [-1935.406] (-1940.758) (-1940.145) * (-1932.797) [-1935.933] (-1933.127) (-1937.012) -- 0:01:10
      663000 -- [-1943.389] (-1936.619) (-1933.492) (-1935.582) * (-1938.452) [-1936.877] (-1932.217) (-1933.154) -- 0:01:10
      663500 -- (-1942.168) [-1944.603] (-1935.805) (-1935.860) * (-1935.149) (-1939.962) [-1936.698] (-1932.668) -- 0:01:09
      664000 -- (-1940.040) [-1937.188] (-1930.747) (-1935.068) * (-1935.146) (-1934.953) (-1933.802) [-1938.566] -- 0:01:09
      664500 -- (-1935.527) (-1935.407) (-1935.077) [-193