--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 10 02:22:12 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/zen2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1932.35 -1941.15
2 -1932.32 -1940.77
--------------------------------------
TOTAL -1932.34 -1940.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.261397 0.000573 0.216275 0.308015 0.259909 1264.65 1332.11 1.001
r(A<->C){all} 0.132227 0.000776 0.080717 0.187850 0.130416 1038.01 1062.51 1.000
r(A<->G){all} 0.281665 0.001511 0.211156 0.360357 0.280031 994.75 1100.72 1.002
r(A<->T){all} 0.108963 0.000610 0.057919 0.154683 0.108155 926.45 1020.33 1.000
r(C<->G){all} 0.112679 0.000804 0.057744 0.165526 0.110469 962.86 1021.48 1.000
r(C<->T){all} 0.254277 0.001405 0.180870 0.328324 0.253236 951.35 1031.49 1.003
r(G<->T){all} 0.110188 0.000739 0.059244 0.161419 0.108337 781.08 923.77 1.000
pi(A){all} 0.286989 0.000231 0.257292 0.315459 0.286837 1082.90 1222.98 1.001
pi(C){all} 0.237962 0.000212 0.208125 0.265894 0.237861 1074.19 1136.36 1.000
pi(G){all} 0.217708 0.000194 0.189610 0.244662 0.217185 1174.67 1202.96 1.000
pi(T){all} 0.257342 0.000225 0.228140 0.286621 0.257060 1042.41 1081.92 1.000
alpha{1,2} 0.760251 0.194257 0.154443 1.618787 0.655520 1501.00 1501.00 1.000
alpha{3} 1.591536 0.491753 0.484521 2.884768 1.460498 1122.03 1311.51 1.000
pinvar{all} 0.094085 0.005818 0.000001 0.243325 0.075379 1125.12 1313.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1889.720689
Model 2: PositiveSelection -1889.720689
Model 0: one-ratio -1892.321075
Model 3: discrete -1889.659973
Model 7: beta -1889.662601
Model 8: beta&w>1 -1889.662601
Model 0 vs 1 5.200772000000143
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=252
C1 MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
C2 MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
C3 MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
C4 MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
C5 MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
**. ********* ****:::****::****** *:*:*:**********
C1 SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
C2 SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
C3 SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
C4 SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
C5 SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
** *****************:*****************************
C1 STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
C2 STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
C3 STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
C4 STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
C5 STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
***** .:* *:*:. :** *** :::*******:*..**:***.***
C1 VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
C2 VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
C3 VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
C4 DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
C5 DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
. .* :*:****:*****:**:.** : : ** ***** .***: *.:
C1 EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
C2 ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
C3 ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
C4 ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
C5 ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
*.***::*:.*: ** *:************** ****** ****:**
C1 NF
C2 NF
C3 SF
C4 NF
C5 NF
.*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 252 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 252 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5040]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5040]--->[5040]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/zen2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.273 Mb, Max= 30.549 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF
FORMAT of file /tmp/tmp6929717734034497927aln Not Supported[FATAL:T-COFFEE]
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:252 S:100 BS:252
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 88.89 C1 C2 88.89
TOP 1 0 88.89 C2 C1 88.89
BOT 0 2 90.48 C1 C3 90.48
TOP 2 0 90.48 C3 C1 90.48
BOT 0 3 82.14 C1 C4 82.14
TOP 3 0 82.14 C4 C1 82.14
BOT 0 4 81.35 C1 C5 81.35
TOP 4 0 81.35 C5 C1 81.35
BOT 1 2 94.84 C2 C3 94.84
TOP 2 1 94.84 C3 C2 94.84
BOT 1 3 79.76 C2 C4 79.76
TOP 3 1 79.76 C4 C2 79.76
BOT 1 4 80.16 C2 C5 80.16
TOP 4 1 80.16 C5 C2 80.16
BOT 2 3 80.95 C3 C4 80.95
TOP 3 2 80.95 C4 C3 80.95
BOT 2 4 80.16 C3 C5 80.16
TOP 4 2 80.16 C5 C3 80.16
BOT 3 4 87.30 C4 C5 87.30
TOP 4 3 87.30 C5 C4 87.30
AVG 0 C1 * 85.71
AVG 1 C2 * 85.91
AVG 2 C3 * 86.61
AVG 3 C4 * 82.54
AVG 4 C5 * 82.24
TOT TOT * 84.60
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTTGCCATTCAAAGCGAAAACTATTTTGTGGACAATTACTCAGTCAG
C2 ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
C3 ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
C4 ATGTTTGCCTTCCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
C5 ATGTTTGCCACTCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
******* .: ************************** *.*********
C1 TGATTTAATGATGTATCCTTGCGTCGAGTTAAACGTAGAAGCCGCTCCCA
C2 TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
C3 TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
C4 TGATTTTGTGATGTATCCTTGCGTGGACCTCAACGTAGAAGCAGCTCCCA
C5 TGATTTTGTGATGTATCCTTGCGTAGAGTTGAACGTAGAAGCAGCGCCCG
******:.****.*********** ** * *********** ** ***.
C1 CGGCAACAACAAGGTCTTCGGAGAAATCAAAGAGATCTCGCACGGCATTC
C2 TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
C3 TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
C4 TTGCATCAACAAAGTCCTCGGAGAAATCGAAGAGATCTCGCACGGCATTC
C5 TTGCTACAACAAAGTCCGCGGAGAAATCGAAGAGATCTCGCACTGCATTC
**::******..** **********.*****.******** ******
C1 AGCAGTCTTCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
C2 AGTAGCCATCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
C3 AGTAGCCATCAGCTTATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
C4 AGCAGCCATCAGCTAATCGAACTTGAAAGGGAGTTCCATCTCAACAAATA
C5 AGCAGCCATCAGCTAATCGAACTCGAAAGGGAGTTCCATCTCAACAAATA
** ** *:******:******** **************************
C1 TTTAGCCCGAACCAGGCGAATCGAGATATCACAGCGTTTGGCACTCACAG
C2 TTTAGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
C3 TTTAGCCCGAGCCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACGG
C4 TTTAGCCCGAACCAGGCGAATCGAAATATCCCAGCGTTTAGCACTCACAG
C5 CTTGGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
**.******.*************.*****.********.********.*
C1 AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
C2 AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
C3 AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
C4 AGAGACAGGTTAAGATCTGGTTCCAAAATCGACGAATGAAACTCAAAAAG
C5 AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
*******************************:**.***********.***
C1 TCGACCAATAGGAAGGGTGCCATTGGAGCGCTGACCACATCTATTCCACT
C2 TCGACCAATAGGAAAGGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
C3 TCGACCAATAGGAAATGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
C4 TCGACCAATAGGAAAGGTGCCTTTGGAGCTCCGACAACATCTATTTCGCC
C5 TCGACCAATAGGAAAGGTGCCATTGGAGCTCTCACCTCGTCTGTTTCAGC
**************. *** *:******. * **.:*.***.** *.
C1 TTCTTCCCAGTCGAGCGAAGATCTTCAAAAGGACGACCAGATCGTAGAGC
C2 TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
C3 TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
C4 TTCTTCCCAATCGAGCGAAGATCTTCTGGAGAACGAGCAGATCGTGGAGC
C5 TACTTCCCAATTGAGCGAAGATCTTCTCGAGGACGAGCAGATCGTAGAGC
*:*******.* *********** **: .**.**** ********.****
C1 GTCTCCTTCGATATGCCAACACAAATGTGGAAACAGCTCCACTCCGGCAG
C2 GCCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTGCACTCCGGCAG
C3 GTCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTCCACTCCGGCAG
C4 GCCTCCTTAAATATGCAAGCACAAATCTTGAAACAGCTCCACTGCGGCAG
C5 GCCTGCTTAAATATGTAAGCACAAATGTGGAAACAGCTCCACTGCGGCAG
* ** ***..***** .*.******* * ********* **** ******
C1 GTTGATCACGGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
C2 GTTCATAGCAGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
C3 GTTGATCACTGTGTCCTGGAGGAGGGTCACATTACACCACCCTATCAGAG
C4 GATGATCGCGGTGTCCTACAGGATGGTCAAATTACACCACCCCATCAGAG
C5 GATGAGCGCGGTTTCCTGGCGGAGGGTCAAATTACACCACCCCATCAGAG
*:* * ..* ** ****. .*** *****.************ *******
C1 CTACGATTACCTCCATGAATTTTCTCCTGAGCCCATGGCTCTTCCCCAAC
C2 CTACGACTACCTCCATGAAATTTGTCCTGAGTTCATGGCTCTTCCCCAAC
C3 CTACGACTACCTCCATGAATTTTGTCCTGAGCCCATGGCTCTTCCCCAAC
C4 CTACGACTACCTCCATGAATTTTGTCCTGAGCCAATAGATGTTCTCCAAC
C5 CTACGACTACTTCCACGAATTTTGTCCCGAGCCAATAGGTGTTCCCCAAC
****** *** **** ***:*** *** *** .**.* * *** *****
C1 TGCCCTTCAATGAATTCGATGCTAACTGGGCGAGTTCATGGCTGGGCCTT
C2 TGCCTTTCAATGAATTCGACGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
C3 TGCCTTTCAATGAATTCGATGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
C4 TGCACTTCAACGAATTCGATTCAGGCTGGGCGAGTACTTTGCTGAGTCTT
C5 TGCGTTTCAATGAATTCGATTCAAACTGGGCAAGTACTTTGCTGGGTATT
*** ***** ******** .:..******.***:*:* ****.* .**
C1 GAGCCAACGATTCCTATCGCAGAAAATGTAATTGAACACAATACACAGGA
C2 GAGTCAACGATTCCTGTCGCAGAACATGTAATTAAACCCAATACACAGGA
C3 GAGTCAACGATTCCTGTCGCAGAAAATGTAATCGAACCCAATACACAGGA
C4 GAGTCAACAATCCCTGTCACAGAAAACCTAATTGAACCTTATATACAGGA
C5 GAGTCAACGATTCCTGTCACAGAACATTTTATTGAACCCAATGCACTGGA
*** ****.** ***.**.*****.* *:** .***. :**. **:***
C1 TCAGCCAATGATACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
C2 TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
C3 TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
C4 TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCTT
C5 TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCGT
*****.****.**************************** ******** *
C1 CATCGTCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTG
C2 CATCGGCGGATATTTTGGATGTTGACGATGACTTTATTCAAAATTTGTTA
C3 CATCGGCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTA
C4 CATCGGAAGATATTTTGGATGTTGACTATGACTTCATTCAAAATTTGTTG
C5 CTTCGGAGGATATTTTGGATGTTGACTATGACTTTATTCAACATTTGTTG
*:*** ..****************** ******* ******.*******.
C1 AACTTT
C2 AACTTT
C3 AGCTTT
C4 AATTTT
C5 AATTTT
*. ***
>C1
ATGTTTGCCATTCAAAGCGAAAACTATTTTGTGGACAATTACTCAGTCAG
TGATTTAATGATGTATCCTTGCGTCGAGTTAAACGTAGAAGCCGCTCCCA
CGGCAACAACAAGGTCTTCGGAGAAATCAAAGAGATCTCGCACGGCATTC
AGCAGTCTTCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAACCAGGCGAATCGAGATATCACAGCGTTTGGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAGGGTGCCATTGGAGCGCTGACCACATCTATTCCACT
TTCTTCCCAGTCGAGCGAAGATCTTCAAAAGGACGACCAGATCGTAGAGC
GTCTCCTTCGATATGCCAACACAAATGTGGAAACAGCTCCACTCCGGCAG
GTTGATCACGGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
CTACGATTACCTCCATGAATTTTCTCCTGAGCCCATGGCTCTTCCCCAAC
TGCCCTTCAATGAATTCGATGCTAACTGGGCGAGTTCATGGCTGGGCCTT
GAGCCAACGATTCCTATCGCAGAAAATGTAATTGAACACAATACACAGGA
TCAGCCAATGATACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
CATCGTCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTG
AACTTT
>C2
ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
AGTAGCCATCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAAGGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
GCCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTGCACTCCGGCAG
GTTCATAGCAGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG
CTACGACTACCTCCATGAAATTTGTCCTGAGTTCATGGCTCTTCCCCAAC
TGCCTTTCAATGAATTCGACGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
GAGTCAACGATTCCTGTCGCAGAACATGTAATTAAACCCAATACACAGGA
TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
CATCGGCGGATATTTTGGATGTTGACGATGACTTTATTCAAAATTTGTTA
AACTTT
>C3
ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG
TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG
TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC
AGTAGCCATCAGCTTATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAGCCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACGG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAATGTGTCATTGGAGAGCTGACCACGTCTATTCCACC
TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC
GTCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTCCACTCCGGCAG
GTTGATCACTGTGTCCTGGAGGAGGGTCACATTACACCACCCTATCAGAG
CTACGACTACCTCCATGAATTTTGTCCTGAGCCCATGGCTCTTCCCCAAC
TGCCTTTCAATGAATTCGATGAAAACTGGGCGAGTTCTTGGCTGGGTCTT
GAGTCAACGATTCCTGTCGCAGAAAATGTAATCGAACCCAATACACAGGA
TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT
CATCGGCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTA
AGCTTT
>C4
ATGTTTGCCTTCCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
TGATTTTGTGATGTATCCTTGCGTGGACCTCAACGTAGAAGCAGCTCCCA
TTGCATCAACAAAGTCCTCGGAGAAATCGAAGAGATCTCGCACGGCATTC
AGCAGCCATCAGCTAATCGAACTTGAAAGGGAGTTCCATCTCAACAAATA
TTTAGCCCGAACCAGGCGAATCGAAATATCCCAGCGTTTAGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGACGAATGAAACTCAAAAAG
TCGACCAATAGGAAAGGTGCCTTTGGAGCTCCGACAACATCTATTTCGCC
TTCTTCCCAATCGAGCGAAGATCTTCTGGAGAACGAGCAGATCGTGGAGC
GCCTCCTTAAATATGCAAGCACAAATCTTGAAACAGCTCCACTGCGGCAG
GATGATCGCGGTGTCCTACAGGATGGTCAAATTACACCACCCCATCAGAG
CTACGACTACCTCCATGAATTTTGTCCTGAGCCAATAGATGTTCTCCAAC
TGCACTTCAACGAATTCGATTCAGGCTGGGCGAGTACTTTGCTGAGTCTT
GAGTCAACAATCCCTGTCACAGAAAACCTAATTGAACCTTATATACAGGA
TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCTT
CATCGGAAGATATTTTGGATGTTGACTATGACTTCATTCAAAATTTGTTG
AATTTT
>C5
ATGTTTGCCACTCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG
TGATTTTGTGATGTATCCTTGCGTAGAGTTGAACGTAGAAGCAGCGCCCG
TTGCTACAACAAAGTCCGCGGAGAAATCGAAGAGATCTCGCACTGCATTC
AGCAGCCATCAGCTAATCGAACTCGAAAGGGAGTTCCATCTCAACAAATA
CTTGGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG
AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG
TCGACCAATAGGAAAGGTGCCATTGGAGCTCTCACCTCGTCTGTTTCAGC
TACTTCCCAATTGAGCGAAGATCTTCTCGAGGACGAGCAGATCGTAGAGC
GCCTGCTTAAATATGTAAGCACAAATGTGGAAACAGCTCCACTGCGGCAG
GATGAGCGCGGTTTCCTGGCGGAGGGTCAAATTACACCACCCCATCAGAG
CTACGACTACTTCCACGAATTTTGTCCCGAGCCAATAGGTGTTCCCCAAC
TGCGTTTCAATGAATTCGATTCAAACTGGGCAAGTACTTTGCTGGGTATT
GAGTCAACGATTCCTGTCACAGAACATTTTATTGAACCCAATGCACTGGA
TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCGT
CTTCGGAGGATATTTTGGATGTTGACTATGACTTTATTCAACATTTGTTG
AATTTT
>C1
MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
NF
>C2
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
NF
>C3
MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
SF
>C4
MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
NF
>C5
MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
NF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 756 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481336273
Setting output file names to "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 434842149
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4880804508
Seed = 54431556
Swapseed = 1481336273
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 43 unique site patterns
Division 2 has 31 unique site patterns
Division 3 has 52 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2223.201378 -- -25.624409
Chain 2 -- -2226.880552 -- -25.624409
Chain 3 -- -2226.880552 -- -25.624409
Chain 4 -- -2232.657341 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2180.023848 -- -25.624409
Chain 2 -- -2227.126553 -- -25.624409
Chain 3 -- -2139.887660 -- -25.624409
Chain 4 -- -2217.011287 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2223.201] (-2226.881) (-2226.881) (-2232.657) * [-2180.024] (-2227.127) (-2139.888) (-2217.011)
500 -- (-1935.427) [-1939.380] (-1941.177) (-1940.170) * (-1946.049) [-1939.978] (-1951.647) (-1949.660) -- 0:00:00
1000 -- [-1935.413] (-1934.442) (-1940.626) (-1934.731) * [-1944.749] (-1938.053) (-1939.480) (-1946.456) -- 0:00:00
1500 -- [-1933.627] (-1934.918) (-1938.880) (-1932.283) * (-1941.173) (-1939.848) [-1938.961] (-1934.795) -- 0:00:00
2000 -- (-1934.291) [-1933.272] (-1942.986) (-1936.671) * (-1941.025) [-1939.792] (-1933.708) (-1934.219) -- 0:00:00
2500 -- (-1932.975) (-1940.031) (-1937.629) [-1934.589] * (-1937.822) [-1939.205] (-1933.861) (-1939.587) -- 0:00:00
3000 -- (-1933.192) (-1940.166) [-1936.314] (-1935.050) * (-1933.467) (-1938.956) (-1935.806) [-1933.917] -- 0:00:00
3500 -- (-1938.828) (-1936.067) [-1934.492] (-1936.613) * (-1939.712) (-1934.260) (-1938.721) [-1937.242] -- 0:04:44
4000 -- (-1932.624) (-1937.486) [-1935.319] (-1940.471) * (-1936.867) (-1935.453) (-1934.683) [-1930.556] -- 0:04:09
4500 -- (-1943.755) [-1934.340] (-1932.805) (-1937.574) * (-1935.919) (-1939.527) (-1935.968) [-1934.234] -- 0:03:41
5000 -- (-1940.205) (-1938.287) [-1938.148] (-1933.195) * (-1938.728) (-1940.827) (-1934.042) [-1930.416] -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- [-1934.016] (-1940.200) (-1934.870) (-1936.766) * (-1935.097) [-1937.154] (-1938.681) (-1931.111) -- 0:03:00
6000 -- (-1936.919) [-1935.541] (-1932.811) (-1940.869) * (-1938.638) (-1938.928) [-1933.777] (-1932.740) -- 0:02:45
6500 -- (-1933.963) (-1936.707) (-1936.173) [-1936.407] * (-1938.691) (-1934.719) [-1934.157] (-1930.113) -- 0:02:32
7000 -- [-1938.323] (-1931.712) (-1936.814) (-1933.255) * (-1934.034) (-1932.288) [-1943.109] (-1933.427) -- 0:04:43
7500 -- (-1939.538) [-1932.686] (-1936.438) (-1937.860) * [-1936.759] (-1938.067) (-1933.942) (-1936.777) -- 0:04:24
8000 -- (-1935.042) (-1938.274) (-1938.180) [-1935.066] * [-1933.492] (-1932.790) (-1937.207) (-1935.732) -- 0:04:08
8500 -- (-1932.851) (-1935.063) (-1935.803) [-1931.047] * (-1933.720) (-1933.877) (-1939.460) [-1932.454] -- 0:03:53
9000 -- (-1933.273) [-1931.742] (-1932.890) (-1930.549) * [-1935.579] (-1934.832) (-1936.070) (-1936.195) -- 0:03:40
9500 -- [-1930.618] (-1936.390) (-1933.926) (-1935.754) * (-1936.120) (-1937.106) (-1933.913) [-1937.195] -- 0:03:28
10000 -- [-1933.535] (-1941.246) (-1939.083) (-1930.290) * (-1937.568) [-1934.511] (-1933.962) (-1934.577) -- 0:03:18
Average standard deviation of split frequencies: 0.000000
10500 -- [-1935.634] (-1938.387) (-1932.304) (-1932.434) * (-1939.179) (-1931.798) [-1932.529] (-1939.946) -- 0:03:08
11000 -- (-1942.937) [-1941.813] (-1934.553) (-1932.041) * (-1939.138) [-1934.271] (-1937.904) (-1938.054) -- 0:02:59
11500 -- (-1935.322) [-1938.171] (-1935.209) (-1937.371) * (-1938.696) [-1938.260] (-1937.472) (-1937.373) -- 0:02:51
12000 -- (-1936.356) [-1935.479] (-1937.418) (-1937.349) * (-1936.607) [-1933.217] (-1938.338) (-1937.089) -- 0:04:07
12500 -- [-1936.654] (-1930.463) (-1936.678) (-1940.728) * (-1934.880) [-1931.937] (-1939.372) (-1941.393) -- 0:03:57
13000 -- [-1936.284] (-1938.086) (-1938.735) (-1935.920) * (-1938.231) (-1940.758) (-1935.151) [-1937.985] -- 0:03:47
13500 -- (-1942.058) [-1939.334] (-1934.008) (-1932.146) * (-1940.423) (-1935.336) (-1938.277) [-1937.499] -- 0:03:39
14000 -- (-1940.648) [-1938.886] (-1934.500) (-1938.253) * [-1937.599] (-1935.472) (-1945.270) (-1937.134) -- 0:03:31
14500 -- (-1934.159) [-1931.639] (-1934.456) (-1935.694) * (-1932.708) (-1938.038) (-1935.917) [-1935.544] -- 0:03:23
15000 -- (-1936.717) (-1932.026) [-1938.432] (-1937.950) * (-1938.852) (-1934.400) [-1937.480] (-1936.861) -- 0:03:17
Average standard deviation of split frequencies: 0.000000
15500 -- (-1933.995) [-1940.201] (-1943.290) (-1934.587) * (-1937.658) (-1936.777) (-1939.102) [-1939.390] -- 0:03:10
16000 -- [-1937.171] (-1939.225) (-1939.235) (-1932.351) * (-1937.966) (-1938.959) [-1930.956] (-1944.723) -- 0:03:04
16500 -- (-1936.985) [-1936.725] (-1937.874) (-1929.278) * (-1939.809) (-1933.578) [-1931.863] (-1933.670) -- 0:02:58
17000 -- (-1935.590) (-1946.239) [-1942.427] (-1930.733) * (-1938.547) (-1939.343) [-1931.288] (-1942.210) -- 0:03:51
17500 -- (-1933.315) [-1937.300] (-1944.072) (-1930.691) * [-1935.196] (-1941.395) (-1931.276) (-1936.260) -- 0:03:44
18000 -- (-1929.184) (-1944.425) [-1934.587] (-1930.458) * [-1932.934] (-1948.396) (-1939.762) (-1931.949) -- 0:03:38
18500 -- (-1932.893) [-1936.690] (-1936.616) (-1935.004) * [-1932.937] (-1939.225) (-1936.259) (-1934.421) -- 0:03:32
19000 -- (-1938.210) (-1934.314) (-1940.294) [-1935.749] * (-1934.355) (-1936.791) [-1932.994] (-1930.619) -- 0:03:26
19500 -- (-1939.776) [-1939.203] (-1945.100) (-1936.284) * (-1941.544) (-1935.936) (-1934.900) [-1931.592] -- 0:03:21
20000 -- (-1940.667) [-1934.940] (-1945.344) (-1938.967) * (-1936.892) (-1932.604) [-1935.877] (-1939.152) -- 0:03:16
Average standard deviation of split frequencies: 0.000000
20500 -- (-1937.382) [-1933.253] (-1944.661) (-1938.090) * [-1936.718] (-1933.237) (-1937.240) (-1935.940) -- 0:03:11
21000 -- [-1936.042] (-1934.536) (-1940.751) (-1934.064) * (-1933.069) [-1935.658] (-1937.059) (-1930.577) -- 0:03:06
21500 -- (-1937.585) [-1932.975] (-1937.932) (-1943.655) * [-1938.623] (-1937.014) (-1938.034) (-1934.867) -- 0:03:02
22000 -- (-1937.703) (-1935.656) (-1934.517) [-1934.403] * (-1938.355) [-1936.270] (-1936.751) (-1934.871) -- 0:03:42
22500 -- (-1932.375) (-1931.850) [-1940.893] (-1939.301) * [-1936.479] (-1936.642) (-1942.202) (-1939.089) -- 0:03:37
23000 -- (-1937.248) (-1939.963) (-1933.357) [-1937.104] * (-1934.619) (-1933.565) (-1934.812) [-1931.419] -- 0:03:32
23500 -- (-1936.407) (-1935.677) (-1935.929) [-1937.562] * [-1939.857] (-1934.160) (-1936.712) (-1931.284) -- 0:03:27
24000 -- (-1933.986) (-1936.977) [-1934.116] (-1936.614) * (-1941.979) (-1942.937) (-1939.137) [-1934.666] -- 0:03:23
24500 -- (-1932.980) [-1934.537] (-1935.516) (-1937.008) * [-1930.858] (-1931.920) (-1939.212) (-1936.966) -- 0:03:19
25000 -- [-1937.411] (-1939.370) (-1932.566) (-1940.803) * (-1930.597) (-1933.179) (-1932.920) [-1937.598] -- 0:03:15
Average standard deviation of split frequencies: 0.000000
25500 -- (-1929.830) (-1931.564) [-1931.644] (-1935.842) * (-1930.664) [-1934.077] (-1934.799) (-1939.242) -- 0:03:11
26000 -- (-1934.145) [-1936.812] (-1932.259) (-1938.848) * (-1939.650) [-1936.455] (-1937.061) (-1935.203) -- 0:03:07
26500 -- (-1936.945) (-1946.275) [-1933.374] (-1933.147) * (-1933.558) (-1940.556) [-1929.920] (-1937.820) -- 0:03:03
27000 -- (-1934.346) (-1932.442) [-1934.412] (-1932.265) * (-1933.420) [-1938.772] (-1930.922) (-1935.664) -- 0:03:36
27500 -- (-1935.709) (-1944.481) (-1931.092) [-1931.582] * (-1933.435) [-1936.621] (-1940.440) (-1938.284) -- 0:03:32
28000 -- [-1935.302] (-1938.317) (-1934.297) (-1931.639) * (-1932.493) [-1930.412] (-1938.255) (-1934.399) -- 0:03:28
28500 -- [-1932.263] (-1933.768) (-1939.451) (-1935.020) * (-1932.523) [-1931.984] (-1940.084) (-1935.616) -- 0:03:24
29000 -- (-1932.184) [-1932.927] (-1940.975) (-1934.401) * [-1935.407] (-1932.064) (-1934.000) (-1935.462) -- 0:03:20
29500 -- (-1933.706) [-1935.504] (-1933.796) (-1931.754) * (-1945.217) (-1938.974) (-1935.941) [-1934.666] -- 0:03:17
30000 -- [-1935.727] (-1937.217) (-1939.780) (-1933.798) * [-1936.024] (-1937.857) (-1930.746) (-1935.477) -- 0:03:14
Average standard deviation of split frequencies: 0.000000
30500 -- [-1940.167] (-1936.277) (-1935.573) (-1935.200) * (-1933.654) (-1936.784) (-1931.998) [-1939.603] -- 0:03:10
31000 -- [-1934.300] (-1935.955) (-1935.057) (-1936.008) * (-1935.617) (-1939.552) [-1937.437] (-1936.803) -- 0:03:07
31500 -- (-1936.329) (-1938.843) (-1934.393) [-1934.800] * (-1936.852) (-1933.622) [-1937.019] (-1939.923) -- 0:03:35
32000 -- (-1937.017) [-1934.276] (-1937.624) (-1934.737) * (-1938.403) (-1933.780) [-1936.720] (-1936.401) -- 0:03:31
32500 -- (-1939.801) [-1936.564] (-1936.483) (-1937.142) * (-1939.930) (-1933.185) [-1938.656] (-1937.609) -- 0:03:28
33000 -- (-1933.326) (-1940.091) [-1937.080] (-1934.939) * (-1940.973) [-1937.478] (-1938.696) (-1938.236) -- 0:03:25
33500 -- (-1934.372) (-1939.163) (-1939.029) [-1938.372] * (-1942.928) [-1931.275] (-1939.607) (-1935.082) -- 0:03:21
34000 -- [-1939.778] (-1940.942) (-1938.269) (-1933.071) * (-1940.403) [-1933.341] (-1936.666) (-1938.762) -- 0:03:18
34500 -- [-1937.045] (-1941.424) (-1938.582) (-1935.236) * (-1935.538) (-1932.842) [-1937.393] (-1941.767) -- 0:03:15
35000 -- (-1940.982) (-1937.156) (-1938.923) [-1944.824] * [-1939.613] (-1941.053) (-1943.798) (-1935.872) -- 0:03:13
Average standard deviation of split frequencies: 0.000000
35500 -- [-1934.087] (-1932.412) (-1935.424) (-1950.926) * (-1933.558) [-1932.456] (-1935.050) (-1939.913) -- 0:03:10
36000 -- [-1934.227] (-1944.277) (-1940.664) (-1942.443) * (-1936.376) (-1932.050) [-1933.280] (-1934.650) -- 0:03:07
36500 -- [-1933.092] (-1934.542) (-1941.263) (-1936.972) * (-1933.346) (-1931.616) (-1938.186) [-1939.218] -- 0:03:31
37000 -- (-1944.865) (-1930.780) (-1937.418) [-1931.706] * (-1941.840) [-1938.384] (-1936.413) (-1940.582) -- 0:03:28
37500 -- (-1942.603) [-1934.000] (-1937.426) (-1934.054) * [-1934.753] (-1939.870) (-1932.206) (-1934.871) -- 0:03:25
38000 -- [-1935.576] (-1938.217) (-1943.458) (-1934.632) * [-1933.784] (-1937.489) (-1937.321) (-1933.022) -- 0:03:22
38500 -- [-1934.697] (-1954.319) (-1939.266) (-1933.688) * (-1932.601) [-1935.788] (-1935.902) (-1934.671) -- 0:03:19
39000 -- [-1934.459] (-1943.122) (-1940.741) (-1935.810) * (-1933.190) [-1933.286] (-1935.908) (-1937.191) -- 0:03:17
39500 -- (-1937.482) [-1935.092] (-1937.357) (-1935.539) * [-1936.052] (-1933.591) (-1936.146) (-1938.178) -- 0:03:14
40000 -- (-1934.111) (-1931.503) (-1937.954) [-1936.265] * [-1931.440] (-1938.184) (-1936.796) (-1939.263) -- 0:03:12
Average standard deviation of split frequencies: 0.000000
40500 -- (-1933.337) [-1934.786] (-1940.453) (-1945.259) * (-1933.682) (-1939.552) [-1931.303] (-1941.244) -- 0:03:09
41000 -- (-1933.643) (-1942.815) [-1930.551] (-1938.568) * (-1931.296) [-1931.562] (-1934.997) (-1938.515) -- 0:03:07
41500 -- (-1933.120) [-1935.902] (-1935.450) (-1938.179) * (-1933.664) [-1936.621] (-1933.070) (-1942.433) -- 0:03:27
42000 -- (-1934.205) (-1936.636) [-1936.436] (-1937.429) * (-1935.046) (-1933.507) (-1934.630) [-1933.993] -- 0:03:25
42500 -- (-1938.023) (-1934.669) (-1937.468) [-1931.544] * (-1935.511) [-1930.762] (-1933.366) (-1936.930) -- 0:03:22
43000 -- (-1937.959) (-1936.220) [-1940.829] (-1937.470) * [-1933.423] (-1934.470) (-1933.090) (-1938.380) -- 0:03:20
43500 -- [-1937.707] (-1935.235) (-1939.292) (-1940.875) * (-1935.855) (-1931.218) (-1932.272) [-1933.460] -- 0:03:17
44000 -- (-1941.568) (-1939.471) [-1931.746] (-1945.223) * (-1936.078) (-1932.973) (-1933.512) [-1931.450] -- 0:03:15
44500 -- (-1934.516) (-1933.945) (-1931.516) [-1942.961] * (-1936.116) [-1934.209] (-1938.601) (-1932.520) -- 0:03:13
45000 -- (-1936.557) (-1937.016) [-1931.658] (-1938.642) * (-1939.397) (-1939.728) (-1936.957) [-1931.806] -- 0:03:11
Average standard deviation of split frequencies: 0.000000
45500 -- (-1939.269) (-1938.302) [-1932.311] (-1934.483) * (-1931.788) (-1934.620) (-1941.303) [-1934.291] -- 0:03:08
46000 -- (-1934.256) [-1935.920] (-1935.191) (-1934.569) * (-1935.952) (-1932.056) [-1938.673] (-1934.100) -- 0:03:06
46500 -- (-1934.299) (-1935.973) (-1940.192) [-1931.575] * (-1937.748) [-1931.634] (-1940.670) (-1934.622) -- 0:03:25
47000 -- (-1938.107) [-1934.749] (-1943.141) (-1939.133) * (-1935.992) (-1939.814) (-1943.518) [-1933.568] -- 0:03:22
47500 -- (-1934.406) (-1938.618) [-1936.350] (-1932.677) * (-1935.168) (-1935.107) (-1938.466) [-1934.308] -- 0:03:20
48000 -- (-1936.138) (-1936.624) (-1934.399) [-1934.656] * [-1935.132] (-1932.907) (-1935.312) (-1935.530) -- 0:03:18
48500 -- (-1932.609) (-1943.242) [-1928.871] (-1935.739) * (-1934.034) (-1936.325) [-1935.708] (-1944.247) -- 0:03:16
49000 -- (-1941.561) (-1947.331) [-1931.795] (-1933.039) * [-1935.140] (-1935.473) (-1937.578) (-1935.836) -- 0:03:14
49500 -- [-1936.253] (-1942.844) (-1936.866) (-1935.961) * (-1932.660) [-1935.452] (-1940.914) (-1932.668) -- 0:03:12
50000 -- [-1937.439] (-1934.086) (-1932.480) (-1937.727) * (-1933.623) (-1937.633) (-1936.758) [-1934.750] -- 0:03:10
Average standard deviation of split frequencies: 0.000000
50500 -- [-1937.125] (-1932.442) (-1936.985) (-1937.173) * (-1938.661) (-1934.500) (-1941.870) [-1934.349] -- 0:03:08
51000 -- (-1939.448) [-1939.400] (-1934.733) (-1935.796) * (-1942.857) (-1936.609) [-1939.088] (-1934.872) -- 0:03:06
51500 -- (-1938.650) (-1938.434) [-1940.915] (-1931.833) * (-1932.892) [-1936.755] (-1934.329) (-1942.808) -- 0:03:22
52000 -- (-1936.898) [-1934.577] (-1937.162) (-1934.790) * [-1936.838] (-1944.822) (-1939.240) (-1948.349) -- 0:03:20
52500 -- (-1936.618) [-1931.577] (-1939.080) (-1936.530) * (-1933.651) (-1935.761) [-1940.643] (-1941.926) -- 0:03:18
53000 -- (-1930.018) (-1935.720) [-1933.814] (-1930.444) * [-1933.641] (-1941.895) (-1938.105) (-1937.255) -- 0:03:16
53500 -- [-1934.055] (-1933.910) (-1932.490) (-1932.925) * (-1936.290) (-1946.334) [-1936.362] (-1933.492) -- 0:03:14
54000 -- (-1932.577) (-1935.151) (-1932.962) [-1929.820] * [-1935.053] (-1941.520) (-1938.363) (-1937.152) -- 0:03:12
54500 -- [-1932.459] (-1935.898) (-1932.869) (-1940.675) * (-1932.814) (-1932.128) [-1931.658] (-1931.452) -- 0:03:10
55000 -- (-1933.522) [-1936.041] (-1936.025) (-1936.833) * (-1937.520) (-1933.170) (-1934.518) [-1931.738] -- 0:03:09
Average standard deviation of split frequencies: 0.000000
55500 -- [-1933.831] (-1933.067) (-1940.582) (-1940.110) * (-1933.290) (-1935.493) (-1932.023) [-1934.123] -- 0:03:07
56000 -- [-1931.095] (-1941.207) (-1935.440) (-1936.637) * (-1933.521) (-1936.054) (-1931.934) [-1940.805] -- 0:03:05
56500 -- (-1944.414) [-1934.546] (-1934.465) (-1937.557) * (-1932.367) [-1937.451] (-1935.970) (-1935.358) -- 0:03:20
57000 -- [-1934.543] (-1935.910) (-1933.135) (-1939.664) * (-1935.164) (-1930.108) [-1935.003] (-1940.774) -- 0:03:18
57500 -- (-1935.897) (-1932.223) [-1935.263] (-1936.141) * [-1933.464] (-1936.865) (-1935.568) (-1937.861) -- 0:03:16
58000 -- [-1939.112] (-1933.287) (-1934.232) (-1934.594) * [-1930.935] (-1939.881) (-1937.140) (-1946.202) -- 0:03:14
58500 -- (-1938.004) (-1934.475) [-1933.720] (-1937.959) * [-1931.275] (-1937.990) (-1934.314) (-1944.481) -- 0:03:13
59000 -- (-1941.407) (-1938.346) [-1932.476] (-1938.659) * [-1933.299] (-1941.056) (-1936.217) (-1940.257) -- 0:03:11
59500 -- (-1940.775) (-1941.910) (-1931.656) [-1935.558] * (-1931.346) (-1936.053) [-1939.031] (-1937.072) -- 0:03:09
60000 -- (-1940.180) (-1942.330) (-1931.335) [-1933.820] * (-1934.929) [-1939.007] (-1939.948) (-1937.379) -- 0:03:08
Average standard deviation of split frequencies: 0.000000
60500 -- (-1940.745) [-1935.161] (-1931.494) (-1937.456) * (-1937.470) (-1938.641) [-1931.348] (-1940.133) -- 0:03:06
61000 -- (-1940.447) (-1933.194) (-1935.364) [-1937.565] * (-1941.555) (-1937.738) [-1930.957] (-1944.924) -- 0:03:20
61500 -- (-1940.884) (-1932.809) (-1938.650) [-1936.694] * (-1934.428) [-1936.305] (-1932.297) (-1945.697) -- 0:03:18
62000 -- (-1943.869) (-1938.334) [-1930.566] (-1933.290) * (-1933.808) [-1937.253] (-1933.705) (-1941.726) -- 0:03:16
62500 -- (-1944.163) [-1933.459] (-1931.318) (-1939.469) * (-1937.290) (-1935.178) [-1929.367] (-1937.600) -- 0:03:15
63000 -- (-1932.732) [-1934.014] (-1947.249) (-1936.437) * (-1931.947) [-1932.687] (-1935.189) (-1943.726) -- 0:03:13
63500 -- (-1937.007) [-1934.112] (-1943.714) (-1945.891) * [-1938.046] (-1932.687) (-1935.778) (-1937.123) -- 0:03:11
64000 -- (-1937.397) [-1935.678] (-1934.545) (-1934.703) * (-1938.209) (-1933.644) (-1940.252) [-1935.520] -- 0:03:10
64500 -- (-1940.242) [-1935.287] (-1938.202) (-1934.934) * [-1934.825] (-1934.327) (-1936.213) (-1936.557) -- 0:03:08
65000 -- [-1933.903] (-1932.064) (-1932.714) (-1937.121) * [-1937.486] (-1935.353) (-1936.166) (-1939.900) -- 0:03:07
Average standard deviation of split frequencies: 0.000000
65500 -- (-1936.740) (-1933.424) [-1931.903] (-1944.613) * (-1930.709) [-1939.754] (-1938.413) (-1937.425) -- 0:03:05
66000 -- (-1930.443) [-1930.330] (-1936.073) (-1940.814) * (-1932.109) [-1938.527] (-1938.149) (-1932.282) -- 0:03:18
66500 -- (-1938.534) (-1941.134) [-1939.229] (-1931.286) * [-1934.717] (-1939.127) (-1944.007) (-1938.862) -- 0:03:16
67000 -- [-1934.682] (-1935.386) (-1939.453) (-1938.878) * [-1938.829] (-1932.000) (-1939.488) (-1933.745) -- 0:03:14
67500 -- (-1934.773) (-1936.240) (-1933.122) [-1934.098] * (-1938.408) [-1933.415] (-1936.822) (-1935.083) -- 0:03:13
68000 -- (-1939.268) [-1932.420] (-1935.460) (-1930.939) * (-1933.908) (-1935.254) (-1935.297) [-1935.833] -- 0:03:11
68500 -- (-1935.981) (-1937.287) (-1932.901) [-1934.402] * (-1937.486) [-1934.985] (-1934.192) (-1938.730) -- 0:03:10
69000 -- (-1934.383) [-1934.076] (-1930.308) (-1939.325) * (-1936.906) (-1937.786) [-1936.753] (-1933.842) -- 0:03:08
69500 -- [-1929.582] (-1931.471) (-1934.313) (-1936.234) * (-1943.378) [-1935.770] (-1932.345) (-1929.896) -- 0:03:07
70000 -- (-1936.988) [-1931.313] (-1931.273) (-1929.512) * [-1939.176] (-1933.393) (-1936.259) (-1935.997) -- 0:03:06
Average standard deviation of split frequencies: 0.000000
70500 -- (-1934.229) [-1934.238] (-1943.766) (-1933.254) * [-1937.039] (-1932.878) (-1933.340) (-1937.436) -- 0:03:04
71000 -- [-1931.892] (-1935.020) (-1933.364) (-1936.606) * (-1935.388) (-1938.054) [-1936.367] (-1937.951) -- 0:03:16
71500 -- (-1933.137) [-1938.653] (-1934.331) (-1933.715) * [-1935.159] (-1937.872) (-1943.644) (-1931.134) -- 0:03:14
72000 -- [-1934.361] (-1936.199) (-1938.391) (-1938.644) * [-1941.043] (-1934.782) (-1939.018) (-1931.968) -- 0:03:13
72500 -- (-1937.774) [-1936.571] (-1940.744) (-1938.877) * [-1935.033] (-1938.893) (-1939.037) (-1937.034) -- 0:03:11
73000 -- (-1932.628) (-1934.623) (-1935.639) [-1932.685] * (-1934.431) (-1936.071) (-1940.558) [-1931.187] -- 0:03:10
73500 -- (-1935.103) (-1936.907) (-1941.361) [-1939.516] * (-1940.640) [-1938.848] (-1933.584) (-1938.910) -- 0:03:09
74000 -- (-1944.804) [-1933.747] (-1946.303) (-1939.480) * (-1937.722) [-1942.032] (-1930.053) (-1932.009) -- 0:03:07
74500 -- (-1931.727) [-1931.947] (-1940.769) (-1942.245) * (-1940.033) (-1932.846) [-1934.748] (-1932.070) -- 0:03:06
75000 -- [-1936.537] (-1931.985) (-1942.353) (-1936.879) * (-1938.799) [-1936.952] (-1937.568) (-1935.396) -- 0:03:05
Average standard deviation of split frequencies: 0.000000
75500 -- [-1936.742] (-1943.151) (-1938.151) (-1940.531) * [-1942.080] (-1933.292) (-1933.492) (-1933.388) -- 0:03:03
76000 -- (-1937.994) [-1933.554] (-1935.428) (-1937.924) * (-1938.367) [-1931.554] (-1935.182) (-1935.270) -- 0:03:14
76500 -- (-1939.805) [-1937.770] (-1938.560) (-1934.855) * (-1942.708) (-1936.238) [-1933.596] (-1933.435) -- 0:03:13
77000 -- [-1932.081] (-1933.947) (-1935.707) (-1936.312) * [-1939.454] (-1939.505) (-1935.744) (-1935.783) -- 0:03:11
77500 -- (-1937.322) (-1934.527) [-1937.050] (-1932.253) * [-1936.526] (-1937.824) (-1931.186) (-1933.982) -- 0:03:10
78000 -- (-1942.201) (-1937.267) [-1939.383] (-1933.759) * (-1930.563) [-1934.172] (-1937.749) (-1935.157) -- 0:03:09
78500 -- (-1938.129) (-1939.397) (-1933.683) [-1934.501] * (-1934.855) [-1935.621] (-1936.988) (-1933.585) -- 0:03:07
79000 -- (-1943.498) (-1936.879) (-1935.000) [-1930.572] * (-1938.303) (-1933.637) [-1943.720] (-1933.507) -- 0:03:06
79500 -- (-1934.999) (-1932.991) [-1933.298] (-1941.466) * [-1931.796] (-1935.573) (-1937.851) (-1935.713) -- 0:03:05
80000 -- (-1933.982) (-1935.337) [-1934.618] (-1942.701) * (-1934.777) (-1941.965) [-1936.014] (-1936.895) -- 0:03:04
Average standard deviation of split frequencies: 0.000000
80500 -- [-1936.587] (-1934.378) (-1944.730) (-1939.847) * [-1931.968] (-1937.277) (-1942.737) (-1934.712) -- 0:03:02
81000 -- [-1935.099] (-1941.207) (-1937.760) (-1938.329) * (-1931.683) [-1936.616] (-1948.056) (-1939.465) -- 0:03:12
81500 -- [-1932.942] (-1936.676) (-1935.025) (-1943.044) * (-1934.741) [-1937.118] (-1939.602) (-1933.131) -- 0:03:11
82000 -- [-1938.980] (-1937.764) (-1938.529) (-1940.961) * [-1934.573] (-1937.707) (-1938.802) (-1931.987) -- 0:03:10
82500 -- (-1933.809) (-1935.958) [-1943.266] (-1946.217) * [-1931.915] (-1935.165) (-1938.231) (-1933.450) -- 0:03:09
83000 -- (-1934.091) (-1934.191) (-1945.207) [-1936.541] * (-1938.957) [-1939.456] (-1934.969) (-1931.980) -- 0:03:07
83500 -- [-1936.068] (-1935.440) (-1941.500) (-1931.974) * (-1935.703) [-1932.513] (-1936.010) (-1930.870) -- 0:03:06
84000 -- (-1936.600) (-1940.707) (-1943.200) [-1933.117] * (-1937.749) (-1935.154) [-1930.494] (-1936.900) -- 0:03:05
84500 -- (-1934.191) (-1935.357) (-1943.024) [-1935.158] * (-1937.404) [-1935.286] (-1938.858) (-1942.043) -- 0:03:04
85000 -- (-1942.441) [-1931.659] (-1942.727) (-1939.049) * (-1936.950) (-1937.835) [-1939.543] (-1935.949) -- 0:03:03
Average standard deviation of split frequencies: 0.000000
85500 -- [-1943.176] (-1939.630) (-1946.515) (-1941.869) * (-1941.270) [-1933.888] (-1935.789) (-1934.759) -- 0:03:01
86000 -- (-1934.318) [-1932.370] (-1945.437) (-1933.469) * (-1931.499) [-1938.301] (-1934.115) (-1936.620) -- 0:03:11
86500 -- [-1940.152] (-1935.934) (-1942.191) (-1938.253) * (-1936.110) [-1936.123] (-1937.482) (-1942.021) -- 0:03:10
87000 -- [-1935.107] (-1931.597) (-1934.457) (-1935.332) * [-1932.581] (-1938.943) (-1937.867) (-1936.755) -- 0:03:08
87500 -- [-1934.813] (-1930.684) (-1943.333) (-1936.322) * (-1939.511) (-1934.954) [-1932.939] (-1934.218) -- 0:03:07
88000 -- (-1932.367) (-1934.119) [-1936.034] (-1936.420) * (-1940.470) [-1931.874] (-1938.130) (-1933.373) -- 0:03:06
88500 -- [-1937.091] (-1932.437) (-1934.841) (-1935.110) * [-1935.507] (-1932.860) (-1940.270) (-1934.187) -- 0:03:05
89000 -- (-1934.035) [-1936.859] (-1941.213) (-1940.924) * (-1935.605) (-1934.605) [-1935.486] (-1931.564) -- 0:03:04
89500 -- (-1940.228) [-1937.264] (-1933.305) (-1938.941) * [-1932.851] (-1939.267) (-1933.068) (-1934.209) -- 0:03:03
90000 -- (-1936.701) (-1937.915) [-1934.473] (-1935.027) * [-1940.162] (-1933.076) (-1935.464) (-1934.063) -- 0:03:02
Average standard deviation of split frequencies: 0.000000
90500 -- (-1935.729) (-1940.003) (-1933.843) [-1934.156] * (-1942.032) (-1933.925) (-1934.716) [-1939.572] -- 0:03:00
91000 -- (-1938.159) (-1937.407) [-1936.516] (-1935.927) * (-1934.866) (-1933.172) (-1934.222) [-1932.892] -- 0:03:09
91500 -- (-1932.651) [-1931.129] (-1936.731) (-1937.184) * [-1940.571] (-1933.506) (-1942.119) (-1930.398) -- 0:03:08
92000 -- [-1936.240] (-1935.871) (-1936.316) (-1932.821) * [-1939.994] (-1939.115) (-1942.303) (-1934.177) -- 0:03:07
92500 -- [-1938.194] (-1929.659) (-1936.229) (-1934.962) * (-1939.183) (-1932.180) (-1939.148) [-1938.098] -- 0:03:06
93000 -- (-1935.199) (-1937.496) (-1935.539) [-1933.516] * [-1939.627] (-1938.281) (-1937.693) (-1933.379) -- 0:03:05
93500 -- (-1938.910) (-1930.050) (-1932.536) [-1932.917] * (-1936.451) (-1944.690) [-1935.698] (-1937.072) -- 0:03:04
94000 -- (-1934.232) (-1933.273) (-1935.713) [-1931.593] * (-1942.568) (-1934.251) [-1932.043] (-1938.967) -- 0:03:03
94500 -- [-1929.810] (-1934.329) (-1937.543) (-1934.882) * (-1932.794) (-1938.668) [-1934.608] (-1934.081) -- 0:03:02
95000 -- [-1937.729] (-1934.112) (-1932.176) (-1936.072) * (-1936.867) (-1941.225) [-1933.244] (-1933.305) -- 0:03:01
Average standard deviation of split frequencies: 0.000000
95500 -- [-1941.061] (-1934.280) (-1941.472) (-1941.204) * (-1937.845) (-1941.102) (-1931.985) [-1930.654] -- 0:03:09
96000 -- (-1942.058) (-1935.604) [-1941.911] (-1941.753) * (-1943.058) (-1939.138) [-1930.819] (-1935.050) -- 0:03:08
96500 -- (-1940.205) (-1941.312) [-1936.405] (-1933.884) * [-1931.341] (-1948.259) (-1947.197) (-1935.587) -- 0:03:07
97000 -- [-1934.731] (-1941.077) (-1933.929) (-1937.252) * (-1932.704) (-1939.206) (-1937.851) [-1934.839] -- 0:03:06
97500 -- (-1935.813) (-1937.525) (-1938.590) [-1937.899] * [-1932.165] (-1940.293) (-1935.903) (-1931.812) -- 0:03:05
98000 -- (-1935.812) (-1936.199) (-1940.550) [-1929.795] * [-1931.260] (-1938.852) (-1934.288) (-1936.225) -- 0:03:04
98500 -- (-1935.951) (-1935.276) (-1936.796) [-1940.004] * (-1932.719) (-1937.176) [-1932.688] (-1936.351) -- 0:03:03
99000 -- (-1938.505) (-1941.382) (-1940.505) [-1939.394] * (-1937.770) [-1937.049] (-1931.970) (-1937.402) -- 0:03:02
99500 -- (-1944.657) (-1944.053) [-1935.981] (-1934.404) * (-1940.286) [-1929.652] (-1934.996) (-1935.245) -- 0:03:01
100000 -- (-1939.489) (-1935.451) (-1933.287) [-1936.287] * [-1935.661] (-1934.461) (-1935.362) (-1937.166) -- 0:03:00
Average standard deviation of split frequencies: 0.000000
100500 -- (-1932.510) (-1938.918) (-1939.221) [-1934.254] * (-1937.396) (-1933.164) [-1943.548] (-1941.435) -- 0:03:07
101000 -- (-1938.522) [-1940.755] (-1937.039) (-1937.206) * (-1939.949) (-1932.956) [-1942.349] (-1939.713) -- 0:03:06
101500 -- [-1939.776] (-1935.726) (-1932.661) (-1932.753) * [-1933.836] (-1930.734) (-1941.139) (-1944.244) -- 0:03:05
102000 -- [-1935.088] (-1935.298) (-1935.957) (-1933.813) * (-1939.916) [-1933.011] (-1941.222) (-1934.081) -- 0:03:04
102500 -- (-1934.876) (-1940.303) [-1937.102] (-1932.472) * (-1940.693) (-1931.229) (-1945.614) [-1941.257] -- 0:03:03
103000 -- (-1935.911) [-1937.919] (-1938.245) (-1933.905) * [-1932.169] (-1936.905) (-1939.839) (-1936.292) -- 0:03:02
103500 -- (-1941.036) [-1936.599] (-1943.728) (-1935.669) * (-1932.343) [-1933.895] (-1937.020) (-1937.494) -- 0:03:01
104000 -- (-1939.135) [-1936.016] (-1934.898) (-1933.855) * [-1931.593] (-1933.559) (-1935.278) (-1935.623) -- 0:03:00
104500 -- (-1939.355) (-1943.908) (-1938.410) [-1932.671] * [-1934.404] (-1937.737) (-1939.838) (-1932.123) -- 0:02:59
105000 -- (-1938.310) (-1942.481) [-1941.776] (-1933.539) * [-1932.644] (-1937.124) (-1937.466) (-1930.772) -- 0:02:59
Average standard deviation of split frequencies: 0.000000
105500 -- (-1943.601) [-1933.557] (-1940.401) (-1931.301) * (-1935.846) [-1932.801] (-1935.411) (-1938.501) -- 0:03:06
106000 -- (-1945.382) (-1934.455) (-1936.445) [-1933.622] * (-1930.043) [-1933.737] (-1933.278) (-1941.180) -- 0:03:05
106500 -- (-1944.541) (-1937.010) (-1938.194) [-1931.463] * [-1936.593] (-1932.146) (-1938.023) (-1936.898) -- 0:03:04
107000 -- [-1939.512] (-1945.818) (-1936.450) (-1929.956) * [-1934.831] (-1935.282) (-1933.772) (-1938.889) -- 0:03:03
107500 -- (-1937.518) (-1946.674) (-1939.009) [-1929.604] * [-1936.275] (-1935.021) (-1933.860) (-1936.313) -- 0:03:02
108000 -- [-1934.686] (-1943.917) (-1933.785) (-1932.972) * (-1935.652) [-1933.700] (-1943.327) (-1933.061) -- 0:03:01
108500 -- (-1939.228) (-1938.820) [-1929.178] (-1941.055) * (-1938.920) (-1935.593) (-1931.425) [-1935.997] -- 0:03:00
109000 -- (-1930.879) (-1937.027) [-1931.466] (-1934.623) * (-1934.810) (-1931.973) (-1935.284) [-1935.462] -- 0:02:59
109500 -- (-1931.849) (-1929.404) [-1934.252] (-1931.954) * (-1935.449) [-1937.150] (-1936.395) (-1934.521) -- 0:03:07
110000 -- [-1937.358] (-1934.643) (-1937.386) (-1934.968) * [-1932.286] (-1934.035) (-1936.518) (-1933.078) -- 0:03:06
Average standard deviation of split frequencies: 0.000000
110500 -- [-1938.625] (-1945.457) (-1938.563) (-1935.730) * (-1931.559) (-1938.046) (-1935.858) [-1935.329] -- 0:03:05
111000 -- (-1931.505) (-1938.285) [-1939.255] (-1945.510) * (-1934.461) [-1931.177] (-1935.417) (-1937.759) -- 0:03:04
111500 -- [-1932.970] (-1942.835) (-1936.574) (-1934.633) * (-1932.038) (-1931.211) (-1938.040) [-1935.215] -- 0:03:03
112000 -- (-1931.485) (-1933.454) (-1934.497) [-1933.002] * (-1932.760) [-1931.232] (-1935.727) (-1936.831) -- 0:03:02
112500 -- (-1931.714) (-1936.287) [-1931.334] (-1936.287) * [-1937.307] (-1935.686) (-1934.523) (-1934.759) -- 0:03:01
113000 -- (-1935.753) (-1934.935) (-1935.615) [-1936.679] * [-1936.433] (-1935.596) (-1933.033) (-1934.178) -- 0:03:00
113500 -- (-1937.500) (-1939.528) (-1931.202) [-1936.652] * (-1935.703) [-1932.616] (-1935.813) (-1937.618) -- 0:02:59
114000 -- (-1932.098) [-1937.058] (-1935.135) (-1937.517) * (-1938.116) (-1939.495) (-1938.776) [-1935.905] -- 0:02:58
114500 -- (-1938.287) [-1932.712] (-1935.917) (-1933.395) * [-1931.873] (-1943.920) (-1935.909) (-1932.783) -- 0:03:05
115000 -- (-1938.956) [-1932.315] (-1936.906) (-1936.567) * (-1933.897) (-1934.582) [-1933.587] (-1932.752) -- 0:03:04
Average standard deviation of split frequencies: 0.000000
115500 -- (-1944.842) (-1936.245) [-1931.999] (-1934.163) * (-1933.184) (-1941.032) [-1937.383] (-1934.794) -- 0:03:03
116000 -- (-1941.902) (-1930.702) (-1931.324) [-1935.873] * (-1940.668) [-1934.278] (-1939.525) (-1930.814) -- 0:03:02
116500 -- (-1939.354) [-1933.584] (-1937.718) (-1939.610) * (-1935.380) (-1938.784) (-1937.275) [-1929.920] -- 0:03:02
117000 -- (-1934.607) (-1937.942) [-1936.972] (-1941.372) * [-1934.101] (-1937.343) (-1933.463) (-1939.282) -- 0:03:01
117500 -- (-1939.898) [-1931.548] (-1932.801) (-1936.891) * (-1937.885) (-1937.924) (-1936.670) [-1932.526] -- 0:03:00
118000 -- (-1937.416) [-1935.828] (-1943.008) (-1937.173) * [-1931.843] (-1933.549) (-1937.874) (-1943.548) -- 0:02:59
118500 -- (-1939.157) (-1932.708) [-1934.050] (-1934.671) * [-1929.938] (-1934.675) (-1942.358) (-1938.153) -- 0:02:58
119000 -- (-1938.747) (-1934.686) [-1935.476] (-1935.648) * (-1933.713) [-1936.859] (-1938.533) (-1934.333) -- 0:03:05
119500 -- (-1933.887) [-1934.059] (-1936.867) (-1936.969) * (-1941.145) [-1930.488] (-1939.361) (-1932.435) -- 0:03:04
120000 -- (-1939.280) [-1935.389] (-1944.684) (-1935.126) * (-1933.186) (-1938.902) [-1930.990] (-1935.416) -- 0:03:03
Average standard deviation of split frequencies: 0.000000
120500 -- (-1936.066) [-1932.370] (-1932.871) (-1934.143) * [-1936.484] (-1938.331) (-1933.769) (-1937.150) -- 0:03:02
121000 -- (-1935.399) (-1933.454) (-1934.416) [-1938.848] * (-1937.243) (-1936.783) [-1928.869] (-1938.868) -- 0:03:01
121500 -- (-1936.084) (-1931.347) [-1933.408] (-1934.942) * [-1938.435] (-1937.553) (-1934.556) (-1937.325) -- 0:03:00
122000 -- (-1935.393) (-1934.581) (-1938.496) [-1935.463] * (-1938.142) (-1939.995) [-1936.575] (-1937.184) -- 0:02:59
122500 -- (-1932.192) [-1935.521] (-1935.852) (-1934.463) * [-1937.911] (-1934.146) (-1935.153) (-1935.540) -- 0:02:59
123000 -- (-1936.138) [-1928.059] (-1936.415) (-1937.977) * (-1931.086) (-1934.203) (-1939.203) [-1933.565] -- 0:02:58
123500 -- [-1932.488] (-1931.199) (-1933.818) (-1937.043) * (-1933.172) (-1931.712) [-1935.770] (-1937.761) -- 0:02:57
124000 -- (-1935.386) (-1930.608) (-1937.013) [-1936.534] * (-1938.308) [-1938.957] (-1940.730) (-1935.508) -- 0:03:03
124500 -- (-1934.419) (-1935.213) [-1931.740] (-1938.250) * [-1936.108] (-1944.908) (-1937.677) (-1936.180) -- 0:03:02
125000 -- [-1934.303] (-1934.187) (-1932.963) (-1933.073) * [-1931.537] (-1934.919) (-1943.414) (-1942.359) -- 0:03:02
Average standard deviation of split frequencies: 0.000000
125500 -- [-1933.704] (-1932.960) (-1945.829) (-1932.928) * (-1939.067) (-1933.412) [-1935.265] (-1941.668) -- 0:03:01
126000 -- (-1935.191) [-1933.370] (-1933.311) (-1936.783) * [-1934.483] (-1931.402) (-1937.239) (-1937.712) -- 0:03:00
126500 -- (-1935.036) (-1938.504) (-1935.161) [-1938.578] * (-1937.198) (-1930.260) [-1934.547] (-1934.359) -- 0:02:59
127000 -- (-1937.580) (-1939.091) (-1941.031) [-1931.885] * [-1932.118] (-1931.605) (-1938.082) (-1934.665) -- 0:02:58
127500 -- (-1936.077) (-1940.036) (-1946.123) [-1938.965] * [-1930.463] (-1933.657) (-1942.203) (-1932.612) -- 0:02:57
128000 -- (-1934.575) [-1940.912] (-1936.376) (-1937.612) * (-1930.988) (-1934.522) [-1938.136] (-1932.248) -- 0:02:57
128500 -- (-1938.771) (-1930.582) [-1933.953] (-1934.201) * (-1933.753) (-1931.472) [-1934.458] (-1938.779) -- 0:03:03
129000 -- (-1945.048) (-1933.489) (-1944.567) [-1934.275] * (-1935.320) (-1935.124) (-1940.159) [-1935.998] -- 0:03:02
129500 -- (-1943.858) [-1933.823] (-1938.423) (-1934.121) * (-1941.974) (-1936.574) (-1943.688) [-1932.999] -- 0:03:01
130000 -- (-1938.280) (-1934.425) (-1932.582) [-1932.224] * (-1938.633) [-1935.670] (-1935.450) (-1930.779) -- 0:03:00
Average standard deviation of split frequencies: 0.000000
130500 -- (-1936.690) (-1935.495) [-1931.609] (-1935.262) * (-1936.219) [-1933.084] (-1933.998) (-1933.329) -- 0:02:59
131000 -- (-1933.254) [-1935.567] (-1939.047) (-1934.260) * [-1932.935] (-1937.912) (-1936.670) (-1930.438) -- 0:02:59
131500 -- [-1930.308] (-1933.430) (-1931.178) (-1940.875) * (-1940.199) (-1933.276) [-1937.631] (-1930.569) -- 0:02:58
132000 -- (-1935.209) (-1934.584) (-1934.204) [-1936.430] * (-1943.786) (-1937.237) [-1942.435] (-1936.093) -- 0:02:57
132500 -- (-1941.453) [-1931.877] (-1932.841) (-1934.736) * (-1941.160) (-1935.277) (-1943.283) [-1935.430] -- 0:02:56
133000 -- (-1935.635) (-1937.433) [-1936.173] (-1940.011) * (-1940.470) (-1936.390) [-1935.762] (-1933.023) -- 0:02:56
133500 -- (-1936.802) [-1931.519] (-1945.619) (-1943.200) * [-1939.243] (-1933.025) (-1931.023) (-1936.368) -- 0:03:01
134000 -- (-1934.605) (-1940.279) [-1943.163] (-1932.927) * (-1937.364) (-1934.841) (-1931.822) [-1932.000] -- 0:03:00
134500 -- (-1934.280) (-1940.977) (-1939.112) [-1931.900] * (-1929.150) (-1939.240) (-1932.668) [-1936.685] -- 0:03:00
135000 -- (-1936.713) [-1940.551] (-1936.810) (-1934.913) * (-1939.868) [-1942.274] (-1936.968) (-1932.880) -- 0:02:59
Average standard deviation of split frequencies: 0.000000
135500 -- (-1935.843) [-1931.896] (-1933.883) (-1935.717) * (-1933.190) (-1941.825) (-1940.876) [-1933.705] -- 0:02:58
136000 -- (-1940.627) (-1939.481) (-1940.065) [-1935.020] * (-1942.105) [-1932.470] (-1935.212) (-1931.912) -- 0:02:57
136500 -- (-1931.853) [-1930.894] (-1941.024) (-1933.907) * (-1937.327) (-1934.749) [-1933.796] (-1930.993) -- 0:02:57
137000 -- [-1930.601] (-1935.286) (-1929.832) (-1938.927) * (-1937.411) (-1933.567) [-1928.860] (-1933.223) -- 0:02:56
137500 -- (-1934.987) [-1933.843] (-1932.393) (-1936.457) * (-1933.836) (-1932.840) (-1933.019) [-1933.132] -- 0:02:55
138000 -- (-1934.995) [-1932.575] (-1937.055) (-1934.705) * (-1931.147) (-1936.814) (-1932.560) [-1941.715] -- 0:03:01
138500 -- (-1935.358) [-1933.627] (-1938.876) (-1942.650) * [-1930.713] (-1943.217) (-1938.468) (-1942.231) -- 0:03:00
139000 -- (-1932.849) [-1935.098] (-1942.597) (-1936.675) * (-1933.850) (-1936.773) (-1938.481) [-1936.894] -- 0:02:59
139500 -- (-1934.385) [-1936.092] (-1937.258) (-1941.780) * (-1936.651) (-1939.863) [-1928.999] (-1933.012) -- 0:02:58
140000 -- (-1937.832) [-1940.665] (-1930.348) (-1936.428) * (-1934.595) (-1940.624) [-1932.517] (-1932.683) -- 0:02:58
Average standard deviation of split frequencies: 0.000000
140500 -- (-1932.907) (-1940.582) [-1936.396] (-1935.878) * [-1928.773] (-1943.174) (-1932.344) (-1938.532) -- 0:02:57
141000 -- [-1938.293] (-1933.068) (-1933.141) (-1934.793) * (-1932.157) (-1937.131) [-1933.340] (-1932.909) -- 0:02:56
141500 -- (-1938.845) [-1933.590] (-1932.882) (-1942.994) * (-1932.780) (-1937.969) (-1939.457) [-1936.654] -- 0:02:55
142000 -- (-1934.735) (-1932.790) (-1940.348) [-1940.978] * (-1936.615) [-1944.135] (-1937.751) (-1935.093) -- 0:02:55
142500 -- [-1931.640] (-1931.526) (-1938.598) (-1937.279) * (-1938.173) (-1934.966) [-1933.635] (-1943.502) -- 0:02:54
143000 -- [-1936.121] (-1931.807) (-1935.207) (-1938.930) * (-1936.676) (-1937.804) (-1935.009) [-1943.845] -- 0:02:59
143500 -- (-1936.864) (-1929.411) [-1932.339] (-1933.136) * [-1933.923] (-1938.587) (-1934.942) (-1942.361) -- 0:02:59
144000 -- (-1939.128) (-1935.513) [-1934.411] (-1935.511) * (-1936.344) (-1929.853) [-1934.271] (-1938.576) -- 0:02:58
144500 -- (-1938.079) (-1934.248) [-1936.004] (-1940.137) * (-1937.759) [-1931.597] (-1936.865) (-1937.492) -- 0:02:57
145000 -- (-1936.013) [-1933.688] (-1933.222) (-1937.670) * (-1938.842) (-1935.040) (-1936.959) [-1936.423] -- 0:02:56
Average standard deviation of split frequencies: 0.000000
145500 -- (-1936.450) (-1931.996) [-1934.340] (-1940.054) * (-1944.137) (-1936.656) (-1932.359) [-1936.348] -- 0:02:56
146000 -- [-1938.791] (-1936.587) (-1936.566) (-1939.109) * (-1934.973) [-1930.924] (-1934.862) (-1932.655) -- 0:02:55
146500 -- [-1932.878] (-1936.316) (-1941.335) (-1935.592) * (-1937.472) [-1933.463] (-1936.378) (-1934.104) -- 0:02:54
147000 -- (-1937.263) (-1932.064) [-1939.179] (-1935.609) * (-1943.584) [-1932.290] (-1937.653) (-1932.806) -- 0:02:54
147500 -- [-1941.642] (-1932.281) (-1938.755) (-1934.877) * (-1933.192) (-1937.735) (-1934.713) [-1934.856] -- 0:02:59
148000 -- (-1937.698) [-1934.951] (-1945.759) (-1936.648) * [-1938.945] (-1933.518) (-1932.857) (-1933.227) -- 0:02:58
148500 -- [-1932.845] (-1936.174) (-1942.319) (-1938.259) * (-1937.376) (-1931.609) (-1939.404) [-1937.968] -- 0:02:57
149000 -- (-1934.639) (-1934.705) (-1938.729) [-1936.674] * (-1936.596) [-1933.863] (-1943.006) (-1934.719) -- 0:02:57
149500 -- (-1934.855) (-1937.147) (-1934.636) [-1935.299] * (-1946.452) (-1935.529) [-1935.798] (-1934.592) -- 0:02:56
150000 -- (-1943.992) (-1931.863) [-1934.228] (-1938.886) * (-1941.552) (-1934.843) [-1934.711] (-1931.804) -- 0:02:55
Average standard deviation of split frequencies: 0.000000
150500 -- (-1939.901) (-1933.181) [-1929.297] (-1942.999) * (-1937.338) (-1934.555) [-1934.927] (-1940.773) -- 0:02:54
151000 -- [-1935.330] (-1933.900) (-1942.977) (-1937.075) * (-1932.649) (-1940.749) [-1933.996] (-1935.744) -- 0:02:54
151500 -- [-1934.426] (-1932.012) (-1943.484) (-1936.469) * (-1935.463) [-1930.741] (-1930.903) (-1933.146) -- 0:02:53
152000 -- (-1932.335) [-1934.979] (-1938.646) (-1939.603) * (-1935.294) [-1936.284] (-1936.697) (-1941.191) -- 0:02:52
152500 -- [-1935.970] (-1934.936) (-1935.069) (-1942.598) * (-1931.826) [-1937.135] (-1937.095) (-1937.164) -- 0:02:57
153000 -- (-1940.284) (-1939.015) [-1932.595] (-1941.621) * [-1933.778] (-1933.465) (-1934.883) (-1937.217) -- 0:02:57
153500 -- (-1939.071) (-1940.769) [-1931.483] (-1941.011) * (-1936.751) [-1941.761] (-1942.154) (-1936.606) -- 0:02:56
154000 -- (-1931.567) (-1938.815) (-1931.878) [-1937.620] * (-1940.647) (-1936.815) (-1940.147) [-1937.443] -- 0:02:55
154500 -- (-1932.076) (-1933.584) (-1935.557) [-1943.538] * [-1933.478] (-1942.276) (-1932.872) (-1931.420) -- 0:02:55
155000 -- [-1937.501] (-1939.209) (-1943.367) (-1941.270) * (-1939.158) (-1938.389) [-1933.883] (-1940.141) -- 0:02:54
Average standard deviation of split frequencies: 0.000000
155500 -- (-1933.501) (-1938.479) [-1932.035] (-1935.805) * (-1939.672) [-1932.479] (-1937.513) (-1940.348) -- 0:02:53
156000 -- (-1931.141) [-1940.648] (-1933.743) (-1935.195) * (-1936.266) (-1939.551) (-1930.352) [-1938.203] -- 0:02:53
156500 -- (-1937.245) (-1934.045) [-1938.072] (-1937.596) * [-1935.853] (-1936.329) (-1933.170) (-1935.247) -- 0:02:52
157000 -- (-1938.928) (-1937.513) (-1936.759) [-1933.883] * [-1931.368] (-1935.148) (-1937.031) (-1941.500) -- 0:02:57
157500 -- [-1932.730] (-1933.445) (-1939.846) (-1933.263) * [-1934.429] (-1937.792) (-1934.067) (-1938.513) -- 0:02:56
158000 -- [-1930.090] (-1933.300) (-1935.334) (-1934.322) * (-1938.490) (-1938.581) [-1938.531] (-1940.650) -- 0:02:55
158500 -- (-1938.625) (-1944.218) (-1937.895) [-1936.445] * (-1938.328) (-1936.619) [-1934.916] (-1939.841) -- 0:02:55
159000 -- (-1934.172) [-1941.492] (-1936.810) (-1941.230) * (-1936.490) (-1950.140) (-1930.829) [-1935.425] -- 0:02:54
159500 -- (-1938.153) (-1934.703) (-1937.769) [-1934.357] * (-1935.692) [-1944.060] (-1937.579) (-1936.352) -- 0:02:53
160000 -- (-1941.011) (-1945.450) (-1939.518) [-1931.451] * [-1934.702] (-1939.148) (-1935.598) (-1931.149) -- 0:02:53
Average standard deviation of split frequencies: 0.000000
160500 -- [-1931.821] (-1930.832) (-1935.440) (-1935.165) * (-1932.700) (-1937.910) (-1932.806) [-1931.224] -- 0:02:52
161000 -- (-1934.669) (-1940.101) (-1936.205) [-1933.043] * (-1936.696) [-1938.677] (-1935.026) (-1940.559) -- 0:02:57
161500 -- (-1943.556) (-1937.275) [-1933.872] (-1936.330) * [-1932.201] (-1942.700) (-1939.352) (-1933.575) -- 0:02:56
162000 -- (-1932.810) [-1934.947] (-1933.347) (-1936.192) * (-1941.383) [-1933.710] (-1936.163) (-1934.796) -- 0:02:55
162500 -- [-1935.459] (-1934.808) (-1936.502) (-1934.586) * [-1938.330] (-1932.235) (-1937.372) (-1947.577) -- 0:02:55
163000 -- (-1930.945) (-1935.820) (-1936.111) [-1937.785] * (-1931.254) [-1934.539] (-1937.028) (-1935.402) -- 0:02:54
163500 -- (-1939.206) [-1941.230] (-1933.755) (-1934.316) * (-1932.481) (-1935.460) (-1936.587) [-1933.247] -- 0:02:53
164000 -- [-1938.041] (-1935.234) (-1936.051) (-1932.517) * (-1934.242) (-1937.633) (-1939.751) [-1937.948] -- 0:02:53
164500 -- (-1939.668) [-1937.383] (-1945.004) (-1935.741) * (-1933.773) (-1941.780) [-1934.300] (-1934.660) -- 0:02:52
165000 -- (-1937.615) (-1935.378) [-1936.661] (-1933.628) * [-1932.515] (-1949.272) (-1932.667) (-1931.541) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
165500 -- (-1938.933) (-1938.128) (-1944.151) [-1930.740] * (-1935.056) (-1937.446) [-1934.453] (-1932.967) -- 0:02:51
166000 -- (-1940.529) (-1931.896) (-1930.866) [-1933.922] * (-1933.734) (-1936.785) (-1933.158) [-1937.854] -- 0:02:55
166500 -- (-1937.837) (-1934.798) [-1932.931] (-1934.349) * (-1935.566) [-1934.043] (-1933.891) (-1934.074) -- 0:02:55
167000 -- (-1935.425) (-1939.507) [-1938.236] (-1933.312) * (-1935.626) (-1932.252) [-1931.468] (-1931.989) -- 0:02:54
167500 -- [-1940.283] (-1945.134) (-1932.777) (-1934.750) * (-1935.470) (-1934.917) (-1932.936) [-1930.056] -- 0:02:53
168000 -- [-1931.273] (-1935.496) (-1932.289) (-1933.559) * (-1933.915) [-1936.435] (-1936.443) (-1934.236) -- 0:02:53
168500 -- (-1940.139) (-1941.544) (-1932.831) [-1933.660] * [-1929.965] (-1935.065) (-1938.820) (-1937.924) -- 0:02:52
169000 -- (-1938.198) [-1937.794] (-1940.841) (-1931.893) * (-1931.892) (-1938.219) (-1935.914) [-1933.734] -- 0:02:52
169500 -- [-1933.870] (-1943.637) (-1943.312) (-1937.904) * (-1935.346) (-1948.557) (-1948.695) [-1932.307] -- 0:02:51
170000 -- (-1933.009) [-1935.584] (-1931.182) (-1939.168) * [-1938.445] (-1934.707) (-1938.130) (-1934.404) -- 0:02:50
Average standard deviation of split frequencies: 0.000000
170500 -- [-1930.961] (-1937.336) (-1933.369) (-1935.353) * (-1938.582) (-1931.831) [-1930.195] (-1934.111) -- 0:02:50
171000 -- [-1934.605] (-1932.483) (-1941.310) (-1934.585) * (-1938.343) (-1934.974) (-1933.041) [-1933.094] -- 0:02:54
171500 -- (-1935.984) (-1936.460) [-1933.491] (-1936.542) * [-1938.276] (-1933.455) (-1935.924) (-1934.049) -- 0:02:53
172000 -- [-1932.622] (-1932.624) (-1936.250) (-1934.386) * (-1937.059) (-1935.356) (-1932.288) [-1936.021] -- 0:02:53
172500 -- (-1937.124) [-1932.284] (-1934.849) (-1935.747) * (-1939.861) (-1935.436) [-1933.867] (-1938.442) -- 0:02:52
173000 -- (-1934.862) [-1931.909] (-1939.181) (-1932.025) * [-1937.979] (-1930.480) (-1934.316) (-1940.174) -- 0:02:52
173500 -- [-1938.217] (-1940.735) (-1940.441) (-1935.448) * (-1938.012) (-1938.935) (-1937.388) [-1934.935] -- 0:02:51
174000 -- (-1941.692) [-1938.027] (-1936.716) (-1935.002) * [-1937.796] (-1934.391) (-1932.462) (-1936.790) -- 0:02:50
174500 -- (-1943.883) (-1932.191) (-1934.717) [-1937.620] * [-1937.415] (-1934.337) (-1942.999) (-1938.135) -- 0:02:50
175000 -- (-1936.225) (-1935.849) (-1938.099) [-1935.853] * (-1937.877) (-1940.366) [-1933.822] (-1941.102) -- 0:02:49
Average standard deviation of split frequencies: 0.000000
175500 -- [-1935.004] (-1933.142) (-1935.092) (-1934.055) * (-1935.043) (-1941.844) [-1935.307] (-1939.865) -- 0:02:49
176000 -- (-1938.202) (-1936.157) (-1938.206) [-1933.832] * (-1942.664) (-1936.759) (-1939.748) [-1939.095] -- 0:02:53
176500 -- (-1933.274) (-1936.235) [-1932.132] (-1935.141) * [-1937.721] (-1944.728) (-1937.952) (-1939.859) -- 0:02:52
177000 -- (-1935.425) (-1940.188) [-1935.189] (-1937.242) * [-1940.230] (-1946.505) (-1928.978) (-1937.213) -- 0:02:52
177500 -- (-1937.057) [-1937.277] (-1937.490) (-1933.615) * (-1942.375) [-1932.264] (-1934.459) (-1945.142) -- 0:02:51
178000 -- (-1933.416) (-1931.169) [-1932.126] (-1935.052) * [-1938.792] (-1932.218) (-1945.235) (-1943.197) -- 0:02:50
178500 -- (-1938.052) [-1935.649] (-1939.274) (-1935.203) * (-1936.483) (-1938.431) [-1934.165] (-1940.383) -- 0:02:50
179000 -- [-1933.397] (-1936.493) (-1935.452) (-1939.349) * (-1942.451) (-1931.401) [-1931.867] (-1936.909) -- 0:02:49
179500 -- [-1931.854] (-1936.546) (-1934.281) (-1939.466) * (-1937.494) (-1932.725) [-1930.429] (-1938.730) -- 0:02:49
180000 -- [-1934.435] (-1935.106) (-1935.134) (-1931.693) * [-1935.395] (-1934.237) (-1936.473) (-1931.382) -- 0:02:48
Average standard deviation of split frequencies: 0.000000
180500 -- (-1933.654) (-1937.786) (-1932.651) [-1933.535] * (-1933.752) [-1941.174] (-1934.482) (-1934.724) -- 0:02:47
181000 -- (-1943.899) (-1946.536) [-1929.225] (-1933.663) * [-1933.672] (-1937.735) (-1931.900) (-1933.627) -- 0:02:51
181500 -- (-1943.096) (-1938.165) [-1932.576] (-1938.262) * [-1931.951] (-1937.807) (-1937.970) (-1942.278) -- 0:02:51
182000 -- (-1940.370) [-1941.246] (-1937.480) (-1933.947) * (-1934.793) (-1931.593) [-1935.148] (-1933.973) -- 0:02:50
182500 -- [-1937.174] (-1933.155) (-1934.941) (-1935.946) * (-1932.296) (-1933.910) [-1939.514] (-1937.810) -- 0:02:50
183000 -- [-1937.590] (-1935.482) (-1932.652) (-1936.587) * (-1934.325) (-1933.960) [-1935.718] (-1936.906) -- 0:02:49
183500 -- (-1936.879) [-1936.854] (-1934.074) (-1934.600) * (-1939.400) (-1938.049) [-1933.593] (-1939.443) -- 0:02:49
184000 -- [-1937.013] (-1940.964) (-1935.806) (-1931.032) * (-1936.873) (-1934.334) [-1933.520] (-1932.195) -- 0:02:48
184500 -- (-1942.447) (-1940.821) (-1935.643) [-1938.863] * (-1942.865) (-1936.408) (-1934.275) [-1935.544] -- 0:02:47
185000 -- (-1935.748) (-1939.067) (-1934.320) [-1933.686] * (-1934.124) (-1937.979) [-1935.234] (-1946.602) -- 0:02:47
Average standard deviation of split frequencies: 0.000000
185500 -- [-1932.143] (-1937.110) (-1933.792) (-1935.519) * (-1932.924) [-1934.885] (-1939.344) (-1941.651) -- 0:02:46
186000 -- (-1934.025) [-1936.782] (-1937.909) (-1934.694) * (-1933.932) (-1933.351) (-1939.078) [-1934.602] -- 0:02:50
186500 -- (-1934.637) (-1936.092) (-1936.484) [-1935.928] * (-1936.859) (-1933.593) [-1936.879] (-1935.026) -- 0:02:50
187000 -- (-1933.830) [-1934.935] (-1938.364) (-1934.073) * (-1932.186) (-1935.603) (-1939.091) [-1933.417] -- 0:02:49
187500 -- [-1932.879] (-1941.344) (-1939.091) (-1934.336) * (-1931.908) (-1934.439) [-1940.208] (-1928.192) -- 0:02:49
188000 -- (-1936.396) (-1942.231) [-1934.919] (-1937.831) * (-1933.968) (-1935.567) [-1938.188] (-1929.468) -- 0:02:48
188500 -- (-1936.590) (-1945.575) (-1941.906) [-1941.017] * (-1935.006) (-1935.241) (-1939.835) [-1935.790] -- 0:02:47
189000 -- [-1930.920] (-1945.043) (-1935.383) (-1936.577) * (-1936.076) (-1938.205) (-1936.859) [-1935.396] -- 0:02:47
189500 -- (-1931.875) (-1939.538) (-1931.723) [-1933.609] * [-1937.207] (-1932.466) (-1933.682) (-1939.976) -- 0:02:46
190000 -- [-1935.073] (-1938.207) (-1932.993) (-1931.297) * (-1939.701) [-1936.280] (-1935.426) (-1936.397) -- 0:02:46
Average standard deviation of split frequencies: 0.000000
190500 -- (-1934.580) [-1936.577] (-1936.222) (-1941.462) * (-1931.906) (-1938.036) (-1931.957) [-1933.916] -- 0:02:45
191000 -- [-1937.417] (-1937.881) (-1936.318) (-1931.282) * (-1935.011) [-1932.356] (-1936.647) (-1935.703) -- 0:02:49
191500 -- [-1939.342] (-1945.342) (-1936.577) (-1934.500) * (-1937.713) (-1942.616) [-1934.963] (-1938.888) -- 0:02:48
192000 -- (-1949.715) [-1932.293] (-1936.638) (-1941.527) * (-1937.383) (-1937.529) [-1932.439] (-1938.094) -- 0:02:48
192500 -- (-1935.085) (-1935.024) (-1934.160) [-1937.785] * (-1932.558) (-1941.561) [-1936.339] (-1938.187) -- 0:02:47
193000 -- [-1935.204] (-1939.952) (-1942.179) (-1932.995) * (-1938.595) (-1935.669) (-1939.580) [-1932.006] -- 0:02:47
193500 -- (-1934.702) (-1938.280) [-1946.840] (-1939.006) * (-1936.502) (-1935.061) [-1932.415] (-1940.823) -- 0:02:46
194000 -- [-1933.193] (-1935.894) (-1938.793) (-1933.164) * (-1931.852) [-1939.540] (-1931.170) (-1935.998) -- 0:02:46
194500 -- (-1933.140) (-1936.536) [-1936.080] (-1932.895) * (-1938.676) [-1930.163] (-1935.822) (-1937.848) -- 0:02:45
195000 -- (-1936.233) [-1932.375] (-1936.619) (-1934.089) * (-1935.349) (-1930.010) [-1939.295] (-1936.146) -- 0:02:45
Average standard deviation of split frequencies: 0.000000
195500 -- (-1937.449) (-1930.881) [-1933.040] (-1940.301) * (-1935.122) (-1931.367) (-1942.110) [-1938.743] -- 0:02:44
196000 -- (-1937.036) (-1936.621) (-1933.623) [-1936.990] * (-1932.314) (-1937.633) [-1936.731] (-1936.471) -- 0:02:48
196500 -- (-1934.027) [-1934.183] (-1935.761) (-1937.548) * (-1937.585) [-1932.936] (-1944.345) (-1937.677) -- 0:02:47
197000 -- (-1940.177) [-1934.084] (-1932.247) (-1941.888) * (-1932.662) (-1934.222) [-1932.786] (-1941.749) -- 0:02:47
197500 -- [-1933.466] (-1934.591) (-1939.181) (-1937.152) * [-1934.950] (-1937.298) (-1932.370) (-1939.327) -- 0:02:46
198000 -- (-1934.297) (-1938.916) (-1930.317) [-1936.013] * (-1937.829) (-1935.297) [-1933.883] (-1936.612) -- 0:02:46
198500 -- [-1939.328] (-1935.169) (-1939.478) (-1933.185) * (-1939.791) (-1936.914) (-1936.119) [-1939.620] -- 0:02:45
199000 -- [-1935.471] (-1938.250) (-1934.964) (-1940.331) * (-1936.407) [-1933.817] (-1937.561) (-1936.875) -- 0:02:45
199500 -- (-1940.324) [-1935.481] (-1944.304) (-1933.447) * (-1933.766) [-1933.149] (-1935.380) (-1936.047) -- 0:02:44
200000 -- (-1942.309) [-1934.113] (-1940.450) (-1936.982) * (-1936.136) (-1930.820) [-1932.813] (-1934.784) -- 0:02:44
Average standard deviation of split frequencies: 0.000000
200500 -- (-1942.285) [-1933.428] (-1945.469) (-1935.612) * (-1942.193) (-1937.467) (-1933.182) [-1934.592] -- 0:02:43
201000 -- (-1933.142) (-1932.576) (-1941.635) [-1937.599] * (-1937.954) (-1935.917) [-1935.625] (-1937.702) -- 0:02:46
201500 -- (-1934.655) [-1934.068] (-1937.213) (-1939.544) * [-1934.539] (-1934.422) (-1944.464) (-1933.814) -- 0:02:46
202000 -- (-1939.918) [-1931.301] (-1935.084) (-1931.763) * [-1941.574] (-1940.184) (-1940.423) (-1942.782) -- 0:02:45
202500 -- (-1933.660) [-1935.540] (-1933.133) (-1930.962) * (-1935.039) [-1936.455] (-1930.475) (-1941.190) -- 0:02:45
203000 -- (-1942.666) (-1938.254) (-1941.476) [-1940.996] * [-1935.694] (-1941.658) (-1937.980) (-1941.662) -- 0:02:44
203500 -- (-1940.301) (-1934.623) (-1941.520) [-1939.035] * [-1932.414] (-1934.093) (-1938.845) (-1941.327) -- 0:02:44
204000 -- (-1934.443) (-1942.450) (-1940.825) [-1935.865] * [-1932.795] (-1933.384) (-1937.986) (-1940.173) -- 0:02:43
204500 -- (-1933.473) (-1931.094) (-1940.083) [-1935.792] * [-1934.787] (-1935.821) (-1931.654) (-1940.269) -- 0:02:43
205000 -- (-1935.966) (-1935.327) (-1942.254) [-1938.626] * (-1933.770) [-1934.076] (-1930.477) (-1936.744) -- 0:02:42
Average standard deviation of split frequencies: 0.000000
205500 -- [-1936.065] (-1933.850) (-1934.111) (-1935.200) * (-1932.569) (-1935.218) (-1928.378) [-1934.484] -- 0:02:42
206000 -- (-1939.538) [-1931.092] (-1941.240) (-1931.728) * (-1934.961) [-1936.675] (-1932.955) (-1936.525) -- 0:02:45
206500 -- (-1941.596) (-1936.694) (-1934.769) [-1932.509] * (-1941.476) (-1935.233) (-1940.270) [-1937.411] -- 0:02:45
207000 -- (-1940.523) [-1936.530] (-1938.159) (-1939.907) * (-1936.722) [-1934.269] (-1932.684) (-1934.020) -- 0:02:44
207500 -- (-1938.705) (-1936.615) [-1933.189] (-1938.507) * (-1933.544) (-1936.394) [-1944.323] (-1940.802) -- 0:02:44
208000 -- (-1942.588) [-1936.279] (-1938.197) (-1934.025) * (-1936.795) [-1938.745] (-1940.827) (-1937.283) -- 0:02:43
208500 -- (-1943.750) (-1934.572) (-1932.695) [-1934.285] * [-1936.466] (-1937.252) (-1936.261) (-1934.062) -- 0:02:43
209000 -- (-1952.101) [-1938.853] (-1938.516) (-1937.449) * (-1935.623) [-1934.647] (-1940.392) (-1937.340) -- 0:02:42
209500 -- (-1941.009) (-1935.677) [-1940.538] (-1933.700) * (-1939.494) [-1929.850] (-1944.112) (-1936.732) -- 0:02:42
210000 -- (-1939.724) [-1937.678] (-1934.532) (-1948.485) * (-1936.916) [-1932.678] (-1934.178) (-1937.958) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
210500 -- (-1941.460) (-1938.692) [-1934.118] (-1933.603) * [-1936.065] (-1939.932) (-1933.416) (-1935.757) -- 0:02:41
211000 -- [-1943.110] (-1940.906) (-1932.635) (-1935.168) * (-1936.391) (-1937.070) (-1942.845) [-1932.683] -- 0:02:44
211500 -- (-1937.191) (-1941.807) (-1936.198) [-1935.978] * (-1941.814) (-1935.735) (-1937.178) [-1939.225] -- 0:02:44
212000 -- (-1936.794) (-1937.551) (-1935.647) [-1934.059] * (-1945.071) [-1938.650] (-1938.169) (-1939.464) -- 0:02:43
212500 -- [-1936.050] (-1937.928) (-1932.576) (-1933.432) * (-1935.179) (-1939.631) (-1932.880) [-1934.337] -- 0:02:43
213000 -- (-1942.210) (-1939.555) [-1933.279] (-1937.728) * (-1935.463) (-1940.354) [-1935.892] (-1940.130) -- 0:02:42
213500 -- (-1937.283) (-1934.026) [-1940.007] (-1931.185) * [-1945.647] (-1932.206) (-1934.025) (-1930.292) -- 0:02:42
214000 -- [-1936.651] (-1937.377) (-1939.022) (-1940.232) * (-1942.225) [-1935.598] (-1939.691) (-1933.468) -- 0:02:41
214500 -- (-1931.602) [-1938.755] (-1933.148) (-1937.841) * (-1941.536) (-1933.543) (-1936.622) [-1937.471] -- 0:02:41
215000 -- [-1934.867] (-1934.992) (-1945.433) (-1935.352) * (-1934.954) [-1933.124] (-1936.656) (-1935.499) -- 0:02:40
Average standard deviation of split frequencies: 0.000000
215500 -- (-1935.461) [-1934.548] (-1942.430) (-1935.913) * (-1938.845) [-1935.235] (-1934.757) (-1935.913) -- 0:02:40
216000 -- (-1936.673) (-1937.304) (-1940.006) [-1932.293] * (-1939.047) [-1936.432] (-1939.409) (-1934.846) -- 0:02:43
216500 -- (-1931.752) (-1936.486) (-1938.287) [-1942.300] * [-1936.264] (-1933.325) (-1935.624) (-1938.781) -- 0:02:42
217000 -- [-1937.384] (-1933.520) (-1938.844) (-1937.607) * [-1935.856] (-1931.888) (-1940.043) (-1938.354) -- 0:02:42
217500 -- (-1934.794) [-1932.307] (-1941.442) (-1935.280) * (-1942.294) (-1937.853) [-1943.542] (-1934.820) -- 0:02:41
218000 -- [-1930.138] (-1935.420) (-1935.198) (-1937.022) * (-1938.267) [-1931.277] (-1939.917) (-1936.697) -- 0:02:41
218500 -- (-1932.530) [-1934.167] (-1936.301) (-1939.229) * (-1936.731) (-1937.173) [-1933.502] (-1933.949) -- 0:02:40
219000 -- [-1934.640] (-1930.924) (-1937.339) (-1936.078) * (-1939.243) (-1936.530) [-1936.961] (-1937.022) -- 0:02:40
219500 -- (-1937.619) (-1934.526) (-1935.062) [-1934.633] * (-1937.461) (-1936.908) [-1935.335] (-1930.377) -- 0:02:40
220000 -- (-1940.693) [-1930.482] (-1942.003) (-1942.516) * (-1934.851) [-1933.110] (-1937.935) (-1930.851) -- 0:02:39
Average standard deviation of split frequencies: 0.000000
220500 -- (-1945.828) [-1936.214] (-1945.409) (-1939.621) * (-1935.207) (-1931.853) (-1938.558) [-1936.810] -- 0:02:39
221000 -- (-1942.487) (-1938.605) [-1938.267] (-1934.902) * [-1941.260] (-1935.132) (-1931.614) (-1937.729) -- 0:02:42
221500 -- [-1933.824] (-1941.003) (-1940.486) (-1935.458) * (-1934.648) [-1931.146] (-1940.468) (-1939.431) -- 0:02:41
222000 -- (-1936.804) (-1936.616) (-1939.281) [-1936.451] * [-1931.762] (-1936.193) (-1944.125) (-1941.046) -- 0:02:41
222500 -- [-1934.957] (-1937.901) (-1938.321) (-1934.560) * [-1932.841] (-1952.430) (-1934.536) (-1940.703) -- 0:02:40
223000 -- (-1934.060) [-1938.113] (-1937.949) (-1936.606) * (-1937.089) (-1941.614) (-1931.444) [-1933.247] -- 0:02:40
223500 -- (-1935.493) (-1942.585) [-1932.999] (-1939.961) * [-1933.283] (-1945.354) (-1932.375) (-1933.304) -- 0:02:39
224000 -- [-1934.808] (-1944.471) (-1934.923) (-1938.051) * [-1931.694] (-1935.715) (-1932.245) (-1939.255) -- 0:02:39
224500 -- [-1937.166] (-1941.678) (-1934.506) (-1937.914) * [-1934.361] (-1938.659) (-1934.596) (-1935.211) -- 0:02:38
225000 -- [-1941.850] (-1942.584) (-1932.627) (-1939.785) * (-1942.283) [-1936.220] (-1934.500) (-1940.355) -- 0:02:38
Average standard deviation of split frequencies: 0.000000
225500 -- [-1938.407] (-1938.715) (-1934.384) (-1942.541) * (-1937.931) [-1937.397] (-1936.944) (-1933.971) -- 0:02:37
226000 -- [-1936.803] (-1937.713) (-1935.904) (-1938.590) * (-1939.712) (-1942.761) [-1932.209] (-1936.025) -- 0:02:40
226500 -- (-1936.062) [-1939.993] (-1941.582) (-1935.942) * (-1931.983) (-1937.162) [-1933.849] (-1931.032) -- 0:02:40
227000 -- (-1941.171) (-1933.590) (-1935.514) [-1935.912] * [-1935.728] (-1934.330) (-1939.756) (-1940.533) -- 0:02:40
227500 -- (-1940.199) (-1934.331) [-1932.893] (-1936.339) * (-1937.230) (-1935.547) (-1933.078) [-1935.291] -- 0:02:39
228000 -- (-1938.191) (-1933.616) [-1935.525] (-1933.506) * (-1935.127) [-1931.633] (-1933.494) (-1938.540) -- 0:02:39
228500 -- (-1934.840) (-1935.711) (-1937.320) [-1936.492] * [-1932.946] (-1934.623) (-1930.496) (-1935.880) -- 0:02:38
229000 -- [-1930.838] (-1936.572) (-1938.608) (-1929.763) * (-1938.085) (-1934.980) (-1932.860) [-1933.674] -- 0:02:38
229500 -- [-1934.040] (-1932.712) (-1937.823) (-1934.503) * [-1938.074] (-1934.109) (-1929.634) (-1939.771) -- 0:02:37
230000 -- (-1937.870) [-1935.893] (-1938.757) (-1945.324) * (-1936.447) [-1937.876] (-1936.209) (-1941.506) -- 0:02:37
Average standard deviation of split frequencies: 0.000000
230500 -- (-1934.332) (-1930.450) [-1943.617] (-1933.767) * [-1939.794] (-1937.278) (-1938.566) (-1935.426) -- 0:02:36
231000 -- (-1939.647) [-1934.026] (-1950.976) (-1941.731) * (-1934.460) (-1930.885) [-1935.352] (-1934.190) -- 0:02:39
231500 -- (-1933.036) (-1935.563) [-1935.864] (-1940.216) * (-1944.630) [-1934.621] (-1935.663) (-1931.703) -- 0:02:39
232000 -- [-1935.090] (-1934.907) (-1934.031) (-1933.347) * (-1933.598) (-1940.390) (-1936.546) [-1934.761] -- 0:02:38
232500 -- (-1932.992) (-1935.353) [-1932.319] (-1937.985) * (-1928.313) [-1939.035] (-1942.064) (-1935.405) -- 0:02:38
233000 -- (-1932.440) (-1935.599) [-1931.999] (-1933.620) * (-1937.850) [-1932.920] (-1939.974) (-1936.958) -- 0:02:38
233500 -- (-1934.303) [-1934.360] (-1935.126) (-1941.379) * [-1932.864] (-1933.771) (-1935.773) (-1931.316) -- 0:02:37
234000 -- (-1936.962) [-1937.588] (-1936.599) (-1937.311) * [-1934.110] (-1932.004) (-1932.897) (-1931.868) -- 0:02:37
234500 -- (-1935.272) (-1943.401) (-1933.521) [-1937.298] * (-1943.332) [-1932.764] (-1936.721) (-1934.695) -- 0:02:36
235000 -- (-1934.200) [-1936.180] (-1937.679) (-1945.290) * [-1935.906] (-1940.135) (-1942.322) (-1941.075) -- 0:02:36
Average standard deviation of split frequencies: 0.000000
235500 -- (-1935.370) (-1933.287) [-1932.153] (-1935.943) * (-1943.317) (-1932.707) [-1935.354] (-1939.889) -- 0:02:39
236000 -- (-1941.382) (-1935.232) [-1930.085] (-1940.722) * [-1933.093] (-1935.680) (-1939.631) (-1937.347) -- 0:02:38
236500 -- (-1936.338) (-1935.951) [-1931.460] (-1941.680) * (-1934.753) [-1933.684] (-1938.250) (-1935.195) -- 0:02:38
237000 -- [-1939.816] (-1933.737) (-1938.974) (-1935.829) * (-1934.067) (-1936.007) (-1938.949) [-1932.525] -- 0:02:37
237500 -- (-1936.738) (-1941.583) (-1944.745) [-1933.802] * (-1939.104) (-1935.507) (-1943.323) [-1936.793] -- 0:02:37
238000 -- (-1933.431) [-1944.918] (-1940.772) (-1931.621) * (-1931.300) (-1934.904) (-1938.209) [-1936.351] -- 0:02:36
238500 -- (-1936.963) [-1937.626] (-1937.461) (-1933.592) * [-1937.812] (-1934.305) (-1935.776) (-1934.738) -- 0:02:36
239000 -- (-1936.636) (-1936.186) (-1938.130) [-1935.720] * (-1937.740) [-1933.366] (-1937.152) (-1942.422) -- 0:02:36
239500 -- (-1932.952) (-1934.804) [-1936.371] (-1936.530) * (-1935.832) (-1930.331) [-1932.920] (-1937.023) -- 0:02:35
240000 -- (-1932.039) (-1936.926) [-1935.530] (-1936.774) * (-1938.316) (-1932.313) (-1936.828) [-1931.836] -- 0:02:35
Average standard deviation of split frequencies: 0.000000
240500 -- (-1936.202) [-1937.676] (-1938.710) (-1935.924) * (-1936.245) (-1943.228) [-1937.566] (-1935.425) -- 0:02:37
241000 -- [-1938.459] (-1936.800) (-1947.538) (-1938.414) * (-1936.585) (-1933.837) (-1944.842) [-1933.712] -- 0:02:37
241500 -- (-1934.385) (-1940.528) [-1936.439] (-1945.610) * (-1936.230) (-1934.631) [-1932.601] (-1942.284) -- 0:02:37
242000 -- (-1934.933) [-1938.127] (-1938.441) (-1939.767) * (-1933.082) (-1933.687) [-1935.039] (-1934.890) -- 0:02:36
242500 -- (-1936.210) (-1933.773) [-1934.688] (-1941.075) * (-1935.084) (-1939.112) [-1935.160] (-1937.583) -- 0:02:36
243000 -- [-1934.011] (-1934.235) (-1937.931) (-1931.422) * (-1940.067) [-1934.988] (-1939.824) (-1938.622) -- 0:02:35
243500 -- [-1938.522] (-1939.360) (-1934.723) (-1935.546) * (-1943.835) (-1930.228) (-1933.161) [-1931.929] -- 0:02:35
244000 -- (-1934.397) (-1933.060) (-1941.763) [-1935.710] * (-1939.319) (-1934.268) [-1932.252] (-1933.039) -- 0:02:34
244500 -- (-1937.898) [-1932.552] (-1940.890) (-1934.362) * [-1933.638] (-1938.467) (-1934.524) (-1935.997) -- 0:02:34
245000 -- (-1935.827) (-1936.446) (-1932.101) [-1932.691] * (-1934.714) (-1938.641) (-1935.232) [-1936.185] -- 0:02:34
Average standard deviation of split frequencies: 0.000000
245500 -- (-1940.968) (-1933.523) [-1934.009] (-1941.556) * [-1932.929] (-1941.878) (-1932.819) (-1936.814) -- 0:02:36
246000 -- (-1931.572) [-1934.656] (-1934.338) (-1936.054) * [-1940.876] (-1935.806) (-1936.140) (-1933.535) -- 0:02:36
246500 -- [-1931.817] (-1933.217) (-1938.317) (-1934.503) * (-1932.459) [-1935.403] (-1939.470) (-1933.693) -- 0:02:35
247000 -- (-1931.682) [-1931.774] (-1935.094) (-1935.813) * (-1931.895) [-1938.159] (-1931.716) (-1929.821) -- 0:02:35
247500 -- (-1943.284) (-1934.419) (-1933.503) [-1938.258] * (-1939.258) [-1934.169] (-1936.005) (-1935.879) -- 0:02:35
248000 -- (-1940.117) (-1935.934) [-1936.207] (-1937.493) * (-1937.695) [-1935.741] (-1942.615) (-1935.703) -- 0:02:34
248500 -- (-1942.283) [-1934.126] (-1938.402) (-1940.181) * (-1938.476) (-1935.715) [-1942.695] (-1932.399) -- 0:02:34
249000 -- [-1936.140] (-1937.450) (-1934.788) (-1935.012) * (-1937.876) (-1934.897) (-1937.333) [-1934.197] -- 0:02:33
249500 -- (-1934.313) (-1934.837) [-1935.708] (-1931.924) * (-1937.442) (-1938.401) (-1941.732) [-1934.822] -- 0:02:33
250000 -- (-1933.275) [-1931.512] (-1936.836) (-1942.852) * [-1935.748] (-1944.879) (-1934.565) (-1933.647) -- 0:02:33
Average standard deviation of split frequencies: 0.000000
250500 -- (-1936.726) (-1936.029) (-1934.052) [-1932.507] * (-1931.785) (-1939.048) [-1935.165] (-1937.724) -- 0:02:35
251000 -- (-1936.690) (-1939.094) [-1930.641] (-1939.428) * (-1933.598) (-1940.266) [-1934.916] (-1940.509) -- 0:02:35
251500 -- (-1930.951) (-1933.418) (-1930.873) [-1938.087] * (-1933.859) (-1935.148) (-1937.507) [-1937.383] -- 0:02:34
252000 -- [-1933.876] (-1931.843) (-1935.512) (-1937.921) * [-1934.235] (-1935.285) (-1936.100) (-1935.336) -- 0:02:34
252500 -- [-1933.982] (-1931.638) (-1940.763) (-1941.648) * (-1934.421) [-1932.795] (-1931.939) (-1934.142) -- 0:02:33
253000 -- (-1935.510) [-1930.209] (-1945.514) (-1943.042) * (-1942.765) (-1935.818) (-1932.818) [-1933.665] -- 0:02:33
253500 -- (-1933.830) [-1933.681] (-1941.788) (-1941.873) * (-1939.225) [-1932.889] (-1934.792) (-1931.898) -- 0:02:33
254000 -- (-1938.637) [-1938.502] (-1939.180) (-1934.206) * (-1937.376) (-1935.117) (-1936.506) [-1936.956] -- 0:02:32
254500 -- (-1938.771) [-1932.711] (-1941.632) (-1939.192) * [-1934.420] (-1935.969) (-1936.287) (-1933.237) -- 0:02:32
255000 -- [-1937.483] (-1939.639) (-1936.956) (-1934.295) * (-1930.994) [-1931.407] (-1938.642) (-1933.543) -- 0:02:31
Average standard deviation of split frequencies: 0.000000
255500 -- (-1936.871) [-1938.540] (-1934.525) (-1937.778) * [-1934.351] (-1938.700) (-1938.878) (-1931.705) -- 0:02:34
256000 -- (-1934.530) (-1934.763) (-1936.855) [-1934.971] * (-1930.190) (-1944.094) (-1943.613) [-1933.974] -- 0:02:34
256500 -- (-1931.831) [-1931.431] (-1931.639) (-1938.894) * [-1940.614] (-1938.922) (-1933.984) (-1934.298) -- 0:02:33
257000 -- (-1937.322) [-1931.856] (-1938.831) (-1934.041) * (-1940.170) (-1938.191) [-1934.236] (-1932.957) -- 0:02:33
257500 -- (-1934.235) (-1939.837) (-1938.399) [-1932.018] * [-1939.799] (-1941.351) (-1932.320) (-1936.202) -- 0:02:32
258000 -- [-1930.935] (-1933.203) (-1937.404) (-1932.570) * (-1940.436) [-1939.862] (-1935.944) (-1939.118) -- 0:02:32
258500 -- (-1933.244) (-1934.165) (-1932.951) [-1937.759] * (-1941.314) (-1939.851) [-1934.664] (-1935.119) -- 0:02:32
259000 -- (-1932.845) (-1937.505) [-1935.977] (-1942.864) * [-1932.489] (-1933.547) (-1935.534) (-1931.840) -- 0:02:31
259500 -- (-1936.839) (-1949.822) (-1936.748) [-1932.640] * (-1934.919) [-1932.216] (-1936.415) (-1936.950) -- 0:02:31
260000 -- (-1936.210) [-1937.609] (-1938.533) (-1941.526) * (-1936.818) [-1934.022] (-1940.317) (-1937.808) -- 0:02:30
Average standard deviation of split frequencies: 0.000000
260500 -- [-1933.005] (-1934.025) (-1933.837) (-1945.387) * (-1931.880) [-1930.388] (-1942.023) (-1935.132) -- 0:02:33
261000 -- (-1939.929) (-1938.683) (-1933.979) [-1933.683] * [-1937.891] (-1936.375) (-1938.970) (-1931.636) -- 0:02:32
261500 -- (-1942.864) [-1941.743] (-1931.694) (-1936.467) * (-1933.213) (-1936.863) (-1934.783) [-1935.729] -- 0:02:32
262000 -- (-1942.092) (-1943.649) [-1932.805] (-1942.147) * (-1934.832) (-1935.367) [-1935.952] (-1935.682) -- 0:02:32
262500 -- (-1950.731) (-1946.001) (-1932.369) [-1932.286] * (-1932.950) (-1936.596) [-1939.127] (-1937.599) -- 0:02:31
263000 -- (-1957.777) [-1940.249] (-1931.463) (-1939.520) * (-1935.770) (-1937.377) (-1937.310) [-1934.701] -- 0:02:31
263500 -- (-1944.468) (-1933.266) [-1937.821] (-1943.615) * (-1942.032) (-1938.757) (-1930.459) [-1935.491] -- 0:02:30
264000 -- (-1945.498) [-1936.817] (-1940.051) (-1935.130) * (-1933.638) [-1937.636] (-1931.241) (-1937.148) -- 0:02:30
264500 -- (-1930.565) (-1935.770) (-1940.947) [-1937.630] * [-1938.467] (-1940.141) (-1935.592) (-1938.299) -- 0:02:30
265000 -- (-1932.037) (-1936.064) [-1933.878] (-1936.311) * (-1938.728) (-1946.711) [-1935.930] (-1935.878) -- 0:02:29
Average standard deviation of split frequencies: 0.000000
265500 -- (-1932.772) (-1942.303) (-1936.544) [-1934.733] * (-1942.210) (-1939.871) [-1936.113] (-1934.556) -- 0:02:32
266000 -- [-1935.718] (-1937.611) (-1938.674) (-1939.062) * (-1934.805) [-1937.685] (-1932.012) (-1934.950) -- 0:02:31
266500 -- [-1932.086] (-1934.267) (-1938.402) (-1931.235) * [-1931.827] (-1935.445) (-1937.491) (-1936.059) -- 0:02:31
267000 -- (-1940.167) (-1931.689) (-1944.269) [-1938.588] * (-1934.831) (-1934.511) (-1939.913) [-1931.261] -- 0:02:30
267500 -- (-1934.680) (-1934.784) [-1944.288] (-1932.751) * (-1935.350) (-1934.112) [-1933.189] (-1936.910) -- 0:02:30
268000 -- [-1932.782] (-1933.466) (-1936.621) (-1936.623) * (-1935.842) [-1931.207] (-1939.408) (-1933.079) -- 0:02:30
268500 -- (-1934.571) [-1930.968] (-1944.785) (-1933.061) * (-1934.812) (-1933.360) (-1931.469) [-1936.912] -- 0:02:29
269000 -- (-1937.256) [-1934.046] (-1940.546) (-1933.035) * (-1938.152) [-1933.280] (-1936.355) (-1940.278) -- 0:02:29
269500 -- (-1938.178) (-1942.949) [-1937.311] (-1937.031) * [-1941.192] (-1932.164) (-1935.810) (-1931.391) -- 0:02:29
270000 -- (-1950.791) (-1939.731) [-1935.095] (-1944.256) * [-1935.999] (-1935.276) (-1936.001) (-1933.001) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
270500 -- (-1941.491) (-1937.115) [-1933.784] (-1943.337) * [-1936.473] (-1939.538) (-1940.102) (-1934.804) -- 0:02:31
271000 -- (-1937.765) [-1934.251] (-1930.815) (-1936.369) * (-1936.950) (-1934.468) [-1935.873] (-1940.186) -- 0:02:30
271500 -- (-1937.703) (-1938.985) [-1939.122] (-1934.242) * (-1937.444) (-1937.281) (-1938.048) [-1938.302] -- 0:02:30
272000 -- (-1938.299) (-1929.890) (-1933.144) [-1929.183] * [-1932.915] (-1936.266) (-1943.706) (-1933.593) -- 0:02:29
272500 -- (-1935.702) [-1935.718] (-1935.775) (-1932.592) * (-1937.787) (-1941.462) [-1932.337] (-1943.449) -- 0:02:29
273000 -- (-1933.760) (-1934.449) [-1934.675] (-1938.845) * (-1938.080) (-1934.597) [-1936.480] (-1933.223) -- 0:02:29
273500 -- (-1937.379) (-1932.979) [-1932.955] (-1934.621) * (-1938.766) [-1929.950] (-1941.772) (-1933.955) -- 0:02:28
274000 -- (-1934.539) (-1932.053) [-1934.162] (-1938.042) * [-1932.226] (-1933.218) (-1935.022) (-1934.596) -- 0:02:28
274500 -- (-1938.072) (-1931.157) (-1932.257) [-1934.889] * (-1933.596) [-1938.520] (-1933.326) (-1931.228) -- 0:02:28
275000 -- [-1937.151] (-1940.849) (-1937.022) (-1934.886) * (-1934.510) [-1930.099] (-1933.410) (-1936.000) -- 0:02:27
Average standard deviation of split frequencies: 0.000000
275500 -- [-1935.487] (-1936.221) (-1942.967) (-1938.676) * (-1935.173) (-1933.430) (-1937.017) [-1930.864] -- 0:02:29
276000 -- (-1934.101) (-1938.062) (-1943.222) [-1939.751] * (-1936.377) [-1936.069] (-1937.186) (-1931.379) -- 0:02:29
276500 -- (-1936.476) (-1943.632) (-1935.075) [-1933.057] * (-1932.327) (-1931.997) (-1940.417) [-1930.441] -- 0:02:29
277000 -- (-1934.446) [-1933.840] (-1936.852) (-1933.905) * (-1935.136) (-1941.448) [-1933.286] (-1934.293) -- 0:02:28
277500 -- (-1942.292) [-1936.493] (-1936.636) (-1934.102) * (-1946.782) (-1937.059) (-1932.385) [-1933.342] -- 0:02:28
278000 -- (-1938.004) (-1932.330) [-1940.473] (-1934.303) * [-1941.978] (-1935.527) (-1934.343) (-1935.140) -- 0:02:28
278500 -- (-1932.699) [-1936.764] (-1940.057) (-1933.498) * [-1938.155] (-1937.510) (-1935.245) (-1941.025) -- 0:02:27
279000 -- (-1937.924) (-1931.198) [-1934.291] (-1942.715) * (-1938.770) (-1945.966) (-1935.061) [-1940.192] -- 0:02:27
279500 -- (-1932.899) [-1930.993] (-1939.645) (-1941.933) * (-1938.512) [-1938.443] (-1935.473) (-1945.485) -- 0:02:26
280000 -- (-1933.414) (-1934.135) (-1940.289) [-1935.726] * [-1942.558] (-1936.768) (-1937.964) (-1933.577) -- 0:02:26
Average standard deviation of split frequencies: 0.000000
280500 -- (-1934.614) [-1933.091] (-1932.492) (-1932.373) * [-1936.941] (-1939.626) (-1942.165) (-1931.315) -- 0:02:28
281000 -- (-1939.282) [-1932.418] (-1933.994) (-1931.271) * (-1933.135) (-1937.664) [-1936.729] (-1935.130) -- 0:02:28
281500 -- [-1939.240] (-1938.236) (-1935.567) (-1933.385) * [-1932.281] (-1939.396) (-1938.945) (-1935.939) -- 0:02:28
282000 -- (-1932.286) (-1937.463) [-1936.494] (-1936.380) * [-1937.915] (-1931.976) (-1938.441) (-1934.836) -- 0:02:27
282500 -- (-1934.118) (-1941.784) [-1937.518] (-1933.046) * (-1938.804) (-1933.300) (-1937.046) [-1934.884] -- 0:02:27
283000 -- [-1935.499] (-1943.159) (-1936.652) (-1936.273) * (-1936.687) [-1935.167] (-1937.646) (-1936.854) -- 0:02:26
283500 -- (-1932.604) (-1934.748) (-1936.714) [-1936.198] * [-1937.986] (-1936.747) (-1953.724) (-1938.193) -- 0:02:26
284000 -- (-1933.655) (-1934.218) (-1937.304) [-1934.526] * (-1943.318) (-1934.369) [-1934.570] (-1941.860) -- 0:02:26
284500 -- [-1932.456] (-1933.896) (-1936.207) (-1933.075) * [-1939.698] (-1931.898) (-1934.380) (-1939.309) -- 0:02:25
285000 -- (-1933.547) [-1935.368] (-1937.080) (-1932.205) * [-1942.902] (-1941.274) (-1941.363) (-1936.252) -- 0:02:25
Average standard deviation of split frequencies: 0.000000
285500 -- (-1937.507) (-1936.282) (-1938.346) [-1934.602] * (-1940.839) (-1939.681) (-1934.799) [-1935.100] -- 0:02:27
286000 -- (-1939.990) (-1935.549) (-1936.676) [-1931.526] * (-1929.404) (-1931.587) (-1936.214) [-1934.884] -- 0:02:27
286500 -- (-1944.532) [-1935.041] (-1939.320) (-1935.648) * (-1936.378) [-1930.056] (-1934.993) (-1930.915) -- 0:02:26
287000 -- (-1942.081) (-1935.312) [-1934.685] (-1931.454) * (-1936.212) [-1935.142] (-1932.042) (-1933.549) -- 0:02:26
287500 -- [-1932.258] (-1934.520) (-1931.622) (-1933.398) * (-1937.316) [-1932.488] (-1936.230) (-1932.535) -- 0:02:26
288000 -- (-1933.530) (-1939.496) (-1935.367) [-1933.533] * [-1937.624] (-1937.779) (-1933.518) (-1940.795) -- 0:02:25
288500 -- (-1935.202) (-1941.577) (-1939.229) [-1933.003] * (-1939.864) (-1933.797) (-1937.863) [-1937.254] -- 0:02:25
289000 -- (-1935.122) (-1936.506) [-1933.228] (-1932.059) * (-1933.146) [-1934.937] (-1935.561) (-1939.958) -- 0:02:25
289500 -- [-1936.003] (-1933.306) (-1935.921) (-1937.952) * [-1936.403] (-1934.524) (-1934.547) (-1934.094) -- 0:02:24
290000 -- (-1935.867) [-1934.774] (-1939.104) (-1938.343) * (-1937.189) [-1935.038] (-1933.422) (-1940.844) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
290500 -- (-1936.211) (-1930.870) (-1930.342) [-1933.196] * (-1935.035) [-1939.830] (-1933.103) (-1936.305) -- 0:02:26
291000 -- (-1936.012) (-1938.244) (-1937.595) [-1935.540] * [-1934.753] (-1932.499) (-1937.770) (-1933.692) -- 0:02:26
291500 -- (-1931.558) [-1935.628] (-1936.633) (-1933.638) * [-1938.235] (-1942.592) (-1945.839) (-1937.747) -- 0:02:25
292000 -- (-1938.751) (-1936.142) [-1929.873] (-1935.406) * (-1939.522) (-1932.551) [-1935.392] (-1933.287) -- 0:02:25
292500 -- [-1940.665] (-1932.300) (-1943.186) (-1942.453) * (-1939.272) [-1931.478] (-1936.344) (-1940.658) -- 0:02:25
293000 -- (-1937.778) [-1931.306] (-1939.750) (-1938.566) * [-1935.971] (-1930.798) (-1933.454) (-1940.558) -- 0:02:24
293500 -- (-1936.435) (-1934.380) (-1936.913) [-1937.592] * (-1937.247) (-1934.650) [-1936.016] (-1937.301) -- 0:02:24
294000 -- (-1937.728) (-1931.374) (-1939.287) [-1936.895] * (-1934.172) (-1934.230) [-1936.544] (-1938.925) -- 0:02:24
294500 -- [-1933.427] (-1931.778) (-1947.293) (-1932.212) * (-1933.577) (-1934.097) (-1934.897) [-1936.318] -- 0:02:23
295000 -- (-1933.563) [-1933.331] (-1945.186) (-1930.544) * (-1937.136) (-1934.282) (-1936.594) [-1933.316] -- 0:02:23
Average standard deviation of split frequencies: 0.000000
295500 -- (-1937.586) (-1934.203) [-1941.404] (-1932.187) * (-1939.245) (-1934.110) (-1939.866) [-1935.245] -- 0:02:25
296000 -- (-1935.532) (-1931.666) (-1938.887) [-1934.514] * [-1932.996] (-1930.810) (-1942.390) (-1943.407) -- 0:02:25
296500 -- (-1939.234) [-1932.269] (-1938.822) (-1933.167) * [-1934.942] (-1938.678) (-1937.769) (-1931.208) -- 0:02:24
297000 -- (-1940.344) [-1935.986] (-1944.443) (-1941.145) * (-1937.261) [-1934.085] (-1935.726) (-1934.502) -- 0:02:24
297500 -- (-1938.960) [-1932.258] (-1942.718) (-1932.133) * (-1934.648) [-1936.672] (-1930.367) (-1934.241) -- 0:02:24
298000 -- (-1936.012) [-1932.437] (-1938.622) (-1937.902) * [-1932.099] (-1934.531) (-1936.627) (-1938.082) -- 0:02:23
298500 -- [-1936.989] (-1935.571) (-1938.043) (-1934.263) * (-1939.596) (-1933.697) (-1935.405) [-1930.331] -- 0:02:23
299000 -- (-1940.907) (-1931.193) [-1939.825] (-1933.769) * (-1938.604) [-1934.782] (-1935.521) (-1939.346) -- 0:02:23
299500 -- (-1938.353) [-1929.465] (-1938.946) (-1935.053) * (-1940.616) [-1932.140] (-1940.728) (-1935.836) -- 0:02:22
300000 -- (-1937.074) (-1937.854) (-1942.895) [-1933.609] * [-1930.452] (-1936.788) (-1937.384) (-1940.748) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
300500 -- (-1937.551) [-1930.232] (-1941.732) (-1938.424) * (-1941.006) (-1946.687) (-1937.214) [-1937.025] -- 0:02:24
301000 -- (-1930.649) (-1931.950) [-1934.654] (-1940.589) * [-1937.179] (-1937.292) (-1935.066) (-1937.017) -- 0:02:23
301500 -- (-1935.702) (-1937.640) (-1933.605) [-1935.104] * (-1946.120) (-1938.216) (-1934.273) [-1935.584] -- 0:02:23
302000 -- (-1934.445) (-1931.698) (-1931.789) [-1934.252] * (-1943.302) (-1937.092) [-1930.459] (-1933.792) -- 0:02:23
302500 -- [-1931.166] (-1931.471) (-1935.739) (-1930.859) * (-1934.297) (-1938.547) (-1932.173) [-1932.299] -- 0:02:22
303000 -- (-1932.904) (-1936.770) (-1935.638) [-1936.249] * (-1933.334) (-1938.109) (-1941.693) [-1941.531] -- 0:02:22
303500 -- [-1935.744] (-1937.476) (-1934.669) (-1941.293) * (-1932.840) (-1935.973) (-1934.062) [-1937.592] -- 0:02:22
304000 -- (-1938.781) (-1937.302) (-1940.494) [-1937.538] * (-1935.892) (-1933.829) [-1940.130] (-1939.608) -- 0:02:21
304500 -- [-1937.586] (-1937.144) (-1947.456) (-1936.304) * [-1933.354] (-1935.859) (-1932.683) (-1938.038) -- 0:02:21
305000 -- (-1936.530) [-1935.244] (-1936.899) (-1936.817) * (-1936.762) [-1938.529] (-1938.717) (-1935.429) -- 0:02:23
Average standard deviation of split frequencies: 0.000000
305500 -- (-1940.297) [-1931.640] (-1933.995) (-1936.045) * (-1937.734) [-1933.608] (-1937.573) (-1944.960) -- 0:02:23
306000 -- [-1938.080] (-1936.224) (-1945.009) (-1935.553) * (-1939.626) [-1933.573] (-1934.087) (-1932.769) -- 0:02:22
306500 -- (-1938.442) [-1933.558] (-1935.364) (-1932.698) * (-1938.011) (-1936.606) (-1936.441) [-1931.492] -- 0:02:22
307000 -- (-1933.803) (-1936.269) (-1938.220) [-1936.920] * (-1939.166) (-1943.761) [-1933.292] (-1935.454) -- 0:02:22
307500 -- [-1932.990] (-1934.065) (-1936.101) (-1935.095) * (-1939.962) [-1943.557] (-1931.314) (-1935.229) -- 0:02:21
308000 -- (-1933.470) [-1930.141] (-1941.572) (-1935.373) * [-1934.989] (-1935.981) (-1939.408) (-1934.641) -- 0:02:21
308500 -- [-1933.029] (-1931.011) (-1939.227) (-1938.179) * (-1939.460) (-1934.576) [-1933.562] (-1942.337) -- 0:02:21
309000 -- [-1937.763] (-1934.041) (-1935.190) (-1931.885) * [-1935.928] (-1933.453) (-1938.298) (-1944.138) -- 0:02:20
309500 -- (-1947.197) [-1935.130] (-1929.031) (-1935.532) * (-1936.427) [-1933.763] (-1935.125) (-1931.705) -- 0:02:20
310000 -- (-1937.218) (-1942.182) [-1931.673] (-1934.146) * (-1931.136) (-1931.751) [-1933.837] (-1937.222) -- 0:02:22
Average standard deviation of split frequencies: 0.000000
310500 -- (-1932.853) (-1933.019) [-1931.654] (-1939.077) * (-1935.746) (-1936.856) (-1940.648) [-1934.819] -- 0:02:22
311000 -- (-1933.989) [-1931.016] (-1937.392) (-1933.353) * (-1932.364) [-1935.423] (-1938.051) (-1932.507) -- 0:02:21
311500 -- (-1937.925) (-1938.294) [-1934.726] (-1932.601) * (-1933.212) (-1934.045) [-1934.433] (-1934.166) -- 0:02:21
312000 -- (-1937.545) (-1932.997) (-1932.306) [-1932.150] * [-1930.229] (-1932.881) (-1941.051) (-1932.807) -- 0:02:21
312500 -- (-1935.420) (-1935.328) (-1933.690) [-1930.667] * [-1935.134] (-1937.715) (-1937.097) (-1941.023) -- 0:02:20
313000 -- [-1935.910] (-1937.074) (-1942.267) (-1935.072) * (-1935.844) (-1936.089) (-1934.585) [-1932.586] -- 0:02:20
313500 -- (-1932.943) (-1937.893) [-1930.579] (-1936.815) * (-1934.077) (-1932.977) [-1932.905] (-1933.350) -- 0:02:20
314000 -- [-1932.462] (-1940.040) (-1932.764) (-1931.266) * (-1932.879) (-1935.153) [-1933.322] (-1937.954) -- 0:02:19
314500 -- (-1935.350) (-1938.359) [-1937.468] (-1941.005) * (-1935.182) (-1939.553) (-1935.294) [-1933.251] -- 0:02:19
315000 -- (-1932.245) (-1933.129) (-1939.412) [-1932.528] * (-1934.644) [-1937.602] (-1940.248) (-1938.569) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
315500 -- (-1937.857) (-1942.802) (-1939.052) [-1933.803] * (-1938.551) [-1935.243] (-1940.092) (-1934.680) -- 0:02:21
316000 -- (-1938.050) (-1932.982) (-1935.086) [-1934.676] * (-1930.956) [-1938.838] (-1945.822) (-1937.716) -- 0:02:20
316500 -- (-1937.718) (-1935.388) (-1933.334) [-1931.549] * (-1943.938) (-1937.843) (-1947.105) [-1936.665] -- 0:02:20
317000 -- (-1934.997) [-1943.223] (-1931.079) (-1937.943) * (-1940.079) [-1936.860] (-1937.626) (-1939.578) -- 0:02:20
317500 -- (-1932.463) (-1939.839) (-1933.007) [-1943.696] * (-1936.320) (-1932.784) [-1933.544] (-1937.951) -- 0:02:19
318000 -- (-1931.576) [-1939.091] (-1938.013) (-1940.137) * (-1937.530) [-1939.201] (-1932.690) (-1936.565) -- 0:02:19
318500 -- (-1934.040) [-1931.912] (-1937.265) (-1932.107) * (-1932.204) (-1940.076) [-1932.026] (-1944.903) -- 0:02:19
319000 -- (-1935.268) [-1931.862] (-1936.085) (-1935.550) * (-1936.885) (-1934.946) [-1934.192] (-1936.610) -- 0:02:18
319500 -- (-1946.084) (-1940.975) [-1935.236] (-1932.432) * [-1935.192] (-1941.447) (-1935.661) (-1938.613) -- 0:02:18
320000 -- [-1932.608] (-1939.124) (-1934.033) (-1945.641) * (-1930.554) (-1934.210) (-1933.602) [-1937.710] -- 0:02:20
Average standard deviation of split frequencies: 0.000000
320500 -- (-1931.723) (-1934.819) (-1934.838) [-1935.708] * (-1935.894) (-1936.780) (-1931.159) [-1938.094] -- 0:02:19
321000 -- (-1942.094) (-1936.851) (-1930.382) [-1931.151] * (-1937.140) (-1939.112) (-1934.512) [-1936.584] -- 0:02:19
321500 -- (-1939.727) [-1934.459] (-1940.808) (-1933.666) * [-1932.435] (-1945.549) (-1941.637) (-1936.346) -- 0:02:19
322000 -- (-1931.999) (-1934.809) [-1936.166] (-1941.389) * (-1938.932) (-1938.717) [-1935.667] (-1936.476) -- 0:02:18
322500 -- [-1929.564] (-1939.650) (-1935.878) (-1935.734) * (-1939.620) (-1931.525) [-1933.261] (-1933.224) -- 0:02:18
323000 -- (-1934.682) [-1935.231] (-1936.785) (-1942.034) * (-1938.384) [-1936.066] (-1935.473) (-1937.648) -- 0:02:18
323500 -- [-1938.963] (-1935.152) (-1934.427) (-1935.589) * (-1935.824) [-1929.653] (-1932.276) (-1938.449) -- 0:02:18
324000 -- (-1939.476) [-1932.785] (-1935.734) (-1940.951) * (-1933.352) [-1932.838] (-1933.336) (-1933.566) -- 0:02:17
324500 -- (-1942.736) (-1935.556) [-1934.502] (-1930.565) * (-1936.138) (-1936.480) [-1931.009] (-1935.034) -- 0:02:17
325000 -- (-1932.050) (-1933.846) [-1936.350] (-1933.667) * [-1937.285] (-1946.899) (-1937.380) (-1935.351) -- 0:02:19
Average standard deviation of split frequencies: 0.000000
325500 -- [-1932.807] (-1934.960) (-1931.872) (-1933.535) * (-1931.683) (-1934.551) [-1932.152] (-1933.700) -- 0:02:18
326000 -- [-1941.088] (-1931.515) (-1939.637) (-1935.272) * (-1934.698) (-1935.418) (-1934.962) [-1934.620] -- 0:02:18
326500 -- [-1930.707] (-1934.434) (-1937.766) (-1939.902) * (-1931.886) (-1933.014) [-1933.066] (-1931.453) -- 0:02:18
327000 -- (-1935.427) (-1936.158) [-1942.727] (-1941.073) * (-1936.051) (-1940.058) (-1938.921) [-1935.081] -- 0:02:17
327500 -- [-1933.709] (-1934.944) (-1936.750) (-1937.013) * [-1934.069] (-1940.305) (-1942.610) (-1933.484) -- 0:02:17
328000 -- [-1934.178] (-1934.742) (-1931.995) (-1939.947) * [-1932.183] (-1933.435) (-1944.284) (-1934.990) -- 0:02:17
328500 -- (-1936.719) [-1938.632] (-1930.935) (-1943.971) * (-1935.666) [-1930.691] (-1934.757) (-1941.166) -- 0:02:16
329000 -- (-1935.666) (-1934.613) [-1939.646] (-1939.396) * (-1931.606) [-1932.959] (-1935.181) (-1940.215) -- 0:02:16
329500 -- (-1940.705) (-1936.750) [-1940.215] (-1938.340) * [-1933.232] (-1934.420) (-1935.682) (-1934.753) -- 0:02:16
330000 -- (-1932.329) (-1937.031) (-1930.723) [-1933.931] * [-1935.040] (-1933.792) (-1932.573) (-1941.446) -- 0:02:18
Average standard deviation of split frequencies: 0.000000
330500 -- (-1941.901) (-1932.069) [-1937.421] (-1935.922) * (-1940.574) (-1940.610) (-1937.615) [-1931.203] -- 0:02:17
331000 -- (-1933.381) [-1931.820] (-1935.361) (-1932.180) * (-1937.216) [-1935.911] (-1937.906) (-1935.221) -- 0:02:17
331500 -- (-1935.479) (-1939.793) [-1936.539] (-1937.228) * [-1934.161] (-1937.726) (-1938.104) (-1939.718) -- 0:02:17
332000 -- (-1940.578) (-1931.588) (-1937.828) [-1934.692] * (-1934.116) (-1935.178) [-1930.198] (-1934.890) -- 0:02:16
332500 -- (-1938.224) (-1931.946) [-1937.628] (-1936.290) * (-1938.066) [-1938.132] (-1933.409) (-1941.621) -- 0:02:16
333000 -- (-1951.546) (-1935.840) [-1936.346] (-1934.520) * [-1936.416] (-1936.368) (-1939.538) (-1938.317) -- 0:02:16
333500 -- (-1939.250) [-1933.796] (-1939.478) (-1939.090) * (-1936.468) (-1939.674) (-1936.335) [-1934.488] -- 0:02:15
334000 -- [-1938.196] (-1932.518) (-1935.491) (-1936.965) * [-1934.400] (-1931.284) (-1937.074) (-1932.881) -- 0:02:15
334500 -- [-1930.813] (-1936.197) (-1934.507) (-1935.256) * (-1940.633) [-1932.378] (-1934.321) (-1935.476) -- 0:02:15
335000 -- (-1940.251) [-1937.395] (-1933.094) (-1935.291) * (-1938.996) (-1938.694) (-1930.792) [-1935.662] -- 0:02:16
Average standard deviation of split frequencies: 0.000000
335500 -- (-1931.602) (-1943.600) [-1935.142] (-1934.082) * (-1940.011) [-1932.825] (-1933.856) (-1932.183) -- 0:02:16
336000 -- (-1931.892) (-1938.925) (-1943.882) [-1937.298] * (-1941.721) (-1935.389) [-1934.056] (-1932.019) -- 0:02:16
336500 -- (-1933.960) (-1940.312) (-1943.237) [-1939.874] * [-1935.775] (-1945.835) (-1938.628) (-1932.236) -- 0:02:16
337000 -- (-1933.220) [-1936.735] (-1938.660) (-1931.126) * (-1939.083) (-1936.749) (-1936.479) [-1931.767] -- 0:02:15
337500 -- [-1939.042] (-1941.463) (-1937.971) (-1939.665) * (-1937.240) (-1931.321) (-1931.838) [-1933.183] -- 0:02:15
338000 -- (-1937.816) (-1935.042) (-1935.333) [-1934.439] * [-1941.839] (-1936.969) (-1936.299) (-1934.337) -- 0:02:15
338500 -- (-1932.047) (-1935.070) [-1932.492] (-1931.947) * (-1936.623) (-1940.427) (-1936.099) [-1944.165] -- 0:02:14
339000 -- (-1932.200) (-1937.242) [-1933.254] (-1932.134) * (-1936.356) (-1937.143) (-1930.921) [-1931.370] -- 0:02:14
339500 -- (-1933.510) (-1937.082) (-1930.459) [-1931.961] * (-1937.891) (-1942.749) (-1934.276) [-1932.185] -- 0:02:14
340000 -- (-1941.346) (-1938.741) (-1931.162) [-1938.886] * [-1933.167] (-1933.938) (-1941.553) (-1938.047) -- 0:02:15
Average standard deviation of split frequencies: 0.000000
340500 -- [-1933.180] (-1934.192) (-1931.998) (-1937.531) * [-1935.773] (-1935.611) (-1942.650) (-1935.425) -- 0:02:15
341000 -- (-1942.950) (-1937.083) [-1932.204] (-1945.378) * [-1936.287] (-1938.418) (-1950.237) (-1935.078) -- 0:02:15
341500 -- (-1937.508) (-1938.911) [-1935.872] (-1940.122) * (-1945.189) [-1937.418] (-1945.595) (-1937.702) -- 0:02:14
342000 -- (-1936.037) [-1935.789] (-1941.079) (-1932.893) * (-1935.960) [-1932.379] (-1936.549) (-1934.813) -- 0:02:14
342500 -- (-1939.661) (-1931.192) (-1938.456) [-1934.700] * (-1941.137) [-1930.154] (-1936.477) (-1933.427) -- 0:02:14
343000 -- (-1937.377) [-1932.089] (-1934.819) (-1934.211) * [-1938.607] (-1937.408) (-1938.564) (-1934.090) -- 0:02:14
343500 -- (-1934.536) [-1937.982] (-1940.201) (-1938.727) * (-1931.112) [-1931.627] (-1936.189) (-1935.308) -- 0:02:13
344000 -- (-1934.013) (-1930.030) (-1937.686) [-1935.890] * (-1936.185) (-1931.449) [-1937.902] (-1940.464) -- 0:02:13
344500 -- (-1937.555) [-1935.950] (-1937.607) (-1935.233) * [-1930.734] (-1933.539) (-1937.294) (-1933.434) -- 0:02:13
345000 -- (-1934.857) (-1945.275) [-1934.130] (-1935.156) * (-1933.968) (-1939.904) (-1935.572) [-1934.822] -- 0:02:14
Average standard deviation of split frequencies: 0.000000
345500 -- (-1938.640) (-1935.825) (-1935.772) [-1939.364] * (-1935.637) (-1941.918) (-1937.146) [-1938.877] -- 0:02:14
346000 -- (-1937.354) (-1931.295) [-1937.037] (-1935.396) * (-1935.435) (-1934.452) [-1934.438] (-1946.701) -- 0:02:14
346500 -- (-1930.785) [-1938.860] (-1937.507) (-1934.064) * [-1936.754] (-1931.758) (-1936.569) (-1938.071) -- 0:02:13
347000 -- (-1934.048) (-1932.970) (-1938.398) [-1931.347] * [-1932.186] (-1934.762) (-1937.915) (-1940.251) -- 0:02:13
347500 -- (-1936.174) [-1932.563] (-1937.243) (-1933.916) * [-1935.975] (-1928.609) (-1932.642) (-1930.026) -- 0:02:13
348000 -- [-1931.219] (-1939.638) (-1935.977) (-1940.662) * (-1932.897) (-1936.790) (-1932.515) [-1932.098] -- 0:02:13
348500 -- (-1938.303) (-1934.774) (-1935.218) [-1934.036] * (-1933.568) (-1931.646) (-1934.321) [-1935.631] -- 0:02:12
349000 -- (-1936.333) (-1933.740) [-1933.228] (-1938.236) * (-1938.355) (-1935.016) [-1935.135] (-1939.117) -- 0:02:12
349500 -- (-1939.544) [-1935.596] (-1940.147) (-1942.233) * (-1931.772) (-1936.131) [-1934.141] (-1935.273) -- 0:02:12
350000 -- (-1936.078) (-1933.554) (-1937.712) [-1937.914] * (-1940.894) (-1929.184) (-1939.705) [-1936.149] -- 0:02:13
Average standard deviation of split frequencies: 0.000000
350500 -- (-1934.470) (-1937.169) [-1932.722] (-1935.915) * (-1941.005) [-1933.712] (-1933.839) (-1941.506) -- 0:02:13
351000 -- (-1936.906) (-1940.895) (-1938.230) [-1936.246] * (-1939.348) [-1937.752] (-1934.846) (-1930.764) -- 0:02:13
351500 -- (-1937.724) [-1929.765] (-1938.999) (-1942.912) * [-1937.379] (-1932.495) (-1943.480) (-1934.283) -- 0:02:12
352000 -- (-1936.284) (-1935.118) (-1938.642) [-1932.712] * (-1936.651) (-1940.600) (-1946.637) [-1933.031] -- 0:02:12
352500 -- (-1936.819) [-1935.977] (-1930.206) (-1933.776) * [-1938.469] (-1935.856) (-1936.472) (-1942.907) -- 0:02:12
353000 -- [-1932.779] (-1940.296) (-1933.385) (-1935.242) * (-1934.197) (-1934.539) [-1935.292] (-1944.019) -- 0:02:11
353500 -- [-1932.203] (-1943.388) (-1935.548) (-1935.289) * [-1933.086] (-1934.911) (-1936.060) (-1939.398) -- 0:02:11
354000 -- (-1930.937) (-1946.858) [-1933.164] (-1940.326) * (-1934.182) (-1938.485) [-1935.082] (-1938.112) -- 0:02:11
354500 -- (-1933.004) [-1940.474] (-1938.168) (-1934.409) * (-1934.347) [-1938.380] (-1941.119) (-1934.907) -- 0:02:11
355000 -- (-1932.264) (-1938.043) [-1936.877] (-1932.933) * (-1931.885) [-1940.229] (-1937.720) (-1935.720) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
355500 -- (-1934.716) [-1934.884] (-1939.344) (-1931.218) * [-1935.794] (-1936.543) (-1934.667) (-1936.858) -- 0:02:12
356000 -- (-1938.520) [-1936.008] (-1934.417) (-1935.166) * (-1933.820) (-1935.795) (-1937.539) [-1932.585] -- 0:02:12
356500 -- (-1935.343) (-1935.956) [-1936.083] (-1938.053) * (-1935.854) (-1934.916) [-1934.544] (-1933.078) -- 0:02:11
357000 -- (-1931.765) [-1935.978] (-1940.504) (-1945.646) * (-1931.381) (-1934.443) (-1931.528) [-1944.063] -- 0:02:11
357500 -- [-1931.781] (-1947.623) (-1932.146) (-1938.116) * (-1933.866) (-1938.685) [-1929.341] (-1933.440) -- 0:02:11
358000 -- (-1940.804) (-1932.978) (-1941.577) [-1934.062] * (-1936.741) (-1942.682) (-1934.356) [-1935.503] -- 0:02:10
358500 -- [-1931.057] (-1944.164) (-1939.678) (-1933.588) * (-1938.109) (-1932.398) (-1932.499) [-1932.261] -- 0:02:10
359000 -- [-1932.250] (-1938.366) (-1941.060) (-1935.590) * (-1937.908) (-1934.609) [-1933.778] (-1937.901) -- 0:02:10
359500 -- [-1937.122] (-1943.326) (-1934.759) (-1931.868) * (-1936.069) (-1936.626) (-1939.483) [-1934.638] -- 0:02:10
360000 -- (-1942.769) [-1944.433] (-1937.395) (-1938.327) * (-1942.956) [-1939.052] (-1935.063) (-1934.569) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
360500 -- [-1934.828] (-1941.912) (-1940.103) (-1936.427) * (-1935.788) (-1935.105) [-1931.519] (-1936.144) -- 0:02:11
361000 -- [-1934.706] (-1937.358) (-1943.044) (-1942.221) * (-1944.005) [-1932.400] (-1937.498) (-1935.908) -- 0:02:10
361500 -- (-1940.345) (-1933.187) (-1935.407) [-1937.298] * (-1940.703) (-1939.235) [-1934.529] (-1936.733) -- 0:02:10
362000 -- (-1935.579) (-1935.187) [-1935.522] (-1937.097) * (-1942.367) [-1940.433] (-1941.068) (-1939.826) -- 0:02:10
362500 -- (-1933.912) (-1944.258) (-1937.990) [-1934.478] * (-1938.378) [-1937.908] (-1932.211) (-1937.955) -- 0:02:10
363000 -- (-1937.187) (-1935.826) [-1935.764] (-1940.108) * (-1939.827) (-1936.892) [-1936.392] (-1937.845) -- 0:02:09
363500 -- (-1934.258) (-1932.311) (-1931.059) [-1930.146] * (-1935.499) (-1936.051) [-1934.659] (-1936.843) -- 0:02:09
364000 -- [-1941.494] (-1935.393) (-1942.845) (-1943.104) * (-1935.793) (-1935.150) [-1933.433] (-1938.365) -- 0:02:09
364500 -- [-1936.266] (-1937.586) (-1937.622) (-1931.474) * (-1938.459) [-1933.121] (-1933.967) (-1933.899) -- 0:02:09
365000 -- (-1934.008) [-1931.941] (-1933.709) (-1933.718) * (-1939.398) (-1936.664) [-1934.321] (-1932.018) -- 0:02:10
Average standard deviation of split frequencies: 0.000000
365500 -- (-1937.204) (-1931.539) (-1936.102) [-1939.609] * [-1943.626] (-1937.255) (-1936.921) (-1933.630) -- 0:02:10
366000 -- [-1934.432] (-1941.760) (-1937.013) (-1934.880) * (-1935.173) (-1937.906) [-1933.575] (-1934.597) -- 0:02:09
366500 -- [-1935.534] (-1935.266) (-1938.762) (-1934.126) * (-1933.228) (-1940.723) [-1936.240] (-1933.372) -- 0:02:09
367000 -- (-1936.113) (-1933.502) (-1941.825) [-1934.569] * (-1946.722) (-1936.546) (-1935.142) [-1933.714] -- 0:02:09
367500 -- [-1932.568] (-1935.754) (-1934.994) (-1933.479) * (-1952.458) (-1940.509) [-1930.293] (-1931.100) -- 0:02:09
368000 -- (-1936.104) [-1932.994] (-1932.866) (-1938.706) * [-1942.262] (-1933.915) (-1940.705) (-1939.035) -- 0:02:08
368500 -- (-1938.041) (-1933.133) [-1936.069] (-1932.847) * (-1940.697) [-1935.355] (-1939.264) (-1933.614) -- 0:02:08
369000 -- (-1934.523) (-1933.432) [-1934.350] (-1932.849) * [-1934.773] (-1937.575) (-1935.948) (-1931.740) -- 0:02:08
369500 -- [-1933.025] (-1932.438) (-1937.722) (-1932.373) * (-1934.362) [-1935.858] (-1940.181) (-1941.888) -- 0:02:07
370000 -- (-1943.340) (-1937.086) (-1934.069) [-1931.398] * (-1934.847) (-1933.918) [-1932.196] (-1939.481) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
370500 -- (-1933.530) (-1942.284) (-1944.860) [-1935.556] * [-1933.031] (-1933.594) (-1934.583) (-1936.887) -- 0:02:09
371000 -- [-1933.965] (-1939.914) (-1931.913) (-1934.332) * (-1930.821) (-1939.324) [-1929.901] (-1937.243) -- 0:02:08
371500 -- [-1937.479] (-1942.006) (-1939.063) (-1935.580) * (-1933.464) (-1937.017) (-1939.021) [-1931.407] -- 0:02:08
372000 -- (-1934.702) [-1936.445] (-1938.771) (-1931.370) * (-1934.032) (-1934.503) (-1932.729) [-1934.082] -- 0:02:08
372500 -- [-1939.611] (-1941.008) (-1938.481) (-1932.980) * (-1934.068) [-1934.977] (-1935.006) (-1936.170) -- 0:02:08
373000 -- (-1935.887) (-1939.846) [-1938.808] (-1934.215) * [-1933.842] (-1933.837) (-1934.577) (-1934.552) -- 0:02:07
373500 -- (-1930.985) [-1934.689] (-1936.640) (-1938.422) * (-1940.573) (-1931.898) (-1953.251) [-1928.781] -- 0:02:07
374000 -- (-1934.276) [-1934.783] (-1936.473) (-1935.365) * (-1932.894) [-1933.845] (-1936.505) (-1934.999) -- 0:02:07
374500 -- [-1935.177] (-1935.211) (-1939.135) (-1935.569) * (-1933.275) (-1931.794) [-1936.184] (-1932.518) -- 0:02:06
375000 -- (-1938.116) (-1937.085) (-1944.467) [-1932.078] * (-1933.133) (-1936.819) [-1937.484] (-1933.103) -- 0:02:08
Average standard deviation of split frequencies: 0.000000
375500 -- [-1933.121] (-1932.583) (-1936.320) (-1935.796) * (-1940.604) (-1940.373) (-1937.606) [-1934.181] -- 0:02:08
376000 -- (-1931.692) (-1933.674) (-1936.401) [-1936.875] * (-1937.857) [-1940.769] (-1935.620) (-1930.335) -- 0:02:07
376500 -- (-1935.567) (-1932.879) (-1935.314) [-1933.512] * (-1928.806) (-1939.265) [-1933.037] (-1933.671) -- 0:02:07
377000 -- (-1934.878) (-1937.477) [-1935.227] (-1936.889) * (-1940.993) (-1937.084) [-1934.303] (-1939.675) -- 0:02:07
377500 -- (-1936.444) (-1948.124) [-1932.895] (-1933.361) * [-1942.867] (-1938.494) (-1936.097) (-1937.033) -- 0:02:06
378000 -- (-1930.218) (-1942.783) (-1932.112) [-1933.315] * (-1939.679) [-1935.305] (-1929.908) (-1943.918) -- 0:02:06
378500 -- (-1936.257) [-1940.834] (-1934.584) (-1934.595) * (-1932.347) [-1933.234] (-1932.250) (-1936.268) -- 0:02:06
379000 -- (-1938.511) [-1934.315] (-1935.076) (-1934.557) * [-1935.243] (-1935.432) (-1941.705) (-1937.034) -- 0:02:06
379500 -- [-1943.971] (-1935.427) (-1931.243) (-1936.140) * (-1934.081) (-1939.963) [-1933.704] (-1945.532) -- 0:02:05
380000 -- [-1935.241] (-1934.323) (-1933.611) (-1933.418) * (-1935.892) (-1935.189) [-1937.832] (-1936.921) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
380500 -- [-1936.204] (-1935.507) (-1930.308) (-1936.605) * [-1938.211] (-1940.220) (-1943.744) (-1934.691) -- 0:02:06
381000 -- (-1933.268) (-1939.825) (-1938.179) [-1936.870] * (-1937.380) [-1937.727] (-1940.790) (-1938.377) -- 0:02:06
381500 -- [-1933.514] (-1940.440) (-1940.584) (-1934.374) * (-1935.802) (-1938.231) (-1950.769) [-1938.548] -- 0:02:06
382000 -- (-1934.073) [-1933.320] (-1937.906) (-1937.161) * (-1937.142) [-1932.207] (-1945.763) (-1935.437) -- 0:02:06
382500 -- (-1936.367) [-1934.281] (-1936.360) (-1936.167) * (-1937.307) (-1936.914) (-1941.058) [-1938.241] -- 0:02:05
383000 -- [-1938.127] (-1933.463) (-1944.266) (-1935.720) * (-1938.980) [-1933.849] (-1941.677) (-1934.079) -- 0:02:05
383500 -- (-1936.038) [-1932.256] (-1931.295) (-1933.686) * (-1940.747) (-1934.751) (-1936.008) [-1935.910] -- 0:02:05
384000 -- (-1935.756) (-1940.278) [-1935.983] (-1934.123) * (-1942.169) (-1940.240) [-1939.636] (-1932.397) -- 0:02:05
384500 -- (-1939.615) (-1944.629) [-1938.279] (-1935.826) * [-1937.912] (-1944.920) (-1934.541) (-1935.347) -- 0:02:04
385000 -- (-1937.571) (-1940.049) [-1930.761] (-1935.400) * (-1942.282) [-1939.267] (-1936.824) (-1941.147) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
385500 -- (-1935.632) (-1938.214) (-1936.349) [-1934.425] * (-1941.986) [-1940.362] (-1943.438) (-1943.545) -- 0:02:05
386000 -- (-1932.827) [-1934.473] (-1937.756) (-1937.570) * (-1932.460) (-1937.242) [-1944.221] (-1942.734) -- 0:02:05
386500 -- (-1934.160) (-1936.138) [-1935.364] (-1941.248) * [-1930.238] (-1935.805) (-1951.445) (-1939.654) -- 0:02:05
387000 -- [-1932.745] (-1936.747) (-1933.215) (-1936.302) * (-1941.160) (-1930.130) (-1950.260) [-1936.227] -- 0:02:05
387500 -- (-1939.389) [-1933.340] (-1931.989) (-1937.258) * (-1936.074) (-1929.854) (-1937.065) [-1933.126] -- 0:02:04
388000 -- [-1940.423] (-1933.080) (-1933.879) (-1934.548) * (-1941.471) [-1935.111] (-1932.046) (-1940.560) -- 0:02:04
388500 -- (-1931.621) [-1933.337] (-1933.433) (-1936.092) * (-1940.661) (-1932.294) (-1935.774) [-1940.193] -- 0:02:04
389000 -- (-1933.980) (-1940.277) (-1938.973) [-1937.761] * (-1939.238) (-1939.889) [-1934.058] (-1930.770) -- 0:02:04
389500 -- [-1931.359] (-1937.708) (-1935.427) (-1944.344) * (-1939.229) (-1939.165) (-1931.313) [-1936.041] -- 0:02:03
390000 -- (-1938.089) (-1929.566) [-1935.595] (-1937.767) * [-1933.725] (-1943.386) (-1931.216) (-1935.697) -- 0:02:05
Average standard deviation of split frequencies: 0.000000
390500 -- (-1942.079) (-1934.097) (-1933.723) [-1937.708] * (-1937.635) [-1931.296] (-1939.190) (-1931.821) -- 0:02:04
391000 -- (-1934.167) (-1934.402) (-1933.690) [-1937.742] * [-1939.689] (-1936.279) (-1932.061) (-1931.709) -- 0:02:04
391500 -- [-1932.986] (-1933.246) (-1933.953) (-1934.026) * (-1945.042) [-1934.725] (-1933.676) (-1936.995) -- 0:02:04
392000 -- (-1933.703) [-1935.090] (-1939.706) (-1932.615) * (-1939.040) (-1939.409) (-1941.095) [-1933.634] -- 0:02:04
392500 -- (-1936.862) (-1941.896) (-1936.770) [-1934.053] * (-1930.750) (-1935.353) [-1936.361] (-1935.242) -- 0:02:03
393000 -- (-1932.291) [-1934.941] (-1936.761) (-1940.622) * (-1932.304) (-1935.271) (-1934.993) [-1934.102] -- 0:02:03
393500 -- (-1930.992) (-1935.817) (-1933.862) [-1941.970] * (-1938.376) (-1937.290) [-1934.932] (-1935.881) -- 0:02:03
394000 -- [-1932.923] (-1935.886) (-1931.233) (-1936.746) * [-1934.230] (-1935.121) (-1937.752) (-1934.991) -- 0:02:03
394500 -- (-1942.846) [-1934.496] (-1934.474) (-1935.384) * (-1935.897) [-1939.934] (-1934.816) (-1936.679) -- 0:02:02
395000 -- (-1939.619) [-1934.349] (-1942.894) (-1935.462) * [-1932.474] (-1936.720) (-1929.535) (-1936.028) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
395500 -- (-1935.598) (-1937.669) [-1938.613] (-1942.180) * (-1930.584) (-1941.668) [-1931.122] (-1933.888) -- 0:02:03
396000 -- (-1935.934) [-1933.042] (-1940.782) (-1934.610) * (-1934.583) (-1932.481) [-1932.956] (-1934.716) -- 0:02:03
396500 -- (-1933.378) [-1935.127] (-1935.621) (-1937.716) * (-1934.856) (-1943.889) (-1938.458) [-1933.813] -- 0:02:03
397000 -- (-1935.680) (-1939.066) (-1931.757) [-1940.749] * [-1929.134] (-1940.128) (-1936.736) (-1936.499) -- 0:02:03
397500 -- (-1937.126) (-1935.751) [-1935.735] (-1941.040) * (-1934.120) (-1940.934) [-1938.176] (-1936.122) -- 0:02:02
398000 -- (-1937.190) (-1937.396) [-1938.158] (-1934.599) * (-1932.240) (-1941.278) [-1939.015] (-1939.667) -- 0:02:02
398500 -- (-1939.134) [-1934.523] (-1947.599) (-1934.453) * (-1936.663) [-1936.761] (-1934.422) (-1932.959) -- 0:02:02
399000 -- (-1936.005) (-1935.598) (-1938.806) [-1934.260] * (-1936.166) (-1938.302) (-1937.543) [-1932.494] -- 0:02:02
399500 -- (-1935.744) (-1935.590) [-1936.261] (-1940.315) * (-1936.899) [-1936.014] (-1940.966) (-1936.407) -- 0:02:01
400000 -- [-1930.802] (-1939.067) (-1936.840) (-1933.337) * (-1932.917) (-1941.784) (-1932.450) [-1935.624] -- 0:02:03
Average standard deviation of split frequencies: 0.000000
400500 -- (-1932.771) (-1939.570) [-1933.732] (-1932.996) * (-1939.788) (-1943.753) (-1939.533) [-1937.627] -- 0:02:02
401000 -- (-1934.583) (-1938.242) [-1941.308] (-1935.936) * (-1939.631) [-1940.309] (-1941.785) (-1932.698) -- 0:02:02
401500 -- [-1934.975] (-1939.151) (-1936.048) (-1936.321) * (-1930.549) [-1931.798] (-1934.668) (-1933.594) -- 0:02:02
402000 -- (-1936.266) (-1946.843) [-1930.879] (-1934.897) * (-1937.617) [-1933.672] (-1934.579) (-1938.176) -- 0:02:01
402500 -- [-1938.582] (-1941.470) (-1931.761) (-1931.866) * (-1934.047) (-1931.819) [-1929.840] (-1933.951) -- 0:02:01
403000 -- (-1939.353) (-1942.922) (-1935.971) [-1932.422] * (-1940.877) (-1932.859) (-1931.755) [-1935.050] -- 0:02:01
403500 -- (-1932.616) (-1931.398) (-1938.518) [-1931.024] * (-1932.845) (-1934.778) (-1930.605) [-1934.281] -- 0:02:01
404000 -- (-1934.022) (-1941.830) (-1936.108) [-1936.554] * (-1937.543) (-1943.642) [-1936.583] (-1933.946) -- 0:02:00
404500 -- (-1937.675) (-1935.668) (-1935.862) [-1935.743] * (-1937.194) (-1940.024) [-1937.718] (-1935.147) -- 0:02:00
405000 -- (-1934.952) [-1932.941] (-1935.044) (-1936.970) * [-1930.024] (-1935.544) (-1942.491) (-1931.006) -- 0:02:01
Average standard deviation of split frequencies: 0.000000
405500 -- (-1941.331) (-1937.938) (-1939.463) [-1936.605] * (-1934.782) (-1938.264) (-1936.440) [-1934.211] -- 0:02:01
406000 -- (-1937.376) (-1939.623) [-1936.080] (-1934.964) * (-1938.470) (-1937.059) (-1937.663) [-1934.927] -- 0:02:01
406500 -- (-1934.244) (-1933.652) [-1937.736] (-1935.767) * [-1935.585] (-1939.029) (-1937.457) (-1932.774) -- 0:02:01
407000 -- (-1941.354) (-1940.270) [-1933.154] (-1942.200) * (-1940.440) (-1944.947) [-1933.571] (-1936.657) -- 0:02:00
407500 -- [-1935.340] (-1935.388) (-1941.274) (-1930.733) * [-1936.160] (-1940.946) (-1941.411) (-1941.146) -- 0:02:00
408000 -- (-1937.374) (-1938.206) [-1932.331] (-1931.463) * [-1938.932] (-1939.256) (-1937.130) (-1934.515) -- 0:02:00
408500 -- [-1936.442] (-1935.361) (-1932.958) (-1935.637) * (-1935.292) [-1934.750] (-1934.284) (-1936.897) -- 0:02:00
409000 -- (-1935.795) [-1934.279] (-1935.091) (-1941.673) * (-1937.349) (-1937.582) (-1932.717) [-1932.665] -- 0:01:59
409500 -- [-1933.690] (-1933.412) (-1933.074) (-1933.962) * (-1928.449) (-1933.591) [-1930.263] (-1937.703) -- 0:01:59
410000 -- [-1934.596] (-1938.656) (-1934.818) (-1931.503) * (-1940.758) (-1935.660) (-1935.260) [-1931.450] -- 0:02:00
Average standard deviation of split frequencies: 0.000000
410500 -- (-1933.674) (-1938.908) (-1935.439) [-1934.268] * [-1930.756] (-1936.572) (-1937.613) (-1936.278) -- 0:02:00
411000 -- [-1938.044] (-1936.445) (-1937.789) (-1941.641) * (-1939.048) (-1941.038) [-1938.106] (-1937.735) -- 0:02:00
411500 -- (-1939.729) [-1932.085] (-1937.807) (-1934.118) * (-1939.579) (-1945.414) [-1933.096] (-1933.993) -- 0:02:00
412000 -- [-1931.096] (-1934.454) (-1942.640) (-1935.135) * [-1937.703] (-1942.436) (-1938.203) (-1944.202) -- 0:01:59
412500 -- (-1944.515) [-1931.467] (-1936.308) (-1938.415) * (-1937.333) [-1941.130] (-1935.362) (-1938.435) -- 0:01:59
413000 -- (-1937.325) [-1934.072] (-1937.859) (-1940.462) * (-1937.406) [-1937.578] (-1939.993) (-1937.356) -- 0:01:59
413500 -- (-1934.728) (-1928.817) [-1939.152] (-1946.656) * [-1935.420] (-1936.085) (-1937.268) (-1940.197) -- 0:01:59
414000 -- (-1935.887) (-1934.726) [-1933.494] (-1942.131) * (-1932.047) [-1937.427] (-1939.610) (-1938.833) -- 0:01:58
414500 -- [-1930.350] (-1933.267) (-1935.571) (-1940.025) * (-1936.952) (-1942.171) [-1937.088] (-1936.828) -- 0:01:58
415000 -- [-1929.911] (-1932.117) (-1934.152) (-1934.023) * (-1933.040) [-1933.309] (-1938.143) (-1941.049) -- 0:01:59
Average standard deviation of split frequencies: 0.000000
415500 -- [-1938.147] (-1935.228) (-1935.741) (-1930.631) * (-1939.910) (-1932.807) [-1936.154] (-1933.288) -- 0:01:59
416000 -- (-1937.150) [-1930.743] (-1933.089) (-1931.342) * (-1933.089) [-1939.514] (-1942.535) (-1933.081) -- 0:01:59
416500 -- (-1932.736) (-1929.454) (-1938.249) [-1931.024] * (-1933.669) [-1937.074] (-1947.271) (-1936.150) -- 0:01:59
417000 -- (-1939.178) [-1932.758] (-1937.927) (-1930.755) * [-1937.187] (-1937.342) (-1933.502) (-1935.263) -- 0:01:58
417500 -- (-1936.422) (-1937.548) [-1937.425] (-1941.111) * [-1932.843] (-1935.596) (-1931.852) (-1932.565) -- 0:01:58
418000 -- (-1934.988) [-1937.428] (-1941.711) (-1935.608) * [-1930.938] (-1935.007) (-1936.338) (-1936.735) -- 0:01:58
418500 -- (-1937.792) [-1939.358] (-1947.097) (-1936.932) * (-1931.628) (-1936.940) [-1936.230] (-1930.107) -- 0:01:58
419000 -- (-1937.510) (-1936.285) (-1933.367) [-1937.297] * [-1933.033] (-1938.368) (-1936.040) (-1934.588) -- 0:01:57
419500 -- (-1935.252) (-1931.838) [-1940.324] (-1940.293) * (-1933.997) [-1935.450] (-1940.827) (-1935.804) -- 0:01:57
420000 -- (-1935.454) [-1937.531] (-1933.104) (-1934.130) * [-1934.328] (-1933.095) (-1934.681) (-1938.233) -- 0:01:58
Average standard deviation of split frequencies: 0.000000
420500 -- (-1941.015) (-1937.062) [-1932.721] (-1932.491) * (-1940.791) (-1940.954) [-1934.966] (-1938.596) -- 0:01:58
421000 -- (-1941.711) (-1941.487) [-1937.452] (-1936.777) * [-1935.151] (-1939.424) (-1933.256) (-1931.937) -- 0:01:58
421500 -- (-1938.183) (-1946.894) [-1934.599] (-1938.419) * (-1934.260) (-1938.544) [-1931.584] (-1936.163) -- 0:01:58
422000 -- [-1937.037] (-1939.006) (-1935.220) (-1932.716) * (-1935.053) (-1937.410) (-1931.192) [-1933.338] -- 0:01:57
422500 -- (-1937.451) (-1938.095) [-1929.392] (-1932.245) * (-1931.496) (-1931.994) [-1931.515] (-1942.444) -- 0:01:57
423000 -- (-1937.963) [-1935.052] (-1936.535) (-1941.598) * [-1930.920] (-1934.145) (-1936.335) (-1935.876) -- 0:01:57
423500 -- (-1931.846) [-1938.197] (-1931.229) (-1934.456) * (-1930.027) (-1939.451) (-1937.298) [-1941.366] -- 0:01:57
424000 -- (-1937.860) (-1936.393) [-1932.837] (-1942.799) * (-1935.061) (-1931.971) (-1938.687) [-1931.129] -- 0:01:56
424500 -- (-1932.959) (-1934.451) [-1933.426] (-1932.069) * (-1933.222) [-1931.504] (-1932.832) (-1935.247) -- 0:01:56
425000 -- (-1931.655) (-1936.271) (-1935.307) [-1931.192] * (-1937.012) [-1935.017] (-1934.077) (-1932.806) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
425500 -- [-1933.072] (-1935.058) (-1935.218) (-1930.590) * (-1936.726) (-1939.024) [-1930.042] (-1934.024) -- 0:01:57
426000 -- (-1934.859) (-1936.240) (-1934.157) [-1934.220] * (-1940.910) [-1934.612] (-1937.069) (-1936.583) -- 0:01:57
426500 -- (-1933.054) [-1937.102] (-1938.768) (-1932.955) * [-1935.030] (-1936.218) (-1934.036) (-1935.707) -- 0:01:56
427000 -- (-1932.661) [-1933.082] (-1928.689) (-1937.914) * (-1934.205) (-1934.185) [-1932.164] (-1939.231) -- 0:01:56
427500 -- (-1938.204) [-1937.380] (-1933.978) (-1939.267) * (-1940.465) (-1938.644) (-1933.801) [-1930.636] -- 0:01:56
428000 -- (-1936.580) [-1934.879] (-1937.885) (-1936.947) * (-1941.682) (-1938.200) [-1931.416] (-1937.506) -- 0:01:56
428500 -- (-1937.474) (-1934.974) [-1938.871] (-1937.331) * (-1936.446) (-1934.798) (-1934.792) [-1938.866] -- 0:01:57
429000 -- [-1935.202] (-1932.066) (-1931.656) (-1945.910) * (-1939.637) (-1933.290) (-1931.911) [-1947.292] -- 0:01:57
429500 -- (-1936.159) (-1931.809) (-1934.517) [-1935.886] * (-1938.072) (-1929.160) [-1937.307] (-1935.191) -- 0:01:56
430000 -- (-1935.834) [-1937.099] (-1934.254) (-1940.313) * (-1934.955) (-1936.690) [-1939.036] (-1936.010) -- 0:01:56
Average standard deviation of split frequencies: 0.000000
430500 -- [-1938.408] (-1938.865) (-1935.841) (-1939.247) * (-1931.453) (-1932.294) (-1941.202) [-1930.332] -- 0:01:56
431000 -- [-1935.734] (-1944.423) (-1933.066) (-1939.518) * [-1935.987] (-1935.095) (-1932.807) (-1936.137) -- 0:01:56
431500 -- [-1932.389] (-1938.290) (-1936.482) (-1938.384) * (-1931.682) (-1939.698) [-1937.433] (-1938.632) -- 0:01:55
432000 -- (-1936.178) (-1938.754) [-1939.241] (-1933.368) * (-1933.751) (-1937.128) [-1932.362] (-1938.350) -- 0:01:55
432500 -- (-1934.960) (-1934.465) (-1933.411) [-1939.278] * (-1942.063) (-1938.703) [-1932.161] (-1930.061) -- 0:01:55
433000 -- [-1933.409] (-1933.963) (-1934.110) (-1940.255) * (-1939.852) (-1936.777) [-1936.601] (-1935.576) -- 0:01:55
433500 -- [-1938.838] (-1934.217) (-1937.062) (-1937.877) * (-1936.296) (-1941.383) (-1942.899) [-1932.896] -- 0:01:56
434000 -- [-1931.685] (-1934.572) (-1935.392) (-1947.343) * [-1932.719] (-1938.027) (-1937.988) (-1940.873) -- 0:01:56
434500 -- (-1936.807) (-1938.497) [-1935.007] (-1936.939) * (-1937.562) (-1936.120) [-1945.436] (-1940.080) -- 0:01:55
435000 -- (-1933.598) [-1933.189] (-1938.027) (-1941.130) * (-1935.082) [-1933.702] (-1953.963) (-1937.948) -- 0:01:55
Average standard deviation of split frequencies: 0.000000
435500 -- (-1930.967) (-1935.176) (-1936.510) [-1939.166] * (-1937.375) (-1931.981) [-1934.076] (-1937.762) -- 0:01:55
436000 -- (-1934.285) (-1945.572) (-1933.568) [-1941.026] * (-1936.228) (-1931.895) [-1938.432] (-1938.204) -- 0:01:55
436500 -- (-1938.283) (-1943.408) [-1930.999] (-1935.829) * (-1934.269) (-1935.348) [-1935.573] (-1933.468) -- 0:01:54
437000 -- [-1935.938] (-1936.370) (-1936.888) (-1931.540) * (-1934.149) (-1942.900) (-1932.891) [-1934.160] -- 0:01:54
437500 -- (-1933.062) (-1933.355) (-1942.236) [-1937.645] * (-1939.340) (-1935.533) [-1936.031] (-1938.794) -- 0:01:54
438000 -- (-1937.657) [-1937.063] (-1937.147) (-1942.153) * [-1933.250] (-1937.951) (-1936.806) (-1933.770) -- 0:01:55
438500 -- [-1942.566] (-1937.977) (-1936.524) (-1934.921) * (-1938.930) (-1932.623) (-1933.056) [-1934.846] -- 0:01:55
439000 -- [-1937.357] (-1934.419) (-1928.559) (-1933.947) * [-1936.727] (-1931.988) (-1933.273) (-1937.239) -- 0:01:55
439500 -- (-1946.267) (-1932.233) [-1932.766] (-1938.527) * (-1933.730) [-1933.331] (-1937.329) (-1938.027) -- 0:01:54
440000 -- [-1938.938] (-1933.445) (-1938.355) (-1940.893) * (-1938.337) (-1935.122) [-1934.559] (-1948.046) -- 0:01:54
Average standard deviation of split frequencies: 0.000000
440500 -- (-1940.733) (-1936.078) [-1929.359] (-1937.698) * (-1938.441) (-1930.517) [-1934.911] (-1950.771) -- 0:01:54
441000 -- (-1935.117) [-1936.109] (-1938.469) (-1933.956) * (-1941.363) [-1933.146] (-1932.121) (-1938.223) -- 0:01:54
441500 -- (-1936.438) (-1934.466) [-1936.189] (-1936.506) * (-1935.961) [-1932.733] (-1939.716) (-1941.897) -- 0:01:53
442000 -- (-1941.146) [-1934.000] (-1937.333) (-1942.914) * (-1930.518) (-1941.474) (-1933.406) [-1942.611] -- 0:01:53
442500 -- (-1942.812) (-1936.409) [-1933.733] (-1938.336) * (-1932.380) (-1941.008) [-1943.251] (-1936.257) -- 0:01:53
443000 -- (-1935.237) [-1932.948] (-1936.535) (-1933.091) * [-1939.849] (-1946.149) (-1936.553) (-1936.171) -- 0:01:54
443500 -- (-1933.495) [-1940.869] (-1941.381) (-1935.821) * (-1940.501) (-1936.590) [-1932.597] (-1937.098) -- 0:01:54
444000 -- (-1936.282) [-1931.830] (-1939.758) (-1933.868) * [-1938.632] (-1939.412) (-1933.642) (-1935.085) -- 0:01:53
444500 -- (-1930.751) [-1934.253] (-1936.214) (-1936.713) * (-1941.918) (-1933.476) [-1933.911] (-1934.246) -- 0:01:53
445000 -- (-1936.580) [-1946.169] (-1933.273) (-1937.136) * (-1940.126) (-1936.291) (-1934.572) [-1936.642] -- 0:01:53
Average standard deviation of split frequencies: 0.000000
445500 -- (-1934.240) [-1940.320] (-1934.152) (-1940.217) * (-1936.073) [-1929.449] (-1950.262) (-1939.369) -- 0:01:53
446000 -- (-1936.805) [-1933.115] (-1930.915) (-1936.745) * (-1938.831) (-1935.751) (-1944.460) [-1942.600] -- 0:01:53
446500 -- (-1937.929) (-1938.487) [-1931.873] (-1935.705) * (-1944.125) (-1939.522) [-1933.431] (-1933.942) -- 0:01:52
447000 -- (-1933.578) (-1936.882) [-1932.487] (-1936.762) * (-1935.055) (-1937.906) [-1930.626] (-1936.194) -- 0:01:52
447500 -- [-1931.518] (-1934.200) (-1939.188) (-1939.253) * [-1933.140] (-1936.352) (-1946.067) (-1939.383) -- 0:01:53
448000 -- [-1931.603] (-1939.102) (-1934.318) (-1934.571) * [-1931.256] (-1934.581) (-1937.626) (-1938.366) -- 0:01:53
448500 -- (-1934.163) [-1939.292] (-1934.644) (-1934.766) * [-1934.127] (-1942.510) (-1947.849) (-1941.610) -- 0:01:53
449000 -- (-1932.079) (-1936.336) (-1930.403) [-1931.723] * (-1942.165) (-1942.042) [-1931.703] (-1945.746) -- 0:01:52
449500 -- [-1933.722] (-1940.494) (-1937.420) (-1935.361) * (-1937.511) (-1935.779) (-1936.803) [-1936.488] -- 0:01:52
450000 -- (-1932.648) (-1943.481) [-1936.611] (-1940.712) * (-1936.854) [-1935.984] (-1939.734) (-1934.855) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
450500 -- (-1933.962) [-1934.792] (-1931.650) (-1942.295) * (-1934.303) (-1937.785) (-1934.982) [-1934.940] -- 0:01:52
451000 -- [-1938.323] (-1937.391) (-1941.053) (-1937.425) * (-1933.183) (-1940.472) [-1933.405] (-1933.166) -- 0:01:51
451500 -- (-1940.701) (-1935.819) (-1940.971) [-1937.384] * [-1934.625] (-1939.274) (-1932.392) (-1934.016) -- 0:01:51
452000 -- (-1940.602) (-1936.583) [-1940.175] (-1931.266) * (-1934.515) (-1931.466) [-1937.973] (-1937.771) -- 0:01:51
452500 -- [-1936.099] (-1942.863) (-1938.760) (-1934.561) * (-1939.971) (-1934.712) (-1932.973) [-1933.724] -- 0:01:52
453000 -- (-1936.125) [-1934.549] (-1937.404) (-1937.824) * (-1942.051) (-1933.309) [-1933.042] (-1932.262) -- 0:01:52
453500 -- [-1933.809] (-1940.883) (-1935.267) (-1940.754) * (-1944.718) (-1932.799) (-1933.078) [-1933.901] -- 0:01:52
454000 -- [-1933.286] (-1941.622) (-1935.654) (-1936.186) * (-1937.402) (-1936.400) [-1933.882] (-1938.853) -- 0:01:51
454500 -- (-1934.347) (-1936.319) [-1931.981] (-1935.730) * [-1936.375] (-1935.766) (-1936.760) (-1936.713) -- 0:01:51
455000 -- (-1937.880) (-1936.258) (-1937.197) [-1932.500] * (-1935.360) [-1939.070] (-1933.590) (-1941.913) -- 0:01:51
Average standard deviation of split frequencies: 0.000000
455500 -- (-1933.839) [-1936.487] (-1940.512) (-1936.734) * (-1933.703) (-1936.497) (-1936.384) [-1930.026] -- 0:01:51
456000 -- (-1931.919) (-1931.413) (-1936.239) [-1941.449] * (-1936.190) (-1935.802) (-1935.325) [-1936.813] -- 0:01:50
456500 -- (-1936.180) (-1933.713) (-1942.854) [-1932.803] * (-1940.124) (-1936.123) [-1940.211] (-1938.186) -- 0:01:50
457000 -- [-1930.865] (-1933.358) (-1934.753) (-1932.501) * (-1932.434) (-1931.768) [-1930.847] (-1935.482) -- 0:01:51
457500 -- (-1937.097) (-1933.825) (-1934.529) [-1929.309] * (-1935.888) (-1941.314) [-1939.186] (-1941.005) -- 0:01:51
458000 -- [-1932.417] (-1937.764) (-1932.617) (-1934.118) * (-1933.120) (-1939.894) [-1931.189] (-1936.225) -- 0:01:51
458500 -- [-1935.620] (-1931.871) (-1930.082) (-1930.855) * (-1935.538) (-1935.783) (-1939.746) [-1936.130] -- 0:01:51
459000 -- (-1936.063) [-1932.876] (-1934.338) (-1934.805) * (-1938.697) (-1936.102) [-1937.847] (-1929.744) -- 0:01:50
459500 -- (-1936.713) (-1933.514) [-1934.194] (-1936.723) * [-1937.064] (-1933.777) (-1943.295) (-1933.820) -- 0:01:50
460000 -- (-1938.175) (-1937.593) (-1935.814) [-1936.551] * (-1933.332) (-1939.446) (-1934.474) [-1935.198] -- 0:01:50
Average standard deviation of split frequencies: 0.000000
460500 -- [-1936.316] (-1935.032) (-1938.794) (-1936.369) * (-1934.347) (-1934.164) [-1937.876] (-1939.871) -- 0:01:50
461000 -- (-1936.704) (-1936.781) (-1938.210) [-1933.366] * (-1934.823) (-1934.599) (-1933.958) [-1942.402] -- 0:01:49
461500 -- (-1934.028) [-1937.253] (-1943.121) (-1935.238) * (-1938.263) [-1935.561] (-1933.240) (-1941.497) -- 0:01:49
462000 -- (-1935.969) (-1934.353) (-1935.104) [-1931.990] * [-1939.184] (-1938.526) (-1936.371) (-1937.486) -- 0:01:50
462500 -- (-1935.458) (-1936.903) (-1932.558) [-1941.573] * (-1936.636) (-1940.999) [-1933.605] (-1942.093) -- 0:01:50
463000 -- [-1933.823] (-1940.023) (-1938.583) (-1941.074) * (-1931.925) [-1937.224] (-1935.715) (-1937.661) -- 0:01:50
463500 -- (-1933.601) (-1932.021) [-1933.034] (-1945.693) * [-1932.529] (-1937.052) (-1934.002) (-1934.809) -- 0:01:49
464000 -- (-1936.617) (-1933.227) [-1934.787] (-1934.127) * (-1937.661) [-1932.944] (-1935.315) (-1935.484) -- 0:01:49
464500 -- (-1939.933) [-1939.616] (-1938.692) (-1936.292) * (-1937.544) [-1933.508] (-1936.647) (-1936.966) -- 0:01:49
465000 -- (-1936.396) [-1931.795] (-1934.841) (-1932.601) * (-1932.247) (-1934.884) (-1939.444) [-1943.638] -- 0:01:49
Average standard deviation of split frequencies: 0.000000
465500 -- (-1936.359) (-1937.070) [-1934.465] (-1935.539) * (-1932.857) (-1933.825) (-1940.838) [-1936.349] -- 0:01:50
466000 -- (-1935.457) [-1933.483] (-1936.938) (-1936.382) * (-1936.850) (-1933.634) [-1934.946] (-1934.033) -- 0:01:50
466500 -- [-1937.239] (-1937.111) (-1935.429) (-1931.096) * (-1935.576) [-1932.742] (-1938.835) (-1932.777) -- 0:01:49
467000 -- (-1936.222) (-1942.369) (-1941.255) [-1935.067] * (-1937.603) (-1929.677) (-1940.503) [-1935.521] -- 0:01:49
467500 -- (-1934.679) [-1933.083] (-1950.085) (-1935.814) * (-1931.329) (-1937.821) (-1931.283) [-1934.262] -- 0:01:49
468000 -- (-1935.407) [-1934.255] (-1937.768) (-1938.869) * (-1933.964) (-1935.530) [-1939.008] (-1940.997) -- 0:01:49
468500 -- [-1932.653] (-1934.435) (-1933.017) (-1936.139) * (-1938.330) (-1929.675) (-1939.595) [-1934.310] -- 0:01:48
469000 -- (-1941.111) (-1939.117) (-1933.157) [-1940.229] * [-1934.488] (-1931.052) (-1947.187) (-1930.727) -- 0:01:48
469500 -- [-1929.302] (-1933.864) (-1935.563) (-1937.549) * (-1937.431) (-1933.317) (-1942.674) [-1932.427] -- 0:01:48
470000 -- (-1941.525) (-1937.972) [-1936.257] (-1935.052) * (-1933.774) (-1937.048) (-1938.108) [-1933.935] -- 0:01:48
Average standard deviation of split frequencies: 0.000000
470500 -- (-1933.745) (-1933.438) (-1936.713) [-1932.748] * (-1935.145) (-1938.651) [-1939.804] (-1939.246) -- 0:01:49
471000 -- (-1940.034) (-1936.213) (-1935.963) [-1932.703] * (-1933.068) (-1941.146) [-1932.826] (-1937.722) -- 0:01:48
471500 -- (-1935.263) (-1937.217) [-1935.643] (-1933.693) * (-1934.342) (-1935.812) (-1945.861) [-1936.432] -- 0:01:48
472000 -- (-1936.224) (-1937.366) [-1937.325] (-1940.107) * [-1942.768] (-1934.415) (-1937.793) (-1930.682) -- 0:01:48
472500 -- (-1943.820) (-1936.830) (-1941.237) [-1931.926] * (-1934.613) (-1936.935) (-1934.084) [-1936.409] -- 0:01:48
473000 -- (-1933.286) (-1951.629) [-1932.895] (-1932.172) * (-1935.939) [-1935.144] (-1939.686) (-1931.731) -- 0:01:48
473500 -- [-1930.813] (-1933.030) (-1937.479) (-1932.890) * (-1932.792) [-1933.402] (-1937.878) (-1939.818) -- 0:01:47
474000 -- [-1933.051] (-1935.215) (-1935.686) (-1941.652) * (-1937.510) [-1935.032] (-1941.545) (-1932.536) -- 0:01:47
474500 -- (-1937.600) [-1936.496] (-1930.300) (-1936.735) * [-1932.270] (-1938.794) (-1940.347) (-1940.041) -- 0:01:47
475000 -- (-1937.407) (-1934.525) (-1940.322) [-1935.869] * (-1934.654) (-1936.262) (-1938.700) [-1936.907] -- 0:01:47
Average standard deviation of split frequencies: 0.000000
475500 -- (-1945.569) (-1936.541) (-1935.434) [-1935.145] * (-1933.694) [-1932.193] (-1934.304) (-1932.822) -- 0:01:48
476000 -- (-1941.898) (-1933.966) (-1936.578) [-1931.852] * [-1932.994] (-1935.077) (-1935.046) (-1941.268) -- 0:01:47
476500 -- (-1940.132) (-1933.325) [-1935.688] (-1931.015) * (-1935.327) (-1936.478) (-1940.110) [-1938.436] -- 0:01:47
477000 -- [-1932.013] (-1931.421) (-1938.209) (-1938.347) * (-1935.512) (-1938.419) (-1943.481) [-1939.978] -- 0:01:47
477500 -- (-1937.395) (-1931.415) (-1939.814) [-1936.692] * [-1934.174] (-1937.102) (-1940.226) (-1945.939) -- 0:01:47
478000 -- [-1933.036] (-1942.083) (-1939.132) (-1940.241) * (-1934.051) [-1934.207] (-1936.535) (-1939.181) -- 0:01:47
478500 -- [-1933.423] (-1935.633) (-1940.115) (-1939.091) * (-1932.595) (-1937.963) [-1937.467] (-1931.601) -- 0:01:46
479000 -- (-1937.929) [-1937.918] (-1935.937) (-1941.816) * [-1934.385] (-1936.059) (-1932.993) (-1929.322) -- 0:01:46
479500 -- (-1932.483) (-1936.030) (-1936.803) [-1933.937] * (-1933.641) (-1932.948) [-1937.007] (-1931.520) -- 0:01:46
480000 -- (-1938.340) (-1937.330) [-1942.119] (-1937.162) * (-1936.358) [-1932.993] (-1937.831) (-1935.136) -- 0:01:46
Average standard deviation of split frequencies: 0.000000
480500 -- (-1938.471) (-1933.497) (-1935.499) [-1934.774] * [-1943.006] (-1937.737) (-1933.662) (-1933.099) -- 0:01:47
481000 -- (-1932.378) (-1933.861) [-1935.576] (-1932.949) * [-1941.882] (-1937.178) (-1930.357) (-1938.692) -- 0:01:46
481500 -- (-1939.695) (-1931.870) (-1937.858) [-1935.742] * (-1945.795) (-1942.205) (-1938.179) [-1940.101] -- 0:01:46
482000 -- (-1934.988) [-1934.950] (-1939.515) (-1936.006) * [-1939.368] (-1930.885) (-1932.649) (-1937.124) -- 0:01:46
482500 -- (-1932.751) (-1941.104) [-1936.719] (-1939.825) * (-1940.399) [-1933.677] (-1932.734) (-1941.316) -- 0:01:46
483000 -- [-1935.170] (-1937.482) (-1940.292) (-1945.829) * (-1938.275) (-1935.276) [-1934.653] (-1943.212) -- 0:01:45
483500 -- (-1937.646) [-1932.160] (-1932.625) (-1940.817) * (-1934.098) [-1933.613] (-1936.227) (-1936.743) -- 0:01:45
484000 -- (-1934.637) (-1933.905) (-1932.319) [-1938.452] * [-1936.991] (-1935.146) (-1942.324) (-1942.661) -- 0:01:45
484500 -- (-1936.875) (-1935.237) [-1939.781] (-1940.613) * (-1937.688) [-1933.872] (-1940.896) (-1933.804) -- 0:01:45
485000 -- (-1939.302) [-1934.219] (-1933.888) (-1932.220) * (-1935.138) (-1932.208) (-1938.660) [-1933.085] -- 0:01:45
Average standard deviation of split frequencies: 0.000000
485500 -- [-1932.009] (-1932.651) (-1933.981) (-1938.471) * [-1930.517] (-1938.141) (-1942.866) (-1936.731) -- 0:01:45
486000 -- [-1938.973] (-1937.584) (-1937.588) (-1937.968) * [-1935.833] (-1936.245) (-1948.411) (-1935.239) -- 0:01:45
486500 -- (-1936.046) (-1937.420) (-1936.604) [-1934.728] * (-1931.608) (-1935.144) (-1938.774) [-1937.300] -- 0:01:45
487000 -- (-1936.394) (-1931.899) [-1931.855] (-1936.820) * (-1935.708) (-1936.745) [-1934.690] (-1937.162) -- 0:01:45
487500 -- (-1937.571) (-1934.452) (-1938.258) [-1932.972] * (-1940.692) (-1938.609) (-1935.088) [-1936.471] -- 0:01:45
488000 -- (-1938.943) (-1939.601) [-1935.690] (-1936.639) * (-1938.985) (-1936.423) [-1933.732] (-1935.500) -- 0:01:44
488500 -- [-1931.723] (-1942.667) (-1935.214) (-1933.480) * (-1941.748) [-1933.584] (-1936.711) (-1939.881) -- 0:01:44
489000 -- (-1933.163) (-1947.445) (-1940.125) [-1936.394] * (-1934.272) (-1936.635) (-1939.583) [-1940.376] -- 0:01:44
489500 -- (-1936.889) (-1934.398) (-1937.390) [-1934.282] * (-1938.772) (-1940.082) [-1934.969] (-1937.521) -- 0:01:44
490000 -- (-1934.577) (-1940.500) [-1934.595] (-1934.765) * [-1935.736] (-1935.518) (-1939.195) (-1931.192) -- 0:01:45
Average standard deviation of split frequencies: 0.000000
490500 -- [-1933.940] (-1933.707) (-1932.848) (-1942.630) * (-1938.782) [-1938.878] (-1936.600) (-1939.256) -- 0:01:44
491000 -- [-1935.691] (-1929.564) (-1938.407) (-1938.733) * [-1935.018] (-1933.557) (-1938.730) (-1932.440) -- 0:01:44
491500 -- (-1932.641) [-1930.199] (-1930.553) (-1931.560) * (-1940.490) [-1936.174] (-1932.509) (-1935.138) -- 0:01:44
492000 -- (-1936.853) [-1939.870] (-1936.855) (-1936.637) * (-1934.448) (-1938.334) (-1942.464) [-1934.299] -- 0:01:44
492500 -- (-1938.365) [-1938.179] (-1935.976) (-1935.562) * (-1936.789) (-1942.100) (-1937.897) [-1933.738] -- 0:01:44
493000 -- (-1941.137) (-1938.983) (-1934.256) [-1934.059] * (-1935.933) (-1937.428) (-1939.356) [-1936.608] -- 0:01:43
493500 -- (-1937.346) (-1942.832) [-1939.726] (-1935.842) * [-1933.624] (-1932.445) (-1933.347) (-1941.263) -- 0:01:43
494000 -- [-1935.671] (-1940.865) (-1938.532) (-1937.710) * (-1933.210) (-1931.176) [-1933.996] (-1939.596) -- 0:01:43
494500 -- (-1934.727) (-1941.306) [-1933.271] (-1939.786) * [-1935.444] (-1935.005) (-1932.118) (-1932.181) -- 0:01:44
495000 -- [-1932.145] (-1941.215) (-1941.243) (-1937.397) * (-1930.620) [-1936.474] (-1930.603) (-1938.015) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
495500 -- (-1934.314) (-1931.710) [-1933.107] (-1938.552) * (-1932.463) (-1933.151) [-1937.876] (-1942.753) -- 0:01:43
496000 -- (-1936.621) (-1938.386) (-1933.009) [-1934.608] * [-1937.016] (-1937.222) (-1939.426) (-1930.609) -- 0:01:43
496500 -- (-1934.213) [-1932.189] (-1931.134) (-1937.662) * (-1935.980) [-1937.082] (-1939.755) (-1936.864) -- 0:01:43
497000 -- (-1934.416) [-1934.778] (-1929.657) (-1939.628) * (-1938.603) [-1933.992] (-1941.899) (-1933.375) -- 0:01:43
497500 -- (-1933.729) [-1936.772] (-1936.304) (-1939.610) * (-1944.678) [-1934.759] (-1936.392) (-1928.920) -- 0:01:43
498000 -- [-1932.695] (-1934.313) (-1942.658) (-1931.965) * (-1940.336) (-1939.737) [-1934.712] (-1931.480) -- 0:01:43
498500 -- (-1931.813) (-1944.808) (-1941.681) [-1935.476] * (-1937.784) (-1935.073) [-1934.363] (-1937.427) -- 0:01:43
499000 -- (-1934.842) (-1938.786) (-1934.029) [-1930.426] * (-1937.006) [-1935.277] (-1938.119) (-1935.566) -- 0:01:43
499500 -- [-1935.926] (-1935.485) (-1929.268) (-1933.065) * (-1937.996) (-1931.424) [-1930.508] (-1934.173) -- 0:01:43
500000 -- (-1935.512) (-1935.086) (-1933.052) [-1934.164] * (-1941.044) (-1930.941) (-1937.453) [-1931.793] -- 0:01:43
Average standard deviation of split frequencies: 0.000000
500500 -- [-1934.781] (-1941.821) (-1934.095) (-1932.574) * (-1938.400) (-1932.176) [-1936.644] (-1938.289) -- 0:01:42
501000 -- (-1936.199) (-1934.053) (-1941.163) [-1931.905] * (-1936.784) (-1932.112) (-1937.375) [-1938.113] -- 0:01:42
501500 -- (-1932.968) [-1934.436] (-1934.430) (-1944.539) * (-1939.636) (-1937.766) (-1939.494) [-1930.127] -- 0:01:42
502000 -- [-1932.196] (-1937.687) (-1938.721) (-1931.870) * (-1934.656) [-1929.974] (-1935.572) (-1931.399) -- 0:01:42
502500 -- [-1931.401] (-1932.108) (-1930.432) (-1937.288) * [-1935.556] (-1932.869) (-1937.027) (-1944.063) -- 0:01:41
503000 -- (-1929.548) (-1933.835) (-1938.561) [-1929.092] * [-1938.577] (-1933.611) (-1937.278) (-1941.713) -- 0:01:42
503500 -- (-1934.330) [-1936.855] (-1931.170) (-1935.125) * (-1936.716) (-1934.911) (-1938.081) [-1935.637] -- 0:01:42
504000 -- (-1934.067) (-1940.526) [-1932.726] (-1939.638) * (-1934.570) [-1939.829] (-1942.495) (-1930.823) -- 0:01:42
504500 -- [-1939.830] (-1940.277) (-1940.246) (-1937.905) * (-1937.896) [-1934.923] (-1934.844) (-1934.195) -- 0:01:42
505000 -- (-1941.855) (-1937.911) (-1935.568) [-1933.814] * (-1936.136) (-1940.252) (-1940.731) [-1933.425] -- 0:01:41
Average standard deviation of split frequencies: 0.000000
505500 -- (-1933.985) [-1934.848] (-1931.723) (-1936.741) * (-1939.053) [-1933.314] (-1942.141) (-1938.435) -- 0:01:41
506000 -- (-1934.560) (-1948.395) [-1929.859] (-1936.432) * [-1937.752] (-1940.077) (-1934.060) (-1938.676) -- 0:01:41
506500 -- (-1939.178) (-1934.018) [-1931.231] (-1932.276) * (-1933.483) (-1943.188) (-1940.240) [-1931.791] -- 0:01:41
507000 -- (-1938.622) (-1939.232) [-1931.542] (-1937.728) * (-1938.930) [-1934.179] (-1940.332) (-1934.348) -- 0:01:41
507500 -- (-1934.323) [-1937.653] (-1934.583) (-1935.908) * (-1941.152) (-1940.321) (-1938.953) [-1933.980] -- 0:01:41
508000 -- [-1934.784] (-1936.783) (-1935.646) (-1937.689) * [-1933.992] (-1938.702) (-1936.300) (-1934.874) -- 0:01:41
508500 -- [-1930.953] (-1930.074) (-1933.870) (-1933.965) * [-1934.829] (-1935.851) (-1936.070) (-1937.985) -- 0:01:41
509000 -- [-1930.189] (-1932.168) (-1933.881) (-1936.714) * (-1933.731) (-1935.556) [-1934.904] (-1935.424) -- 0:01:41
509500 -- (-1935.925) (-1937.723) [-1935.918] (-1941.702) * [-1935.154] (-1939.408) (-1934.333) (-1934.678) -- 0:01:41
510000 -- (-1930.501) (-1937.169) [-1936.350] (-1932.365) * [-1940.376] (-1932.393) (-1937.769) (-1938.295) -- 0:01:40
Average standard deviation of split frequencies: 0.000000
510500 -- (-1931.495) [-1937.501] (-1933.251) (-1935.236) * (-1933.005) (-1932.100) (-1937.368) [-1937.960] -- 0:01:40
511000 -- (-1934.321) (-1935.762) (-1936.812) [-1933.985] * [-1934.110] (-1931.690) (-1932.148) (-1937.587) -- 0:01:40
511500 -- (-1938.018) [-1934.559] (-1934.937) (-1941.834) * (-1941.796) [-1944.541] (-1933.625) (-1939.455) -- 0:01:40
512000 -- (-1932.482) [-1936.659] (-1935.034) (-1940.330) * (-1935.852) (-1936.274) (-1949.426) [-1936.354] -- 0:01:40
512500 -- [-1933.599] (-1937.065) (-1937.573) (-1941.958) * [-1941.308] (-1937.948) (-1936.823) (-1942.912) -- 0:01:40
513000 -- [-1935.647] (-1947.638) (-1932.092) (-1937.544) * [-1934.658] (-1935.936) (-1939.748) (-1936.177) -- 0:01:40
513500 -- (-1943.505) [-1936.179] (-1933.377) (-1930.241) * [-1933.221] (-1934.081) (-1940.267) (-1936.982) -- 0:01:40
514000 -- (-1934.618) (-1933.339) [-1936.361] (-1936.234) * (-1937.028) [-1933.693] (-1941.004) (-1934.301) -- 0:01:40
514500 -- (-1935.373) (-1943.230) [-1938.710] (-1929.767) * (-1939.465) (-1937.823) (-1939.460) [-1933.976] -- 0:01:40
515000 -- (-1935.044) (-1937.858) (-1945.395) [-1931.953] * (-1939.294) [-1933.386] (-1940.143) (-1936.971) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
515500 -- (-1929.945) [-1936.437] (-1935.401) (-1933.449) * (-1944.222) (-1939.441) [-1932.340] (-1934.708) -- 0:01:39
516000 -- [-1934.441] (-1935.387) (-1937.034) (-1936.194) * (-1935.514) (-1938.052) [-1934.780] (-1930.748) -- 0:01:39
516500 -- (-1935.924) (-1944.112) [-1938.025] (-1937.114) * (-1935.034) (-1946.205) (-1935.290) [-1932.909] -- 0:01:39
517000 -- (-1938.222) [-1938.931] (-1931.984) (-1936.014) * (-1941.052) (-1936.289) [-1933.394] (-1935.565) -- 0:01:39
517500 -- [-1937.816] (-1932.708) (-1934.189) (-1936.107) * [-1934.750] (-1939.614) (-1934.762) (-1933.025) -- 0:01:39
518000 -- [-1938.778] (-1938.052) (-1936.934) (-1939.067) * (-1934.768) (-1942.847) (-1934.112) [-1934.583] -- 0:01:39
518500 -- (-1938.303) (-1933.185) (-1942.212) [-1937.358] * (-1936.761) (-1935.512) [-1929.469] (-1933.897) -- 0:01:39
519000 -- (-1931.371) (-1934.333) (-1931.796) [-1939.528] * (-1932.925) (-1941.116) (-1932.559) [-1937.517] -- 0:01:39
519500 -- (-1935.247) (-1935.884) (-1935.528) [-1935.995] * (-1935.107) (-1936.763) (-1940.868) [-1934.641] -- 0:01:38
520000 -- (-1934.536) (-1942.846) (-1939.873) [-1937.675] * [-1933.581] (-1938.698) (-1937.603) (-1936.482) -- 0:01:38
Average standard deviation of split frequencies: 0.000000
520500 -- (-1935.070) (-1941.205) (-1935.346) [-1933.556] * (-1934.534) (-1932.822) (-1941.002) [-1933.972] -- 0:01:38
521000 -- (-1937.685) (-1939.490) [-1936.682] (-1951.110) * (-1933.116) [-1933.852] (-1936.760) (-1936.610) -- 0:01:38
521500 -- (-1939.843) (-1937.535) (-1934.867) [-1939.952] * (-1933.176) [-1938.565] (-1935.701) (-1940.726) -- 0:01:38
522000 -- (-1946.318) [-1939.437] (-1931.425) (-1936.374) * (-1934.597) (-1936.291) [-1938.112] (-1933.532) -- 0:01:38
522500 -- (-1937.443) (-1941.974) (-1934.817) [-1933.080] * (-1932.328) (-1941.176) [-1935.759] (-1938.629) -- 0:01:38
523000 -- (-1940.120) (-1940.442) [-1933.187] (-1935.653) * (-1942.121) (-1939.253) [-1935.666] (-1934.246) -- 0:01:38
523500 -- (-1936.763) (-1941.309) (-1939.885) [-1932.937] * [-1931.822] (-1946.247) (-1933.832) (-1933.676) -- 0:01:38
524000 -- (-1936.553) (-1935.733) (-1936.220) [-1934.181] * [-1935.094] (-1942.869) (-1944.559) (-1939.298) -- 0:01:38
524500 -- (-1936.048) (-1936.602) (-1939.343) [-1935.035] * [-1935.866] (-1944.905) (-1935.572) (-1935.059) -- 0:01:37
525000 -- [-1930.688] (-1932.788) (-1936.395) (-1938.175) * [-1936.431] (-1947.980) (-1934.453) (-1935.913) -- 0:01:37
Average standard deviation of split frequencies: 0.000000
525500 -- (-1934.740) (-1939.333) (-1941.436) [-1933.384] * (-1931.357) [-1941.141] (-1932.756) (-1930.447) -- 0:01:37
526000 -- (-1934.426) (-1937.824) (-1937.517) [-1936.389] * (-1936.719) (-1939.286) (-1929.550) [-1936.166] -- 0:01:37
526500 -- (-1933.829) [-1931.146] (-1930.499) (-1934.805) * (-1931.309) (-1937.888) (-1938.208) [-1931.752] -- 0:01:38
527000 -- (-1931.065) (-1939.357) [-1932.132] (-1935.978) * [-1934.917] (-1933.408) (-1934.821) (-1932.186) -- 0:01:37
527500 -- (-1932.834) (-1939.243) [-1930.699] (-1937.500) * (-1937.880) (-1932.892) [-1935.285] (-1933.155) -- 0:01:37
528000 -- (-1939.207) [-1933.650] (-1938.746) (-1933.224) * [-1939.230] (-1935.455) (-1934.802) (-1937.690) -- 0:01:37
528500 -- (-1935.008) [-1934.057] (-1941.158) (-1938.952) * (-1940.724) [-1936.954] (-1941.864) (-1934.516) -- 0:01:37
529000 -- (-1935.544) (-1934.712) (-1935.435) [-1935.500] * [-1933.918] (-1938.417) (-1935.288) (-1937.985) -- 0:01:37
529500 -- (-1940.189) [-1934.071] (-1944.340) (-1937.421) * [-1933.569] (-1938.117) (-1937.694) (-1940.960) -- 0:01:36
530000 -- (-1936.605) (-1936.317) [-1936.141] (-1937.485) * (-1938.781) (-1935.811) (-1934.886) [-1929.847] -- 0:01:36
Average standard deviation of split frequencies: 0.000000
530500 -- (-1947.767) (-1939.811) (-1948.949) [-1935.760] * (-1932.416) (-1934.359) [-1934.258] (-1933.457) -- 0:01:36
531000 -- (-1934.597) (-1941.230) (-1938.163) [-1931.841] * (-1937.014) [-1933.757] (-1936.909) (-1933.326) -- 0:01:36
531500 -- [-1934.498] (-1940.207) (-1936.889) (-1942.718) * (-1934.204) [-1931.370] (-1937.665) (-1931.013) -- 0:01:36
532000 -- (-1934.908) (-1929.537) [-1934.330] (-1936.071) * (-1937.423) [-1936.989] (-1936.034) (-1932.195) -- 0:01:36
532500 -- [-1930.816] (-1931.791) (-1932.516) (-1934.783) * [-1934.984] (-1938.490) (-1939.339) (-1937.132) -- 0:01:36
533000 -- (-1937.688) [-1934.431] (-1936.211) (-1939.216) * (-1934.720) (-1940.135) (-1938.439) [-1933.518] -- 0:01:36
533500 -- (-1935.660) (-1935.554) (-1931.976) [-1933.065] * (-1939.534) [-1935.714] (-1938.444) (-1932.052) -- 0:01:36
534000 -- [-1938.871] (-1935.520) (-1931.650) (-1939.919) * (-1935.072) (-1941.940) [-1939.777] (-1934.834) -- 0:01:35
534500 -- (-1937.308) (-1938.057) [-1936.412] (-1935.334) * [-1937.386] (-1938.065) (-1939.922) (-1940.247) -- 0:01:35
535000 -- (-1938.604) [-1938.645] (-1934.481) (-1930.777) * (-1940.682) (-1933.026) (-1945.945) [-1934.123] -- 0:01:35
Average standard deviation of split frequencies: 0.000000
535500 -- (-1936.154) [-1934.153] (-1936.611) (-1938.114) * [-1935.607] (-1944.318) (-1932.090) (-1935.398) -- 0:01:35
536000 -- (-1936.909) (-1930.810) [-1939.144] (-1931.834) * [-1935.121] (-1936.348) (-1932.193) (-1932.323) -- 0:01:36
536500 -- (-1933.327) (-1939.339) [-1937.696] (-1935.026) * [-1931.490] (-1939.474) (-1941.026) (-1936.343) -- 0:01:35
537000 -- (-1934.922) (-1939.548) (-1937.084) [-1931.388] * (-1938.276) (-1931.239) [-1937.718] (-1944.137) -- 0:01:35
537500 -- (-1932.613) [-1931.599] (-1933.943) (-1934.387) * (-1941.486) (-1940.507) (-1934.275) [-1931.102] -- 0:01:35
538000 -- (-1941.622) (-1942.005) (-1943.678) [-1935.487] * (-1933.754) (-1940.869) [-1933.450] (-1936.132) -- 0:01:35
538500 -- (-1933.402) [-1930.854] (-1939.385) (-1934.631) * [-1935.028] (-1932.767) (-1934.871) (-1933.240) -- 0:01:35
539000 -- [-1932.679] (-1932.851) (-1930.274) (-1939.015) * (-1935.784) [-1940.240] (-1934.678) (-1943.237) -- 0:01:34
539500 -- [-1933.087] (-1935.164) (-1934.852) (-1933.412) * [-1930.444] (-1935.829) (-1938.437) (-1933.002) -- 0:01:34
540000 -- (-1943.588) [-1937.631] (-1935.664) (-1933.125) * [-1936.196] (-1938.648) (-1948.538) (-1932.560) -- 0:01:34
Average standard deviation of split frequencies: 0.000000
540500 -- [-1932.445] (-1935.892) (-1936.615) (-1937.876) * [-1934.371] (-1936.722) (-1943.576) (-1938.905) -- 0:01:34
541000 -- (-1933.156) (-1937.742) [-1935.367] (-1936.191) * (-1939.065) [-1933.912] (-1935.555) (-1935.940) -- 0:01:35
541500 -- (-1940.123) (-1935.170) (-1934.117) [-1931.019] * [-1936.805] (-1934.179) (-1939.909) (-1934.218) -- 0:01:34
542000 -- (-1934.808) [-1936.547] (-1937.190) (-1935.478) * [-1934.756] (-1938.185) (-1935.267) (-1934.627) -- 0:01:34
542500 -- (-1934.717) (-1943.192) (-1941.565) [-1934.134] * (-1932.551) (-1935.637) [-1935.787] (-1933.080) -- 0:01:34
543000 -- (-1934.670) (-1939.572) (-1933.757) [-1934.806] * (-1945.063) (-1932.641) [-1939.014] (-1937.879) -- 0:01:34
543500 -- [-1931.930] (-1940.258) (-1935.922) (-1942.409) * (-1936.155) (-1934.592) [-1936.300] (-1935.764) -- 0:01:34
544000 -- (-1938.439) (-1935.771) [-1940.723] (-1935.210) * (-1936.017) (-1938.454) [-1935.037] (-1935.851) -- 0:01:33
544500 -- (-1940.053) [-1932.892] (-1936.283) (-1937.354) * (-1936.955) (-1937.527) (-1936.058) [-1934.824] -- 0:01:33
545000 -- (-1938.957) (-1936.441) [-1940.895] (-1938.958) * (-1934.500) (-1941.054) [-1939.620] (-1933.874) -- 0:01:33
Average standard deviation of split frequencies: 0.000000
545500 -- (-1938.512) (-1937.029) (-1937.267) [-1936.971] * [-1934.571] (-1940.251) (-1937.873) (-1935.545) -- 0:01:34
546000 -- [-1941.611] (-1933.785) (-1939.258) (-1934.683) * (-1938.052) [-1934.755] (-1931.904) (-1938.007) -- 0:01:33
546500 -- (-1943.071) (-1939.992) (-1939.134) [-1933.585] * (-1932.181) (-1934.514) (-1935.184) [-1934.402] -- 0:01:33
547000 -- (-1934.378) [-1933.685] (-1940.298) (-1931.099) * (-1938.773) (-1935.531) (-1935.624) [-1938.921] -- 0:01:33
547500 -- (-1934.226) (-1933.683) [-1937.127] (-1931.773) * (-1936.803) (-1928.454) (-1935.394) [-1932.882] -- 0:01:33
548000 -- [-1939.821] (-1937.851) (-1934.619) (-1934.052) * [-1933.457] (-1931.795) (-1935.125) (-1935.339) -- 0:01:33
548500 -- (-1934.316) [-1936.365] (-1934.097) (-1939.795) * [-1937.171] (-1931.505) (-1931.487) (-1935.593) -- 0:01:33
549000 -- (-1932.961) (-1936.384) [-1932.057] (-1941.177) * (-1941.056) [-1935.806] (-1934.770) (-1943.583) -- 0:01:32
549500 -- (-1938.621) [-1930.819] (-1937.024) (-1943.420) * (-1940.182) [-1933.458] (-1941.261) (-1934.705) -- 0:01:32
550000 -- [-1933.025] (-1932.969) (-1933.858) (-1946.195) * (-1937.240) (-1940.611) [-1938.730] (-1933.709) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
550500 -- (-1934.312) [-1935.972] (-1934.666) (-1939.760) * (-1941.201) [-1937.174] (-1943.400) (-1933.305) -- 0:01:33
551000 -- [-1934.527] (-1937.542) (-1932.934) (-1942.729) * (-1932.129) (-1936.270) (-1934.913) [-1935.774] -- 0:01:32
551500 -- [-1933.125] (-1943.672) (-1936.100) (-1938.966) * [-1933.919] (-1939.273) (-1937.370) (-1931.024) -- 0:01:32
552000 -- (-1936.096) (-1934.321) [-1936.156] (-1938.171) * [-1935.398] (-1938.786) (-1941.103) (-1936.270) -- 0:01:32
552500 -- (-1939.372) (-1945.455) [-1932.838] (-1939.668) * [-1934.319] (-1933.121) (-1938.703) (-1940.272) -- 0:01:32
553000 -- (-1936.701) (-1941.242) [-1934.400] (-1943.052) * (-1935.896) (-1935.135) (-1937.764) [-1936.453] -- 0:01:32
553500 -- (-1947.211) (-1946.370) (-1934.667) [-1934.591] * [-1939.908] (-1933.910) (-1934.468) (-1936.503) -- 0:01:31
554000 -- (-1935.789) (-1940.426) [-1936.404] (-1943.676) * [-1931.786] (-1934.037) (-1935.931) (-1941.824) -- 0:01:31
554500 -- [-1937.652] (-1935.214) (-1938.963) (-1939.263) * (-1938.628) [-1932.630] (-1931.412) (-1941.870) -- 0:01:31
555000 -- (-1939.612) (-1937.570) (-1933.714) [-1936.584] * (-1930.878) [-1935.955] (-1935.674) (-1939.014) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
555500 -- (-1939.002) (-1936.816) [-1931.143] (-1931.568) * (-1942.987) (-1935.163) (-1933.184) [-1935.532] -- 0:01:32
556000 -- (-1942.810) [-1934.648] (-1934.198) (-1936.811) * (-1953.093) (-1935.756) (-1945.270) [-1935.071] -- 0:01:31
556500 -- (-1945.226) (-1933.761) (-1936.417) [-1936.201] * (-1939.538) (-1939.680) (-1937.899) [-1933.393] -- 0:01:31
557000 -- [-1938.628] (-1936.404) (-1933.192) (-1933.556) * (-1938.268) (-1936.046) (-1941.593) [-1934.894] -- 0:01:31
557500 -- (-1933.773) [-1935.062] (-1940.311) (-1939.031) * (-1941.592) (-1934.391) [-1931.081] (-1935.319) -- 0:01:31
558000 -- (-1936.179) (-1936.724) (-1937.286) [-1929.713] * (-1942.404) [-1934.277] (-1934.447) (-1936.885) -- 0:01:31
558500 -- (-1935.495) [-1933.315] (-1937.301) (-1938.451) * (-1939.401) [-1933.807] (-1933.870) (-1940.650) -- 0:01:30
559000 -- (-1938.094) [-1930.830] (-1934.370) (-1949.296) * (-1935.079) (-1932.601) (-1934.377) [-1932.322] -- 0:01:30
559500 -- (-1933.480) (-1936.895) [-1935.235] (-1937.455) * [-1932.130] (-1934.371) (-1935.853) (-1935.279) -- 0:01:31
560000 -- (-1933.960) (-1938.181) (-1936.038) [-1934.138] * (-1932.903) (-1934.526) (-1935.274) [-1932.680] -- 0:01:31
Average standard deviation of split frequencies: 0.000000
560500 -- (-1930.424) [-1934.223] (-1937.759) (-1937.422) * [-1937.340] (-1936.998) (-1938.748) (-1940.600) -- 0:01:30
561000 -- (-1944.494) [-1935.467] (-1935.939) (-1935.118) * (-1936.678) (-1935.992) (-1937.168) [-1932.818] -- 0:01:30
561500 -- (-1938.850) (-1934.736) (-1937.523) [-1933.618] * (-1940.437) [-1936.652] (-1937.827) (-1936.510) -- 0:01:30
562000 -- (-1939.501) [-1931.492] (-1930.353) (-1936.771) * (-1943.529) [-1934.481] (-1938.145) (-1931.886) -- 0:01:30
562500 -- (-1934.743) (-1935.720) [-1934.621] (-1941.441) * [-1936.230] (-1933.122) (-1936.243) (-1936.136) -- 0:01:30
563000 -- (-1933.916) [-1938.312] (-1935.482) (-1942.999) * (-1932.284) [-1933.180] (-1935.213) (-1939.418) -- 0:01:30
563500 -- (-1936.256) [-1939.714] (-1938.756) (-1933.928) * (-1936.682) (-1932.042) [-1936.753] (-1938.123) -- 0:01:29
564000 -- (-1931.534) (-1937.734) [-1937.368] (-1933.706) * [-1934.997] (-1934.799) (-1931.500) (-1943.496) -- 0:01:29
564500 -- (-1933.906) (-1935.010) (-1938.641) [-1939.273] * (-1930.367) (-1941.982) [-1934.073] (-1938.849) -- 0:01:30
565000 -- [-1934.547] (-1938.509) (-1938.974) (-1934.910) * (-1935.831) (-1938.075) (-1935.356) [-1933.794] -- 0:01:30
Average standard deviation of split frequencies: 0.000000
565500 -- (-1941.512) [-1937.904] (-1944.246) (-1936.119) * (-1933.214) (-1941.710) [-1933.714] (-1934.333) -- 0:01:29
566000 -- (-1933.700) (-1937.130) (-1942.572) [-1934.633] * (-1941.079) (-1935.931) (-1934.083) [-1937.735] -- 0:01:29
566500 -- (-1934.492) (-1934.044) [-1936.934] (-1932.953) * [-1931.568] (-1939.247) (-1938.243) (-1930.691) -- 0:01:29
567000 -- (-1934.438) (-1932.816) (-1936.570) [-1935.508] * (-1936.833) (-1934.620) (-1942.994) [-1932.418] -- 0:01:29
567500 -- (-1935.078) [-1937.079] (-1939.030) (-1935.585) * (-1933.186) (-1939.344) (-1938.782) [-1932.728] -- 0:01:29
568000 -- (-1939.556) [-1936.316] (-1940.817) (-1941.156) * (-1935.113) (-1937.581) (-1931.303) [-1939.657] -- 0:01:28
568500 -- (-1935.911) [-1934.760] (-1943.570) (-1937.666) * (-1938.091) (-1934.464) (-1932.376) [-1936.478] -- 0:01:28
569000 -- [-1932.947] (-1934.709) (-1934.133) (-1940.080) * [-1935.467] (-1930.495) (-1934.727) (-1935.538) -- 0:01:28
569500 -- (-1933.306) [-1930.593] (-1943.842) (-1936.608) * (-1931.147) (-1940.119) [-1931.775] (-1938.325) -- 0:01:29
570000 -- [-1934.086] (-1935.315) (-1930.836) (-1934.531) * (-1942.277) (-1936.381) (-1939.039) [-1931.215] -- 0:01:29
Average standard deviation of split frequencies: 0.000000
570500 -- (-1934.395) (-1945.709) [-1935.078] (-1935.970) * (-1942.670) [-1939.272] (-1932.888) (-1929.860) -- 0:01:28
571000 -- [-1932.164] (-1938.628) (-1933.514) (-1940.385) * (-1932.650) (-1935.359) [-1932.222] (-1932.458) -- 0:01:28
571500 -- (-1933.135) (-1932.626) [-1938.413] (-1941.013) * (-1933.397) (-1937.382) (-1934.346) [-1940.461] -- 0:01:28
572000 -- [-1933.860] (-1934.217) (-1936.410) (-1934.656) * (-1935.985) [-1931.158] (-1943.993) (-1931.442) -- 0:01:28
572500 -- (-1932.381) [-1930.318] (-1938.004) (-1934.744) * (-1940.137) (-1935.588) [-1937.728] (-1935.025) -- 0:01:28
573000 -- [-1931.825] (-1939.990) (-1935.394) (-1933.375) * (-1934.421) [-1940.087] (-1939.535) (-1940.330) -- 0:01:27
573500 -- (-1935.950) [-1941.123] (-1936.069) (-1932.159) * [-1939.504] (-1934.040) (-1936.474) (-1948.069) -- 0:01:27
574000 -- (-1932.789) [-1935.207] (-1932.452) (-1947.277) * (-1936.787) (-1931.484) (-1936.229) [-1934.755] -- 0:01:27
574500 -- (-1935.301) [-1933.208] (-1930.350) (-1940.440) * (-1931.704) (-1934.663) (-1934.299) [-1935.043] -- 0:01:28
575000 -- (-1941.145) [-1932.902] (-1929.842) (-1938.592) * (-1941.623) (-1932.984) (-1939.440) [-1931.597] -- 0:01:27
Average standard deviation of split frequencies: 0.000000
575500 -- (-1934.609) (-1936.351) (-1931.931) [-1937.309] * (-1937.624) (-1933.898) (-1939.622) [-1939.731] -- 0:01:27
576000 -- [-1934.284] (-1931.745) (-1935.030) (-1934.562) * (-1934.210) [-1933.475] (-1935.484) (-1942.995) -- 0:01:27
576500 -- [-1940.044] (-1935.016) (-1932.618) (-1939.895) * (-1938.684) [-1934.846] (-1937.818) (-1932.168) -- 0:01:27
577000 -- (-1945.506) [-1931.127] (-1934.818) (-1935.955) * (-1935.342) [-1932.961] (-1940.757) (-1936.280) -- 0:01:27
577500 -- (-1946.473) (-1933.264) (-1932.457) [-1930.514] * (-1940.024) [-1935.493] (-1937.512) (-1932.929) -- 0:01:27
578000 -- (-1942.961) (-1941.227) (-1935.606) [-1936.076] * [-1935.627] (-1943.674) (-1934.687) (-1938.082) -- 0:01:26
578500 -- (-1935.085) (-1941.145) [-1936.992] (-1932.606) * [-1935.491] (-1940.472) (-1934.820) (-1934.364) -- 0:01:26
579000 -- (-1934.678) [-1938.842] (-1934.824) (-1934.045) * (-1936.192) (-1942.482) [-1938.376] (-1934.460) -- 0:01:27
579500 -- (-1939.171) (-1933.308) (-1930.220) [-1937.509] * (-1933.694) (-1936.281) [-1934.260] (-1937.732) -- 0:01:27
580000 -- (-1932.787) (-1933.578) (-1933.050) [-1931.774] * (-1938.750) (-1931.624) [-1935.299] (-1934.880) -- 0:01:26
Average standard deviation of split frequencies: 0.000000
580500 -- (-1939.849) (-1932.566) (-1934.073) [-1938.679] * (-1937.586) (-1930.644) [-1934.437] (-1939.363) -- 0:01:26
581000 -- (-1940.596) (-1935.825) (-1931.072) [-1934.107] * (-1937.911) [-1934.284] (-1936.910) (-1937.240) -- 0:01:26
581500 -- [-1940.120] (-1932.762) (-1936.418) (-1942.457) * (-1935.390) (-1934.655) [-1932.821] (-1933.933) -- 0:01:26
582000 -- (-1936.194) (-1938.507) (-1934.588) [-1936.351] * (-1935.303) (-1933.633) [-1935.615] (-1939.294) -- 0:01:26
582500 -- (-1933.433) (-1935.613) [-1935.004] (-1931.942) * [-1936.665] (-1932.585) (-1940.360) (-1934.423) -- 0:01:26
583000 -- (-1940.352) (-1934.776) [-1939.512] (-1937.980) * [-1931.207] (-1931.421) (-1937.403) (-1938.806) -- 0:01:25
583500 -- (-1930.522) (-1932.981) [-1937.932] (-1936.747) * [-1933.993] (-1933.913) (-1940.960) (-1933.008) -- 0:01:25
584000 -- [-1933.053] (-1934.658) (-1933.719) (-1931.136) * [-1932.815] (-1929.890) (-1939.450) (-1935.109) -- 0:01:26
584500 -- (-1934.940) (-1935.202) (-1931.268) [-1936.156] * (-1935.939) [-1936.525] (-1940.142) (-1934.620) -- 0:01:26
585000 -- [-1936.105] (-1934.279) (-1933.555) (-1930.747) * [-1941.518] (-1942.102) (-1934.023) (-1939.578) -- 0:01:25
Average standard deviation of split frequencies: 0.000000
585500 -- [-1933.940] (-1935.139) (-1935.197) (-1934.364) * [-1932.821] (-1939.778) (-1945.508) (-1938.387) -- 0:01:25
586000 -- (-1936.117) [-1935.804] (-1938.599) (-1938.750) * (-1937.428) (-1935.542) (-1935.426) [-1939.009] -- 0:01:25
586500 -- (-1938.730) [-1933.736] (-1935.274) (-1936.378) * (-1936.639) (-1938.221) (-1932.828) [-1941.999] -- 0:01:25
587000 -- (-1943.009) (-1939.971) [-1934.207] (-1937.392) * [-1932.059] (-1934.514) (-1937.308) (-1933.701) -- 0:01:25
587500 -- (-1942.669) (-1939.433) [-1935.441] (-1937.483) * (-1932.480) (-1935.293) (-1938.856) [-1940.754] -- 0:01:24
588000 -- [-1941.832] (-1933.602) (-1937.043) (-1933.572) * [-1936.268] (-1936.776) (-1941.589) (-1938.402) -- 0:01:24
588500 -- (-1939.919) (-1931.972) [-1934.323] (-1936.338) * (-1939.408) (-1933.702) (-1935.158) [-1934.782] -- 0:01:24
589000 -- (-1937.415) (-1939.780) (-1939.953) [-1941.207] * [-1934.267] (-1934.764) (-1933.190) (-1935.487) -- 0:01:25
589500 -- (-1935.041) [-1931.035] (-1936.362) (-1934.123) * (-1934.636) (-1937.172) (-1932.016) [-1936.452] -- 0:01:24
590000 -- [-1932.789] (-1935.800) (-1932.412) (-1933.932) * (-1932.871) (-1936.757) [-1933.643] (-1936.947) -- 0:01:24
Average standard deviation of split frequencies: 0.000000
590500 -- (-1938.910) (-1938.871) (-1934.325) [-1938.054] * (-1938.019) [-1933.285] (-1935.592) (-1937.102) -- 0:01:24
591000 -- [-1931.893] (-1933.831) (-1939.667) (-1935.895) * (-1932.735) (-1937.319) (-1939.767) [-1931.990] -- 0:01:24
591500 -- (-1936.382) (-1937.137) [-1942.142] (-1935.711) * [-1934.390] (-1934.544) (-1935.777) (-1936.372) -- 0:01:24
592000 -- (-1940.603) (-1934.705) [-1935.333] (-1939.726) * (-1936.986) [-1936.407] (-1944.818) (-1937.382) -- 0:01:24
592500 -- (-1932.514) (-1934.803) [-1936.061] (-1937.915) * (-1936.360) (-1941.059) (-1936.472) [-1936.575] -- 0:01:23
593000 -- (-1933.352) (-1940.944) (-1937.741) [-1939.266] * (-1935.355) (-1937.999) (-1929.997) [-1930.079] -- 0:01:23
593500 -- (-1935.727) (-1932.957) (-1939.898) [-1940.473] * [-1932.478] (-1938.723) (-1934.368) (-1933.131) -- 0:01:23
594000 -- (-1939.347) (-1945.980) (-1936.200) [-1935.287] * (-1937.415) (-1937.656) [-1931.626] (-1932.425) -- 0:01:24
594500 -- (-1940.537) (-1944.926) (-1945.808) [-1929.758] * (-1936.711) (-1938.459) (-1939.352) [-1930.452] -- 0:01:23
595000 -- (-1941.320) (-1935.968) (-1934.274) [-1931.065] * [-1936.201] (-1950.023) (-1940.000) (-1936.957) -- 0:01:23
Average standard deviation of split frequencies: 0.000000
595500 -- (-1938.535) [-1934.625] (-1934.518) (-1932.198) * [-1935.482] (-1936.930) (-1936.766) (-1940.358) -- 0:01:23
596000 -- (-1934.245) (-1937.641) (-1935.941) [-1936.277] * [-1934.618] (-1943.558) (-1936.603) (-1936.394) -- 0:01:23
596500 -- (-1939.583) (-1936.593) [-1941.658] (-1934.507) * [-1931.777] (-1943.059) (-1935.270) (-1937.946) -- 0:01:23
597000 -- (-1931.828) [-1936.148] (-1935.320) (-1935.806) * (-1938.162) (-1939.108) (-1935.132) [-1934.279] -- 0:01:23
597500 -- (-1931.709) [-1932.048] (-1944.330) (-1939.330) * (-1934.541) [-1935.508] (-1933.691) (-1935.293) -- 0:01:22
598000 -- (-1932.143) (-1938.822) (-1938.745) [-1939.372] * (-1943.090) [-1934.391] (-1933.259) (-1935.663) -- 0:01:22
598500 -- (-1933.662) [-1933.859] (-1935.433) (-1935.557) * (-1938.527) [-1937.087] (-1938.992) (-1930.176) -- 0:01:22
599000 -- (-1931.216) (-1936.746) [-1934.004] (-1939.491) * [-1934.864] (-1932.101) (-1935.381) (-1931.370) -- 0:01:23
599500 -- [-1929.954] (-1935.046) (-1935.811) (-1932.315) * [-1935.407] (-1948.342) (-1934.827) (-1934.146) -- 0:01:22
600000 -- (-1932.772) (-1935.994) [-1935.294] (-1938.980) * [-1932.386] (-1936.092) (-1943.888) (-1942.892) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
600500 -- (-1936.808) (-1937.232) (-1933.826) [-1933.773] * [-1931.658] (-1934.008) (-1936.910) (-1936.552) -- 0:01:22
601000 -- (-1937.346) (-1932.452) (-1935.520) [-1936.503] * [-1935.112] (-1937.403) (-1935.479) (-1934.709) -- 0:01:22
601500 -- (-1932.591) (-1941.844) [-1933.575] (-1937.369) * (-1944.762) [-1937.279] (-1942.996) (-1932.818) -- 0:01:22
602000 -- [-1931.023] (-1935.683) (-1938.146) (-1933.827) * (-1933.262) (-1932.964) (-1932.604) [-1931.741] -- 0:01:21
602500 -- (-1939.013) (-1933.211) (-1939.631) [-1933.409] * [-1935.136] (-1937.851) (-1935.872) (-1937.764) -- 0:01:21
603000 -- (-1936.945) (-1936.315) [-1934.881] (-1933.424) * (-1936.803) [-1934.970] (-1937.262) (-1932.887) -- 0:01:22
603500 -- (-1936.667) (-1938.255) [-1936.151] (-1935.469) * (-1941.495) [-1933.057] (-1932.888) (-1930.910) -- 0:01:22
604000 -- (-1935.122) (-1936.894) (-1941.033) [-1933.045] * (-1937.971) (-1934.733) [-1933.371] (-1933.653) -- 0:01:21
604500 -- (-1934.979) (-1939.394) (-1935.646) [-1932.756] * (-1939.192) [-1934.462] (-1936.450) (-1934.585) -- 0:01:21
605000 -- [-1933.543] (-1937.599) (-1939.081) (-1936.505) * [-1929.222] (-1938.718) (-1949.147) (-1936.945) -- 0:01:21
Average standard deviation of split frequencies: 0.000000
605500 -- [-1934.926] (-1933.062) (-1938.592) (-1933.185) * [-1937.222] (-1937.313) (-1937.975) (-1938.473) -- 0:01:21
606000 -- (-1935.228) (-1937.671) (-1937.484) [-1935.618] * [-1932.988] (-1936.090) (-1935.969) (-1935.839) -- 0:01:21
606500 -- (-1937.254) (-1937.300) (-1939.353) [-1934.573] * (-1933.385) [-1938.414] (-1939.998) (-1935.593) -- 0:01:21
607000 -- (-1942.516) [-1934.684] (-1940.340) (-1933.165) * (-1936.728) (-1939.776) (-1933.899) [-1932.937] -- 0:01:20
607500 -- (-1939.629) (-1937.325) (-1939.650) [-1939.905] * (-1932.861) (-1938.633) (-1939.198) [-1934.195] -- 0:01:21
608000 -- (-1938.065) [-1936.690] (-1936.262) (-1935.744) * [-1932.256] (-1933.206) (-1937.882) (-1943.507) -- 0:01:21
608500 -- (-1935.247) (-1943.524) (-1934.594) [-1932.202] * (-1932.882) (-1938.404) [-1935.801] (-1937.252) -- 0:01:21
609000 -- [-1933.751] (-1942.551) (-1934.868) (-1933.380) * (-1937.649) [-1937.724] (-1939.391) (-1931.480) -- 0:01:20
609500 -- [-1934.181] (-1932.909) (-1934.920) (-1938.966) * (-1935.262) (-1940.980) [-1934.191] (-1935.322) -- 0:01:20
610000 -- (-1938.449) (-1935.584) (-1938.690) [-1935.583] * (-1930.232) (-1936.605) (-1933.104) [-1941.799] -- 0:01:20
Average standard deviation of split frequencies: 0.000000
610500 -- [-1937.161] (-1934.330) (-1940.505) (-1934.624) * (-1934.930) (-1936.911) (-1938.051) [-1940.138] -- 0:01:20
611000 -- (-1940.278) (-1932.735) [-1936.226] (-1936.598) * (-1934.677) (-1934.491) (-1934.039) [-1932.403] -- 0:01:20
611500 -- (-1938.483) (-1941.265) (-1936.085) [-1932.857] * (-1936.069) (-1940.927) [-1936.565] (-1932.190) -- 0:01:20
612000 -- [-1937.828] (-1939.415) (-1933.304) (-1934.773) * (-1935.636) [-1940.810] (-1933.507) (-1935.870) -- 0:01:20
612500 -- (-1935.086) (-1933.661) [-1937.611] (-1933.406) * (-1941.206) (-1938.691) (-1933.819) [-1932.921] -- 0:01:20
613000 -- (-1933.809) (-1937.929) (-1931.986) [-1932.938] * [-1932.210] (-1931.275) (-1932.784) (-1935.235) -- 0:01:20
613500 -- (-1935.089) (-1936.295) (-1934.931) [-1936.869] * [-1940.802] (-1932.758) (-1937.945) (-1942.425) -- 0:01:20
614000 -- (-1935.751) [-1935.375] (-1937.295) (-1936.210) * [-1931.067] (-1936.222) (-1936.511) (-1937.282) -- 0:01:19
614500 -- (-1939.189) [-1933.182] (-1941.062) (-1939.662) * (-1932.163) [-1929.642] (-1937.976) (-1939.860) -- 0:01:19
615000 -- [-1932.474] (-1934.572) (-1930.497) (-1938.429) * [-1930.268] (-1939.947) (-1931.960) (-1939.012) -- 0:01:19
Average standard deviation of split frequencies: 0.000000
615500 -- (-1934.592) (-1942.213) (-1936.793) [-1933.218] * (-1935.131) (-1941.616) (-1940.130) [-1936.146] -- 0:01:19
616000 -- (-1936.183) (-1938.078) (-1937.547) [-1940.388] * (-1932.404) (-1934.041) [-1933.187] (-1936.521) -- 0:01:19
616500 -- (-1935.211) [-1931.028] (-1933.007) (-1942.107) * (-1940.846) (-1937.587) [-1934.592] (-1933.491) -- 0:01:19
617000 -- [-1935.900] (-1936.631) (-1935.348) (-1939.626) * (-1938.010) [-1936.179] (-1934.045) (-1932.323) -- 0:01:19
617500 -- (-1939.339) (-1940.840) [-1935.569] (-1940.178) * (-1936.407) [-1934.963] (-1940.483) (-1935.645) -- 0:01:19
618000 -- (-1935.646) (-1937.055) [-1933.744] (-1937.929) * (-1934.718) (-1940.199) (-1940.279) [-1934.936] -- 0:01:19
618500 -- (-1936.266) (-1931.152) (-1933.368) [-1940.371] * (-1938.224) (-1934.786) (-1934.562) [-1934.171] -- 0:01:18
619000 -- (-1939.063) [-1932.928] (-1932.939) (-1937.825) * (-1938.022) (-1935.320) (-1941.307) [-1937.278] -- 0:01:18
619500 -- (-1935.114) (-1938.857) [-1933.475] (-1934.113) * (-1940.916) (-1939.566) (-1941.662) [-1933.564] -- 0:01:18
620000 -- (-1931.537) [-1935.016] (-1934.359) (-1936.148) * [-1938.318] (-1934.450) (-1941.334) (-1933.086) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
620500 -- (-1931.725) (-1933.128) [-1937.878] (-1935.668) * (-1933.521) [-1933.737] (-1933.153) (-1931.865) -- 0:01:18
621000 -- (-1940.499) (-1934.836) (-1935.101) [-1933.398] * (-1932.654) [-1934.277] (-1931.934) (-1930.878) -- 0:01:18
621500 -- (-1933.731) (-1939.576) (-1939.234) [-1933.665] * (-1933.217) (-1940.735) [-1939.755] (-1935.895) -- 0:01:18
622000 -- [-1930.005] (-1940.904) (-1948.835) (-1938.859) * (-1938.050) (-1938.050) (-1931.438) [-1934.230] -- 0:01:18
622500 -- (-1934.236) [-1934.098] (-1935.810) (-1941.180) * (-1948.173) (-1935.344) [-1942.816] (-1938.918) -- 0:01:18
623000 -- [-1934.379] (-1935.642) (-1938.213) (-1937.295) * [-1939.900] (-1935.404) (-1943.124) (-1938.910) -- 0:01:18
623500 -- [-1932.041] (-1938.800) (-1937.740) (-1939.162) * (-1933.168) (-1936.003) (-1935.014) [-1938.006] -- 0:01:17
624000 -- (-1937.375) (-1936.376) (-1932.964) [-1934.772] * (-1933.330) [-1934.209] (-1941.852) (-1938.231) -- 0:01:17
624500 -- (-1930.569) (-1936.241) [-1934.761] (-1936.332) * (-1939.475) (-1932.234) (-1939.196) [-1934.950] -- 0:01:17
625000 -- [-1933.683] (-1933.522) (-1933.796) (-1939.740) * [-1930.704] (-1938.098) (-1941.925) (-1942.565) -- 0:01:17
Average standard deviation of split frequencies: 0.000000
625500 -- (-1935.512) (-1931.067) (-1935.593) [-1937.429] * [-1934.968] (-1933.852) (-1937.084) (-1937.727) -- 0:01:17
626000 -- (-1938.672) (-1929.637) [-1935.948] (-1942.039) * [-1934.869] (-1939.317) (-1934.274) (-1935.677) -- 0:01:17
626500 -- [-1933.731] (-1931.795) (-1940.358) (-1932.693) * [-1936.674] (-1938.724) (-1931.323) (-1941.856) -- 0:01:17
627000 -- (-1938.151) (-1937.568) (-1936.012) [-1938.599] * (-1937.136) [-1931.683] (-1934.958) (-1939.457) -- 0:01:17
627500 -- (-1934.865) (-1944.460) [-1934.119] (-1941.074) * (-1938.499) (-1934.656) [-1934.265] (-1935.772) -- 0:01:17
628000 -- (-1932.145) (-1937.608) (-1937.003) [-1935.618] * [-1936.114] (-1933.608) (-1935.182) (-1938.220) -- 0:01:17
628500 -- [-1936.270] (-1932.272) (-1933.589) (-1934.225) * (-1933.812) (-1937.402) (-1935.526) [-1931.975] -- 0:01:16
629000 -- (-1943.931) (-1933.416) [-1934.570] (-1935.757) * (-1932.812) (-1930.425) (-1948.076) [-1935.045] -- 0:01:16
629500 -- (-1933.293) (-1933.653) (-1938.579) [-1938.750] * (-1935.480) (-1934.233) [-1934.330] (-1937.446) -- 0:01:17
630000 -- (-1943.418) (-1934.458) [-1937.607] (-1936.224) * (-1942.379) (-1933.850) (-1942.514) [-1935.838] -- 0:01:16
Average standard deviation of split frequencies: 0.000000
630500 -- (-1932.926) [-1933.760] (-1934.280) (-1936.504) * [-1932.551] (-1940.351) (-1931.408) (-1932.390) -- 0:01:16
631000 -- (-1939.914) [-1933.995] (-1933.835) (-1932.972) * (-1936.425) (-1936.359) (-1933.980) [-1938.563] -- 0:01:16
631500 -- (-1936.169) (-1932.846) [-1937.133] (-1939.883) * (-1939.289) (-1934.032) (-1935.921) [-1930.592] -- 0:01:16
632000 -- [-1934.862] (-1935.984) (-1938.235) (-1933.413) * (-1932.785) (-1933.996) (-1932.841) [-1930.722] -- 0:01:16
632500 -- [-1938.960] (-1936.516) (-1940.798) (-1941.165) * (-1936.862) (-1938.677) [-1935.587] (-1935.969) -- 0:01:16
633000 -- (-1938.087) [-1934.334] (-1938.486) (-1940.880) * (-1935.074) (-1935.171) (-1941.340) [-1933.848] -- 0:01:15
633500 -- (-1933.655) (-1940.160) [-1933.576] (-1933.686) * (-1938.913) (-1934.984) (-1935.741) [-1934.222] -- 0:01:15
634000 -- (-1939.596) [-1934.748] (-1932.631) (-1940.333) * (-1932.848) (-1934.111) [-1932.293] (-1937.128) -- 0:01:16
634500 -- (-1936.337) (-1937.147) (-1940.284) [-1937.995] * [-1936.394] (-1940.495) (-1934.999) (-1931.746) -- 0:01:16
635000 -- (-1937.321) [-1932.287] (-1936.850) (-1934.053) * (-1932.947) [-1937.657] (-1939.674) (-1935.377) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
635500 -- (-1937.451) [-1935.523] (-1931.132) (-1939.026) * [-1933.918] (-1935.436) (-1932.714) (-1933.683) -- 0:01:15
636000 -- [-1933.691] (-1937.033) (-1938.468) (-1938.138) * (-1933.969) (-1937.105) [-1938.705] (-1943.919) -- 0:01:15
636500 -- (-1932.117) [-1940.193] (-1940.306) (-1939.372) * (-1936.648) (-1932.395) [-1930.884] (-1937.414) -- 0:01:15
637000 -- (-1933.313) (-1933.967) [-1935.035] (-1937.963) * [-1937.924] (-1934.585) (-1934.752) (-1937.448) -- 0:01:15
637500 -- (-1932.412) (-1935.663) [-1931.269] (-1930.391) * (-1939.846) [-1932.493] (-1946.360) (-1938.773) -- 0:01:15
638000 -- (-1939.729) [-1937.486] (-1937.128) (-1940.032) * [-1934.770] (-1936.321) (-1944.003) (-1935.552) -- 0:01:14
638500 -- (-1934.658) (-1935.138) (-1941.142) [-1934.741] * (-1936.654) (-1941.031) (-1934.300) [-1941.921] -- 0:01:15
639000 -- (-1940.098) [-1935.188] (-1935.357) (-1930.733) * (-1933.798) [-1938.492] (-1934.039) (-1935.325) -- 0:01:15
639500 -- [-1932.085] (-1937.316) (-1935.973) (-1936.373) * [-1931.985] (-1938.225) (-1932.780) (-1933.533) -- 0:01:14
640000 -- (-1937.645) (-1933.750) [-1939.918] (-1939.171) * (-1934.310) (-1939.278) [-1934.067] (-1937.755) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
640500 -- (-1937.934) [-1932.871] (-1942.109) (-1936.869) * (-1931.809) (-1933.969) [-1935.067] (-1934.880) -- 0:01:14
641000 -- (-1932.574) (-1930.707) [-1934.430] (-1939.828) * [-1931.847] (-1931.325) (-1932.559) (-1942.232) -- 0:01:14
641500 -- (-1940.592) [-1930.441] (-1936.465) (-1936.806) * (-1940.453) (-1936.614) [-1937.907] (-1935.337) -- 0:01:14
642000 -- (-1936.370) (-1938.121) [-1933.144] (-1937.672) * (-1930.597) (-1933.166) [-1936.337] (-1942.031) -- 0:01:14
642500 -- (-1940.491) [-1939.078] (-1939.970) (-1934.566) * (-1933.860) (-1934.013) [-1934.350] (-1933.918) -- 0:01:14
643000 -- [-1935.524] (-1936.640) (-1941.910) (-1940.915) * (-1935.128) (-1936.964) (-1936.744) [-1935.990] -- 0:01:13
643500 -- (-1941.054) [-1931.650] (-1933.729) (-1936.601) * [-1932.151] (-1944.946) (-1932.370) (-1939.308) -- 0:01:14
644000 -- (-1932.608) (-1935.174) (-1929.923) [-1933.757] * (-1935.739) (-1937.982) [-1933.480] (-1941.227) -- 0:01:14
644500 -- (-1936.305) (-1940.215) [-1931.490] (-1937.343) * (-1939.564) [-1939.731] (-1936.366) (-1943.977) -- 0:01:13
645000 -- (-1942.311) (-1932.980) [-1934.582] (-1932.707) * [-1937.043] (-1946.460) (-1943.205) (-1937.014) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
645500 -- (-1934.106) (-1935.766) [-1934.128] (-1935.810) * [-1934.660] (-1937.241) (-1933.968) (-1933.765) -- 0:01:13
646000 -- (-1934.260) [-1935.297] (-1934.719) (-1931.913) * (-1934.853) (-1939.151) (-1932.130) [-1936.044] -- 0:01:13
646500 -- (-1939.247) (-1933.611) (-1936.148) [-1940.065] * (-1937.622) (-1937.828) [-1939.560] (-1932.655) -- 0:01:13
647000 -- [-1933.915] (-1934.810) (-1941.449) (-1935.950) * [-1935.981] (-1933.204) (-1933.439) (-1937.106) -- 0:01:13
647500 -- [-1931.904] (-1936.174) (-1934.622) (-1934.795) * (-1935.416) [-1937.937] (-1929.769) (-1934.931) -- 0:01:12
648000 -- (-1933.357) [-1934.038] (-1940.190) (-1935.049) * (-1937.538) [-1931.905] (-1940.777) (-1938.315) -- 0:01:13
648500 -- (-1939.362) [-1937.158] (-1935.509) (-1939.833) * (-1933.116) (-1932.459) [-1936.286] (-1942.485) -- 0:01:13
649000 -- [-1934.766] (-1936.731) (-1936.329) (-1945.782) * (-1935.425) [-1936.283] (-1935.688) (-1936.464) -- 0:01:13
649500 -- (-1935.590) (-1939.817) (-1931.263) [-1937.070] * (-1934.020) [-1933.182] (-1931.888) (-1934.879) -- 0:01:12
650000 -- [-1933.476] (-1941.813) (-1934.451) (-1933.795) * (-1938.357) [-1933.494] (-1935.088) (-1943.019) -- 0:01:12
Average standard deviation of split frequencies: 0.000000
650500 -- [-1932.922] (-1936.372) (-1929.314) (-1932.809) * (-1939.260) (-1933.058) [-1937.021] (-1940.028) -- 0:01:12
651000 -- (-1933.552) (-1942.348) (-1935.362) [-1931.735] * (-1939.781) [-1935.264] (-1935.374) (-1937.033) -- 0:01:12
651500 -- (-1938.577) (-1938.739) [-1937.052] (-1933.678) * [-1935.849] (-1936.108) (-1933.906) (-1936.074) -- 0:01:12
652000 -- (-1931.562) (-1933.441) (-1934.626) [-1939.705] * (-1934.468) (-1934.676) (-1936.712) [-1943.037] -- 0:01:12
652500 -- (-1941.197) [-1931.886] (-1935.508) (-1932.857) * (-1936.788) (-1933.165) [-1941.981] (-1940.160) -- 0:01:12
653000 -- (-1937.358) (-1944.033) [-1937.097] (-1934.288) * (-1935.187) [-1933.347] (-1935.083) (-1932.799) -- 0:01:12
653500 -- [-1933.802] (-1938.278) (-1932.519) (-1938.042) * (-1931.072) (-1935.341) (-1938.684) [-1932.837] -- 0:01:12
654000 -- [-1936.013] (-1935.017) (-1940.244) (-1936.334) * (-1941.487) [-1933.542] (-1935.213) (-1934.924) -- 0:01:11
654500 -- (-1937.632) [-1932.184] (-1933.777) (-1937.492) * (-1938.215) [-1932.590] (-1934.258) (-1939.427) -- 0:01:11
655000 -- (-1932.761) (-1933.607) [-1935.284] (-1930.945) * (-1934.552) (-1933.840) (-1938.211) [-1934.612] -- 0:01:11
Average standard deviation of split frequencies: 0.000000
655500 -- [-1940.241] (-1937.233) (-1929.347) (-1928.859) * (-1939.226) [-1935.711] (-1935.650) (-1942.457) -- 0:01:11
656000 -- (-1935.837) (-1945.120) (-1931.025) [-1935.410] * [-1935.103] (-1938.761) (-1935.467) (-1935.218) -- 0:01:11
656500 -- [-1932.915] (-1947.335) (-1933.295) (-1939.576) * [-1939.998] (-1939.021) (-1933.193) (-1934.737) -- 0:01:11
657000 -- (-1931.795) (-1937.806) [-1936.630] (-1935.117) * (-1940.284) (-1935.852) (-1932.666) [-1938.363] -- 0:01:11
657500 -- (-1936.081) (-1936.358) [-1938.126] (-1934.884) * (-1934.621) (-1934.359) (-1934.735) [-1934.404] -- 0:01:11
658000 -- (-1938.662) (-1936.088) [-1935.814] (-1938.140) * [-1938.722] (-1937.689) (-1936.420) (-1933.728) -- 0:01:11
658500 -- (-1934.907) [-1935.911] (-1944.139) (-1934.348) * (-1940.145) (-1935.464) [-1936.712] (-1934.366) -- 0:01:11
659000 -- (-1936.116) (-1947.769) [-1933.656] (-1937.089) * (-1936.550) (-1934.816) [-1935.184] (-1937.803) -- 0:01:10
659500 -- (-1940.713) (-1935.527) [-1933.558] (-1934.156) * (-1932.297) (-1938.539) [-1934.243] (-1937.975) -- 0:01:10
660000 -- (-1938.026) [-1940.157] (-1933.148) (-1933.093) * (-1940.581) [-1936.090] (-1934.077) (-1934.616) -- 0:01:10
Average standard deviation of split frequencies: 0.000000
660500 -- (-1942.905) [-1936.145] (-1935.956) (-1935.645) * [-1931.395] (-1936.542) (-1937.925) (-1939.366) -- 0:01:10
661000 -- (-1933.658) (-1937.082) (-1932.307) [-1942.281] * [-1935.007] (-1935.045) (-1938.546) (-1935.174) -- 0:01:10
661500 -- (-1934.990) [-1935.470] (-1936.112) (-1941.215) * [-1931.514] (-1932.826) (-1936.836) (-1934.806) -- 0:01:10
662000 -- (-1938.513) (-1939.474) (-1937.552) [-1934.073] * (-1936.707) (-1936.490) (-1934.329) [-1941.619] -- 0:01:09
662500 -- (-1939.437) [-1935.406] (-1940.758) (-1940.145) * (-1932.797) [-1935.933] (-1933.127) (-1937.012) -- 0:01:10
663000 -- [-1943.389] (-1936.619) (-1933.492) (-1935.582) * (-1938.452) [-1936.877] (-1932.217) (-1933.154) -- 0:01:10
663500 -- (-1942.168) [-1944.603] (-1935.805) (-1935.860) * (-1935.149) (-1939.962) [-1936.698] (-1932.668) -- 0:01:09
664000 -- (-1940.040) [-1937.188] (-1930.747) (-1935.068) * (-1935.146) (-1934.953) (-1933.802) [-1938.566] -- 0:01:09
664500 -- (-1935.527) (-1935.407) (-1935.077) [-1934.774] * [-1931.686] (-1935.738) (-1930.846) (-1940.704) -- 0:01:09
665000 -- [-1938.185] (-1937.929) (-1934.947) (-1934.164) * (-1941.033) [-1937.034] (-1940.683) (-1948.573) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
665500 -- (-1937.289) [-1932.795] (-1936.488) (-1934.259) * (-1937.712) (-1929.550) [-1930.523] (-1940.761) -- 0:01:09
666000 -- (-1936.080) (-1935.551) [-1938.402] (-1932.438) * [-1933.900] (-1941.283) (-1935.207) (-1937.531) -- 0:01:09
666500 -- (-1934.784) (-1942.244) (-1939.139) [-1935.029] * (-1935.204) [-1932.400] (-1932.654) (-1937.608) -- 0:01:09
667000 -- (-1933.149) (-1933.427) [-1937.742] (-1940.746) * (-1942.160) (-1940.060) (-1935.312) [-1937.570] -- 0:01:09
667500 -- [-1933.769] (-1935.065) (-1933.623) (-1933.521) * (-1934.007) [-1934.966] (-1940.531) (-1934.563) -- 0:01:09
668000 -- (-1937.536) (-1932.468) (-1940.156) [-1932.412] * (-1937.850) (-1939.498) [-1935.101] (-1934.735) -- 0:01:09
668500 -- (-1937.732) (-1938.571) [-1936.157] (-1937.231) * (-1933.883) (-1935.543) [-1934.841] (-1937.126) -- 0:01:08
669000 -- [-1933.307] (-1939.777) (-1936.837) (-1933.028) * (-1933.616) [-1931.265] (-1933.968) (-1938.350) -- 0:01:08
669500 -- [-1933.602] (-1939.836) (-1938.759) (-1940.089) * (-1938.784) [-1936.704] (-1936.996) (-1938.940) -- 0:01:08
670000 -- [-1937.231] (-1939.964) (-1935.741) (-1936.239) * (-1933.851) (-1937.500) [-1937.775] (-1942.759) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
670500 -- (-1936.225) (-1934.273) (-1935.895) [-1938.820] * (-1935.364) (-1931.813) [-1935.155] (-1940.024) -- 0:01:08
671000 -- (-1932.966) (-1940.792) (-1940.208) [-1934.109] * (-1943.204) [-1934.523] (-1933.559) (-1945.472) -- 0:01:08
671500 -- (-1945.348) [-1934.268] (-1941.779) (-1940.450) * (-1932.436) (-1940.866) (-1931.880) [-1937.721] -- 0:01:07
672000 -- (-1940.922) (-1942.076) (-1940.007) [-1934.439] * [-1931.750] (-1937.980) (-1937.028) (-1944.800) -- 0:01:08
672500 -- (-1934.938) [-1935.016] (-1937.387) (-1935.542) * (-1936.544) (-1939.229) [-1931.482] (-1939.687) -- 0:01:08
673000 -- [-1936.418] (-1933.129) (-1946.107) (-1938.781) * [-1932.532] (-1937.067) (-1936.719) (-1941.068) -- 0:01:08
673500 -- (-1938.103) (-1932.094) (-1939.376) [-1945.228] * (-1934.818) [-1933.565] (-1935.514) (-1939.823) -- 0:01:07
674000 -- (-1931.578) (-1934.217) (-1939.191) [-1937.066] * (-1936.304) [-1932.577] (-1938.335) (-1938.608) -- 0:01:07
674500 -- [-1930.970] (-1935.401) (-1937.333) (-1932.474) * (-1934.529) (-1932.380) (-1933.563) [-1937.135] -- 0:01:07
675000 -- [-1936.628] (-1934.503) (-1930.578) (-1935.392) * (-1932.973) [-1932.864] (-1941.874) (-1941.455) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
675500 -- (-1933.807) (-1936.083) [-1931.541] (-1939.852) * (-1936.989) (-1933.945) (-1943.594) [-1937.111] -- 0:01:07
676000 -- (-1944.135) (-1937.791) [-1935.024] (-1936.882) * (-1943.197) (-1940.912) (-1937.569) [-1939.531] -- 0:01:07
676500 -- (-1943.332) (-1932.105) [-1934.718] (-1934.091) * [-1938.779] (-1938.057) (-1932.375) (-1940.666) -- 0:01:06
677000 -- (-1936.876) (-1932.241) [-1935.913] (-1938.455) * (-1934.191) (-1933.288) (-1945.805) [-1935.404] -- 0:01:07
677500 -- (-1939.060) (-1932.515) (-1938.300) [-1933.253] * [-1933.715] (-1940.828) (-1935.750) (-1943.772) -- 0:01:07
678000 -- [-1943.561] (-1943.814) (-1935.594) (-1934.321) * [-1931.624] (-1929.265) (-1929.877) (-1942.057) -- 0:01:06
678500 -- [-1938.788] (-1945.162) (-1942.404) (-1929.197) * [-1942.328] (-1934.378) (-1935.762) (-1943.452) -- 0:01:06
679000 -- (-1936.738) [-1938.795] (-1939.055) (-1933.382) * [-1935.543] (-1933.961) (-1935.976) (-1935.259) -- 0:01:06
679500 -- (-1939.539) (-1937.852) (-1931.995) [-1929.275] * (-1943.949) [-1933.862] (-1930.133) (-1940.432) -- 0:01:06
680000 -- (-1937.731) (-1938.622) (-1936.167) [-1934.394] * (-1934.524) (-1932.543) [-1934.630] (-1936.709) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
680500 -- [-1942.135] (-1934.459) (-1935.621) (-1940.939) * (-1933.833) (-1935.550) [-1938.493] (-1932.464) -- 0:01:06
681000 -- (-1939.993) [-1937.774] (-1934.433) (-1933.759) * [-1934.982] (-1937.268) (-1934.629) (-1940.714) -- 0:01:06
681500 -- (-1939.832) (-1933.729) (-1933.799) [-1933.280] * (-1936.257) (-1939.535) (-1935.652) [-1934.883] -- 0:01:05
682000 -- (-1939.812) (-1937.871) [-1934.670] (-1930.651) * [-1928.740] (-1934.445) (-1938.098) (-1933.617) -- 0:01:06
682500 -- [-1935.906] (-1940.043) (-1939.667) (-1934.307) * (-1934.846) (-1936.415) (-1935.430) [-1930.045] -- 0:01:06
683000 -- (-1933.059) (-1931.710) (-1943.530) [-1936.540] * (-1931.630) (-1939.014) (-1937.866) [-1931.862] -- 0:01:05
683500 -- (-1936.568) (-1939.081) [-1934.967] (-1937.139) * (-1934.842) [-1934.426] (-1937.467) (-1932.414) -- 0:01:05
684000 -- (-1930.062) [-1938.443] (-1942.792) (-1937.825) * (-1935.640) (-1936.388) (-1936.818) [-1935.313] -- 0:01:05
684500 -- (-1937.016) [-1932.938] (-1940.666) (-1938.280) * (-1935.505) [-1938.230] (-1935.384) (-1935.362) -- 0:01:05
685000 -- (-1938.741) (-1931.984) (-1944.785) [-1936.352] * (-1935.039) (-1939.562) [-1937.087] (-1935.070) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
685500 -- (-1944.180) (-1936.745) (-1939.883) [-1933.434] * (-1939.584) [-1941.738] (-1937.519) (-1934.690) -- 0:01:05
686000 -- (-1937.392) (-1933.078) [-1932.771] (-1934.472) * (-1931.237) (-1939.804) (-1943.946) [-1934.413] -- 0:01:04
686500 -- (-1936.954) [-1936.293] (-1938.001) (-1935.611) * (-1930.253) (-1936.843) [-1936.114] (-1937.626) -- 0:01:05
687000 -- (-1938.041) (-1934.309) [-1929.892] (-1938.287) * (-1935.293) (-1936.770) (-1936.430) [-1933.471] -- 0:01:05
687500 -- (-1935.746) (-1937.346) (-1936.544) [-1933.573] * (-1938.014) [-1933.649] (-1933.504) (-1935.656) -- 0:01:05
688000 -- (-1944.799) (-1939.457) [-1932.218] (-1942.095) * [-1937.230] (-1938.992) (-1931.549) (-1940.799) -- 0:01:04
688500 -- (-1934.484) (-1939.472) [-1933.834] (-1936.269) * (-1933.952) (-1940.591) [-1933.502] (-1934.988) -- 0:01:04
689000 -- [-1938.591] (-1938.581) (-1939.128) (-1933.703) * [-1934.478] (-1931.395) (-1939.473) (-1939.666) -- 0:01:04
689500 -- (-1937.089) [-1934.894] (-1938.852) (-1930.707) * (-1937.100) (-1940.846) [-1933.632] (-1935.383) -- 0:01:04
690000 -- [-1938.792] (-1939.390) (-1938.838) (-1938.829) * (-1933.732) (-1936.294) (-1940.299) [-1932.698] -- 0:01:04
Average standard deviation of split frequencies: 0.000000
690500 -- [-1933.337] (-1933.014) (-1933.427) (-1934.177) * (-1935.469) [-1938.818] (-1940.826) (-1932.014) -- 0:01:04
691000 -- (-1936.983) (-1936.815) [-1934.495] (-1941.882) * (-1933.369) (-1941.328) (-1934.641) [-1932.448] -- 0:01:03
691500 -- (-1946.889) [-1937.920] (-1936.990) (-1941.727) * (-1940.620) (-1933.157) (-1947.542) [-1932.639] -- 0:01:04
692000 -- [-1931.160] (-1934.738) (-1935.514) (-1940.133) * (-1940.395) [-1936.345] (-1935.969) (-1933.992) -- 0:01:04
692500 -- (-1937.607) (-1938.762) [-1934.605] (-1934.860) * [-1934.418] (-1937.494) (-1936.942) (-1935.934) -- 0:01:03
693000 -- [-1938.091] (-1939.341) (-1937.861) (-1936.572) * [-1934.803] (-1934.153) (-1940.140) (-1936.067) -- 0:01:03
693500 -- (-1939.213) (-1938.516) [-1936.902] (-1937.778) * (-1931.090) (-1932.461) (-1937.993) [-1930.410] -- 0:01:03
694000 -- (-1933.448) (-1940.350) (-1938.934) [-1937.937] * [-1933.139] (-1934.023) (-1936.393) (-1934.263) -- 0:01:03
694500 -- (-1935.165) (-1933.280) (-1936.404) [-1936.189] * (-1937.662) (-1932.349) (-1936.717) [-1935.058] -- 0:01:03
695000 -- (-1933.536) (-1935.349) [-1935.253] (-1938.333) * [-1935.120] (-1941.105) (-1933.675) (-1938.939) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
695500 -- (-1932.960) (-1939.757) (-1940.312) [-1933.039] * [-1934.147] (-1933.911) (-1932.365) (-1936.347) -- 0:01:03
696000 -- [-1936.432] (-1937.896) (-1933.914) (-1946.240) * [-1932.542] (-1939.733) (-1937.214) (-1934.133) -- 0:01:02
696500 -- (-1937.080) (-1947.143) [-1935.559] (-1941.083) * (-1933.760) [-1938.685] (-1933.487) (-1935.682) -- 0:01:03
697000 -- (-1934.646) [-1944.023] (-1938.561) (-1936.523) * [-1934.059] (-1933.748) (-1933.934) (-1938.065) -- 0:01:03
697500 -- (-1938.276) [-1931.240] (-1937.824) (-1937.385) * (-1933.597) (-1934.808) [-1932.127] (-1931.639) -- 0:01:02
698000 -- (-1932.894) [-1932.987] (-1930.525) (-1936.845) * (-1938.795) (-1936.163) (-1934.603) [-1931.367] -- 0:01:02
698500 -- (-1941.481) (-1936.206) (-1931.157) [-1932.301] * (-1943.755) [-1937.480] (-1941.217) (-1933.598) -- 0:01:02
699000 -- (-1934.333) (-1934.886) (-1936.808) [-1934.038] * (-1937.746) (-1931.768) (-1936.156) [-1934.305] -- 0:01:02
699500 -- (-1936.264) (-1932.161) [-1934.335] (-1931.883) * [-1937.632] (-1938.055) (-1935.030) (-1931.184) -- 0:01:02
700000 -- [-1930.659] (-1933.287) (-1940.567) (-1933.986) * (-1943.364) (-1932.418) (-1938.140) [-1934.088] -- 0:01:02
Average standard deviation of split frequencies: 0.000000
700500 -- (-1935.061) (-1932.034) (-1941.853) [-1932.904] * (-1934.644) (-1933.921) (-1934.351) [-1933.420] -- 0:01:01
701000 -- (-1938.115) [-1938.714] (-1935.499) (-1934.138) * (-1936.041) (-1932.387) (-1939.440) [-1937.493] -- 0:01:01
701500 -- (-1942.407) (-1939.120) [-1933.366] (-1938.280) * (-1940.864) (-1932.237) [-1933.285] (-1936.660) -- 0:01:02
702000 -- [-1932.230] (-1930.809) (-1940.453) (-1933.355) * (-1937.232) [-1939.301] (-1937.457) (-1937.818) -- 0:01:01
702500 -- (-1939.280) (-1940.323) (-1938.278) [-1936.469] * (-1937.853) (-1937.457) [-1936.136] (-1931.232) -- 0:01:01
703000 -- (-1931.251) [-1936.356] (-1939.527) (-1944.419) * (-1938.023) [-1934.842] (-1937.574) (-1931.477) -- 0:01:01
703500 -- (-1936.621) [-1936.411] (-1936.170) (-1936.836) * [-1937.839] (-1931.954) (-1939.409) (-1931.311) -- 0:01:01
704000 -- (-1935.565) [-1934.933] (-1935.592) (-1932.553) * (-1936.040) [-1933.755] (-1935.160) (-1935.116) -- 0:01:01
704500 -- (-1937.114) (-1935.973) (-1939.033) [-1937.281] * (-1938.874) (-1929.306) (-1934.418) [-1937.072] -- 0:01:01
705000 -- [-1931.871] (-1933.599) (-1939.527) (-1937.103) * (-1937.583) [-1935.688] (-1935.311) (-1934.471) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
705500 -- (-1931.521) (-1940.417) [-1936.574] (-1932.010) * (-1933.379) (-1932.443) [-1939.955] (-1939.997) -- 0:01:00
706000 -- (-1934.258) (-1935.074) [-1934.601] (-1942.812) * (-1944.863) (-1942.470) (-1933.701) [-1933.302] -- 0:01:00
706500 -- (-1934.774) (-1935.767) (-1933.993) [-1936.586] * (-1936.957) (-1936.453) (-1931.537) [-1937.447] -- 0:01:01
707000 -- (-1936.887) (-1935.711) [-1936.310] (-1935.435) * [-1936.592] (-1939.153) (-1932.231) (-1932.772) -- 0:01:00
707500 -- (-1939.128) (-1934.980) (-1932.846) [-1939.335] * (-1940.082) (-1935.401) [-1932.695] (-1933.851) -- 0:01:00
708000 -- (-1935.052) (-1937.702) [-1934.178] (-1936.204) * (-1938.595) [-1933.892] (-1937.156) (-1944.170) -- 0:01:00
708500 -- (-1931.786) (-1935.301) [-1941.829] (-1940.234) * (-1937.110) [-1935.956] (-1934.785) (-1942.637) -- 0:01:00
709000 -- (-1938.610) (-1931.305) [-1935.800] (-1936.612) * (-1938.553) [-1935.001] (-1934.865) (-1947.289) -- 0:01:00
709500 -- (-1935.769) (-1937.359) [-1931.981] (-1932.120) * (-1933.497) (-1938.594) [-1934.265] (-1940.335) -- 0:01:00
710000 -- (-1934.973) [-1935.664] (-1932.643) (-1945.947) * [-1935.209] (-1939.863) (-1941.538) (-1934.987) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
710500 -- (-1936.099) (-1931.969) [-1931.677] (-1940.174) * (-1934.890) [-1936.576] (-1935.569) (-1934.586) -- 0:00:59
711000 -- (-1936.980) [-1931.352] (-1939.687) (-1942.935) * (-1933.678) [-1933.551] (-1935.424) (-1934.477) -- 0:00:59
711500 -- (-1932.438) [-1934.453] (-1937.046) (-1937.524) * (-1940.163) (-1935.503) (-1933.769) [-1938.447] -- 0:01:00
712000 -- (-1939.080) [-1935.366] (-1939.397) (-1940.662) * (-1934.206) [-1932.895] (-1936.555) (-1937.601) -- 0:00:59
712500 -- (-1932.305) [-1933.760] (-1935.679) (-1932.560) * (-1935.737) (-1942.508) [-1939.397] (-1940.681) -- 0:00:59
713000 -- (-1935.531) (-1938.970) (-1935.357) [-1935.478] * (-1939.323) (-1932.623) [-1938.586] (-1939.364) -- 0:00:59
713500 -- [-1932.443] (-1933.894) (-1933.684) (-1935.874) * [-1933.447] (-1933.213) (-1934.858) (-1943.292) -- 0:00:59
714000 -- (-1936.042) (-1936.242) [-1929.348] (-1941.610) * (-1935.946) (-1937.657) [-1930.283] (-1942.597) -- 0:00:59
714500 -- (-1940.175) (-1941.943) [-1932.029] (-1945.486) * (-1934.090) [-1936.136] (-1936.671) (-1942.547) -- 0:00:59
715000 -- (-1935.597) (-1940.453) [-1931.558] (-1931.152) * [-1934.127] (-1936.280) (-1938.200) (-1933.751) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
715500 -- (-1936.670) (-1938.058) [-1935.748] (-1938.958) * (-1935.407) [-1931.802] (-1932.808) (-1940.497) -- 0:00:58
716000 -- (-1936.720) [-1935.988] (-1938.355) (-1941.673) * (-1941.476) (-1933.012) (-1932.182) [-1939.895] -- 0:00:59
716500 -- (-1935.650) (-1939.851) [-1934.335] (-1939.103) * (-1936.837) [-1930.283] (-1933.790) (-1936.726) -- 0:00:58
717000 -- (-1935.575) (-1936.491) [-1939.680] (-1935.904) * (-1937.193) (-1935.119) (-1933.348) [-1935.527] -- 0:00:58
717500 -- (-1934.077) [-1936.771] (-1933.095) (-1933.225) * [-1931.160] (-1936.261) (-1931.222) (-1936.264) -- 0:00:58
718000 -- [-1937.893] (-1938.004) (-1941.143) (-1932.114) * (-1936.600) [-1935.770] (-1938.259) (-1931.793) -- 0:00:58
718500 -- (-1935.504) (-1937.759) (-1949.848) [-1936.221] * (-1932.401) [-1934.113] (-1943.691) (-1937.477) -- 0:00:58
719000 -- (-1932.554) (-1938.984) (-1937.445) [-1933.809] * (-1940.833) [-1933.909] (-1935.485) (-1935.686) -- 0:00:58
719500 -- [-1930.670] (-1936.222) (-1938.017) (-1934.284) * (-1943.279) [-1932.994] (-1942.447) (-1937.416) -- 0:00:58
720000 -- (-1935.250) [-1940.058] (-1937.635) (-1933.550) * (-1945.822) [-1933.668] (-1936.450) (-1939.958) -- 0:00:57
Average standard deviation of split frequencies: 0.000000
720500 -- (-1931.175) (-1933.183) (-1934.972) [-1934.474] * (-1940.965) [-1933.474] (-1934.091) (-1939.658) -- 0:00:57
721000 -- [-1932.345] (-1935.761) (-1936.472) (-1930.920) * (-1937.718) (-1937.610) [-1939.166] (-1942.166) -- 0:00:58
721500 -- [-1934.903] (-1940.803) (-1936.605) (-1937.848) * (-1938.389) (-1931.869) (-1933.099) [-1944.027] -- 0:00:57
722000 -- (-1934.552) [-1943.667] (-1934.468) (-1939.613) * (-1937.258) (-1932.985) (-1933.935) [-1939.971] -- 0:00:57
722500 -- (-1932.927) [-1936.141] (-1936.656) (-1932.744) * [-1934.898] (-1933.831) (-1936.794) (-1936.008) -- 0:00:57
723000 -- (-1932.843) (-1935.423) (-1933.652) [-1936.439] * [-1933.564] (-1939.342) (-1932.300) (-1939.404) -- 0:00:57
723500 -- (-1936.560) [-1933.290] (-1935.959) (-1935.190) * (-1934.766) (-1939.729) [-1938.137] (-1935.749) -- 0:00:57
724000 -- (-1936.358) [-1931.864] (-1934.773) (-1932.011) * (-1934.168) [-1933.997] (-1941.855) (-1934.163) -- 0:00:57
724500 -- (-1936.349) [-1931.595] (-1933.372) (-1931.436) * (-1931.037) (-1940.071) [-1935.037] (-1933.451) -- 0:00:57
725000 -- [-1937.551] (-1932.885) (-1941.686) (-1932.703) * [-1931.905] (-1937.924) (-1944.464) (-1938.914) -- 0:00:56
Average standard deviation of split frequencies: 0.000000
725500 -- (-1941.309) (-1933.980) [-1933.247] (-1932.063) * (-1936.417) [-1932.954] (-1930.827) (-1935.147) -- 0:00:56
726000 -- (-1937.665) (-1933.696) (-1934.406) [-1936.240] * [-1935.009] (-1932.351) (-1937.633) (-1943.498) -- 0:00:56
726500 -- (-1939.723) (-1936.955) [-1934.432] (-1932.443) * [-1933.419] (-1938.197) (-1934.416) (-1937.800) -- 0:00:56
727000 -- (-1939.269) (-1940.538) [-1931.394] (-1938.346) * (-1933.229) (-1938.945) [-1934.224] (-1936.143) -- 0:00:56
727500 -- (-1936.490) [-1935.571] (-1936.117) (-1934.515) * (-1935.210) [-1934.955] (-1936.745) (-1934.297) -- 0:00:56
728000 -- [-1934.631] (-1931.827) (-1937.337) (-1936.802) * (-1937.966) (-1935.464) [-1933.696] (-1935.884) -- 0:00:56
728500 -- [-1932.184] (-1932.374) (-1934.574) (-1934.831) * (-1931.394) (-1935.588) (-1938.639) [-1931.325] -- 0:00:56
729000 -- [-1937.701] (-1931.588) (-1936.409) (-1934.191) * (-1934.689) (-1933.155) (-1935.965) [-1931.626] -- 0:00:56
729500 -- (-1935.711) [-1931.166] (-1932.526) (-1929.620) * (-1931.264) [-1940.730] (-1944.687) (-1936.133) -- 0:00:55
730000 -- (-1936.260) (-1936.304) (-1934.285) [-1937.045] * (-1936.333) (-1934.729) [-1932.074] (-1935.583) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
730500 -- (-1936.465) [-1938.828] (-1939.854) (-1932.648) * (-1933.890) [-1934.306] (-1938.779) (-1936.314) -- 0:00:55
731000 -- (-1935.276) (-1937.578) [-1936.624] (-1938.437) * [-1933.422] (-1932.216) (-1945.614) (-1935.899) -- 0:00:55
731500 -- [-1933.747] (-1937.234) (-1937.169) (-1939.490) * (-1934.060) (-1938.695) (-1935.687) [-1934.178] -- 0:00:55
732000 -- [-1930.249] (-1937.992) (-1942.000) (-1940.040) * (-1935.254) (-1939.921) [-1931.962] (-1932.938) -- 0:00:55
732500 -- (-1935.418) (-1936.110) (-1937.884) [-1934.948] * [-1930.017] (-1935.830) (-1942.313) (-1936.048) -- 0:00:55
733000 -- (-1933.732) [-1936.221] (-1943.611) (-1935.817) * (-1931.481) (-1933.605) (-1938.103) [-1930.227] -- 0:00:55
733500 -- (-1939.024) (-1934.718) (-1940.455) [-1938.366] * [-1932.892] (-1934.168) (-1938.561) (-1939.385) -- 0:00:55
734000 -- [-1938.038] (-1938.887) (-1938.721) (-1934.322) * (-1936.319) (-1932.631) (-1934.092) [-1937.342] -- 0:00:55
734500 -- (-1940.011) (-1939.960) [-1936.367] (-1938.935) * (-1941.049) (-1934.631) [-1931.042] (-1932.663) -- 0:00:54
735000 -- (-1937.745) [-1937.100] (-1935.378) (-1936.046) * (-1939.868) (-1936.368) (-1932.466) [-1935.231] -- 0:00:54
Average standard deviation of split frequencies: 0.000000
735500 -- [-1938.295] (-1940.811) (-1935.729) (-1933.806) * [-1936.549] (-1935.690) (-1935.547) (-1937.072) -- 0:00:54
736000 -- (-1940.026) (-1938.272) (-1932.745) [-1941.268] * (-1940.458) (-1934.965) [-1932.812] (-1933.744) -- 0:00:54
736500 -- (-1944.472) (-1945.189) (-1934.902) [-1934.591] * [-1936.154] (-1931.536) (-1936.424) (-1932.954) -- 0:00:54
737000 -- (-1937.498) (-1940.190) (-1948.670) [-1939.771] * [-1936.098] (-1931.302) (-1936.650) (-1942.610) -- 0:00:54
737500 -- (-1939.216) (-1939.953) (-1941.944) [-1931.440] * [-1935.865] (-1933.040) (-1935.538) (-1933.636) -- 0:00:54
738000 -- (-1940.558) (-1936.096) [-1936.759] (-1937.804) * (-1941.245) [-1930.583] (-1931.942) (-1951.875) -- 0:00:54
738500 -- (-1932.379) (-1935.734) [-1933.039] (-1937.718) * (-1935.403) (-1937.819) (-1940.487) [-1933.601] -- 0:00:54
739000 -- (-1932.538) [-1937.013] (-1935.869) (-1936.687) * [-1935.997] (-1931.009) (-1934.070) (-1942.256) -- 0:00:54
739500 -- (-1936.564) (-1939.076) [-1932.393] (-1936.461) * (-1944.093) (-1932.038) [-1933.266] (-1931.851) -- 0:00:53
740000 -- [-1934.546] (-1933.458) (-1930.936) (-1940.145) * (-1942.062) [-1931.884] (-1932.383) (-1934.361) -- 0:00:53
Average standard deviation of split frequencies: 0.000000
740500 -- [-1929.885] (-1935.957) (-1936.015) (-1943.340) * (-1942.493) (-1936.669) (-1930.521) [-1934.278] -- 0:00:53
741000 -- (-1934.872) [-1933.123] (-1934.293) (-1948.552) * (-1937.485) (-1940.922) (-1930.614) [-1937.710] -- 0:00:53
741500 -- [-1934.799] (-1936.241) (-1936.799) (-1943.853) * (-1931.935) (-1940.444) [-1933.092] (-1935.497) -- 0:00:53
742000 -- (-1941.146) (-1940.747) [-1937.796] (-1938.995) * (-1936.678) (-1937.632) (-1934.893) [-1932.556] -- 0:00:53
742500 -- (-1931.364) (-1936.604) [-1932.510] (-1941.751) * (-1935.508) [-1934.482] (-1939.669) (-1939.455) -- 0:00:53
743000 -- [-1937.550] (-1932.228) (-1932.933) (-1935.472) * [-1934.360] (-1936.837) (-1942.097) (-1937.303) -- 0:00:53
743500 -- [-1937.800] (-1941.920) (-1940.367) (-1939.147) * (-1939.269) [-1934.578] (-1933.203) (-1938.783) -- 0:00:53
744000 -- (-1931.549) [-1939.966] (-1947.222) (-1945.580) * (-1938.891) (-1937.867) (-1936.302) [-1938.387] -- 0:00:52
744500 -- [-1932.689] (-1939.038) (-1933.311) (-1932.370) * (-1937.954) (-1935.314) [-1934.738] (-1938.987) -- 0:00:52
745000 -- (-1938.099) [-1931.483] (-1933.895) (-1938.918) * (-1937.396) (-1938.418) (-1935.518) [-1932.045] -- 0:00:52
Average standard deviation of split frequencies: 0.000000
745500 -- (-1947.195) (-1929.209) (-1935.163) [-1939.743] * (-1938.123) (-1939.741) [-1937.242] (-1933.302) -- 0:00:52
746000 -- (-1937.965) [-1929.589] (-1932.952) (-1935.417) * (-1933.152) (-1936.871) [-1933.861] (-1933.433) -- 0:00:52
746500 -- (-1936.478) [-1936.957] (-1937.291) (-1934.325) * (-1936.695) (-1936.411) (-1932.773) [-1930.701] -- 0:00:52
747000 -- (-1935.769) (-1940.292) (-1942.005) [-1932.732] * (-1939.816) [-1935.193] (-1935.474) (-1938.558) -- 0:00:52
747500 -- [-1937.408] (-1938.618) (-1937.164) (-1932.432) * (-1936.470) (-1942.126) [-1935.513] (-1936.416) -- 0:00:52
748000 -- (-1941.125) [-1932.428] (-1936.425) (-1932.734) * [-1936.785] (-1935.424) (-1931.842) (-1933.627) -- 0:00:52
748500 -- (-1935.215) (-1938.136) (-1939.774) [-1935.305] * [-1932.726] (-1936.573) (-1934.412) (-1933.814) -- 0:00:52
749000 -- (-1933.939) (-1935.864) (-1937.495) [-1938.323] * (-1933.336) (-1935.826) [-1933.744] (-1936.574) -- 0:00:51
749500 -- (-1931.886) (-1934.112) [-1936.436] (-1932.096) * (-1930.385) (-1937.662) [-1936.002] (-1932.221) -- 0:00:51
750000 -- [-1932.225] (-1942.069) (-1939.863) (-1937.484) * (-1935.874) (-1940.980) [-1930.565] (-1935.484) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
750500 -- [-1934.305] (-1933.590) (-1940.708) (-1938.716) * (-1941.172) [-1934.786] (-1940.103) (-1936.619) -- 0:00:51
751000 -- (-1943.218) [-1936.465] (-1939.559) (-1933.358) * [-1934.199] (-1936.757) (-1932.696) (-1936.264) -- 0:00:51
751500 -- (-1938.746) (-1938.695) [-1934.401] (-1939.486) * (-1930.874) (-1933.911) [-1930.776] (-1939.774) -- 0:00:51
752000 -- (-1941.711) (-1934.754) (-1933.752) [-1932.667] * (-1939.441) (-1942.137) [-1936.203] (-1933.646) -- 0:00:51
752500 -- (-1939.633) (-1937.149) [-1936.813] (-1936.348) * (-1937.661) (-1940.389) (-1934.205) [-1935.619] -- 0:00:51
753000 -- (-1935.479) (-1937.218) [-1934.468] (-1930.218) * (-1938.422) (-1938.627) (-1933.611) [-1935.258] -- 0:00:51
753500 -- [-1931.406] (-1931.656) (-1935.988) (-1933.253) * (-1938.019) (-1936.636) (-1932.273) [-1933.956] -- 0:00:51
754000 -- (-1933.520) [-1935.572] (-1934.717) (-1936.033) * (-1938.444) (-1934.452) (-1932.920) [-1933.389] -- 0:00:50
754500 -- (-1937.150) [-1932.938] (-1935.907) (-1941.433) * (-1932.661) (-1939.208) (-1941.587) [-1936.090] -- 0:00:50
755000 -- (-1942.886) (-1931.704) [-1937.623] (-1935.160) * [-1933.756] (-1940.396) (-1941.162) (-1934.813) -- 0:00:50
Average standard deviation of split frequencies: 0.000000
755500 -- [-1936.372] (-1934.634) (-1934.467) (-1937.519) * [-1932.683] (-1935.735) (-1938.882) (-1936.132) -- 0:00:50
756000 -- [-1931.739] (-1938.439) (-1934.186) (-1932.368) * (-1937.298) (-1933.901) (-1938.254) [-1937.577] -- 0:00:50
756500 -- (-1930.613) (-1935.058) [-1933.424] (-1937.784) * (-1934.920) (-1931.173) (-1932.621) [-1935.526] -- 0:00:50
757000 -- (-1931.144) (-1935.304) [-1936.173] (-1933.021) * (-1935.560) (-1936.239) (-1931.316) [-1933.601] -- 0:00:50
757500 -- (-1934.983) [-1935.031] (-1935.274) (-1941.709) * [-1932.787] (-1932.226) (-1937.287) (-1932.898) -- 0:00:50
758000 -- (-1943.009) [-1932.795] (-1942.794) (-1939.720) * [-1933.439] (-1935.227) (-1936.304) (-1932.947) -- 0:00:50
758500 -- (-1938.206) (-1938.553) (-1941.082) [-1947.055] * [-1932.312] (-1934.777) (-1935.273) (-1932.455) -- 0:00:49
759000 -- (-1936.599) [-1932.283] (-1933.951) (-1935.849) * (-1930.789) (-1932.673) (-1930.433) [-1934.864] -- 0:00:49
759500 -- (-1937.609) (-1934.309) (-1933.696) [-1941.259] * (-1937.890) (-1942.891) (-1934.995) [-1931.933] -- 0:00:49
760000 -- (-1942.519) (-1937.225) [-1933.207] (-1941.189) * [-1936.931] (-1943.536) (-1930.006) (-1934.520) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
760500 -- (-1937.870) (-1936.919) [-1939.387] (-1934.931) * [-1936.452] (-1932.808) (-1932.978) (-1935.884) -- 0:00:49
761000 -- (-1934.051) (-1939.089) (-1938.406) [-1936.717] * [-1934.298] (-1934.782) (-1932.566) (-1937.756) -- 0:00:49
761500 -- (-1933.688) (-1934.702) [-1938.278] (-1941.514) * (-1939.665) (-1932.707) [-1933.282] (-1939.749) -- 0:00:49
762000 -- (-1939.162) [-1934.486] (-1932.945) (-1934.145) * [-1937.002] (-1933.251) (-1936.297) (-1933.784) -- 0:00:49
762500 -- (-1950.184) (-1934.072) [-1941.638] (-1941.353) * [-1936.668] (-1937.834) (-1946.882) (-1935.089) -- 0:00:49
763000 -- (-1930.891) [-1932.253] (-1937.424) (-1939.862) * (-1936.054) (-1936.217) (-1932.785) [-1937.136] -- 0:00:49
763500 -- (-1938.450) [-1934.430] (-1939.480) (-1936.606) * (-1935.978) [-1934.178] (-1939.092) (-1931.214) -- 0:00:48
764000 -- (-1931.989) (-1937.740) [-1935.300] (-1934.607) * (-1936.649) (-1942.079) (-1934.967) [-1933.902] -- 0:00:48
764500 -- (-1932.716) [-1934.903] (-1932.277) (-1934.868) * (-1935.095) (-1938.604) [-1932.522] (-1930.638) -- 0:00:48
765000 -- [-1940.163] (-1934.207) (-1936.830) (-1932.859) * [-1932.356] (-1935.514) (-1932.613) (-1935.555) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
765500 -- [-1935.258] (-1935.316) (-1932.863) (-1943.595) * (-1932.678) [-1937.513] (-1936.359) (-1941.404) -- 0:00:48
766000 -- (-1938.286) [-1935.465] (-1930.966) (-1944.932) * (-1934.384) (-1935.442) [-1936.708] (-1944.891) -- 0:00:48
766500 -- (-1943.335) (-1934.853) (-1933.155) [-1936.419] * (-1938.221) (-1933.039) (-1941.160) [-1935.700] -- 0:00:48
767000 -- (-1940.551) [-1933.060] (-1938.159) (-1938.069) * (-1937.570) (-1932.977) [-1931.023] (-1943.652) -- 0:00:48
767500 -- (-1936.432) (-1939.286) [-1936.647] (-1933.560) * (-1932.904) [-1934.212] (-1936.618) (-1932.522) -- 0:00:48
768000 -- [-1941.480] (-1933.231) (-1938.153) (-1937.787) * (-1937.367) (-1934.460) (-1931.896) [-1936.471] -- 0:00:48
768500 -- [-1939.839] (-1930.168) (-1929.593) (-1935.800) * (-1937.484) [-1931.684] (-1934.665) (-1934.135) -- 0:00:47
769000 -- [-1940.224] (-1933.225) (-1932.354) (-1934.756) * (-1937.123) [-1930.670] (-1939.069) (-1939.925) -- 0:00:47
769500 -- [-1932.303] (-1932.937) (-1932.768) (-1934.037) * (-1939.609) [-1939.016] (-1933.787) (-1944.394) -- 0:00:47
770000 -- (-1937.644) [-1938.491] (-1946.553) (-1938.105) * (-1939.739) (-1942.474) (-1936.686) [-1939.785] -- 0:00:47
Average standard deviation of split frequencies: 0.000000
770500 -- (-1934.560) [-1937.787] (-1935.784) (-1934.501) * [-1937.358] (-1936.984) (-1938.206) (-1938.996) -- 0:00:47
771000 -- (-1942.404) (-1937.441) (-1933.782) [-1937.704] * (-1934.451) (-1936.985) (-1937.432) [-1936.415] -- 0:00:47
771500 -- (-1938.947) [-1934.425] (-1934.879) (-1934.702) * (-1940.438) [-1935.451] (-1934.473) (-1935.461) -- 0:00:47
772000 -- (-1940.500) [-1935.793] (-1936.094) (-1942.418) * (-1931.519) [-1929.955] (-1935.316) (-1930.710) -- 0:00:47
772500 -- [-1934.534] (-1940.813) (-1943.011) (-1934.786) * (-1937.615) (-1935.964) [-1938.890] (-1934.235) -- 0:00:47
773000 -- (-1938.933) (-1932.125) (-1937.771) [-1933.560] * (-1933.754) [-1935.464] (-1941.370) (-1932.402) -- 0:00:46
773500 -- [-1937.321] (-1931.574) (-1942.568) (-1937.671) * (-1936.145) (-1940.302) [-1937.662] (-1934.774) -- 0:00:46
774000 -- [-1932.749] (-1937.816) (-1935.779) (-1937.869) * [-1932.199] (-1940.337) (-1934.671) (-1934.377) -- 0:00:47
774500 -- [-1932.549] (-1934.693) (-1934.892) (-1937.497) * (-1934.119) [-1936.347] (-1943.343) (-1933.180) -- 0:00:46
775000 -- (-1932.053) (-1945.949) [-1934.581] (-1933.230) * [-1934.548] (-1940.432) (-1937.019) (-1932.392) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
775500 -- (-1934.433) (-1940.617) [-1932.376] (-1941.131) * (-1936.566) [-1933.299] (-1938.290) (-1942.596) -- 0:00:46
776000 -- (-1931.286) [-1938.767] (-1932.964) (-1940.728) * [-1934.976] (-1937.115) (-1935.943) (-1939.587) -- 0:00:46
776500 -- [-1937.601] (-1938.986) (-1933.575) (-1944.472) * (-1937.079) (-1938.043) (-1932.303) [-1932.562] -- 0:00:46
777000 -- (-1936.325) (-1940.942) [-1936.349] (-1937.672) * [-1937.374] (-1936.809) (-1934.399) (-1934.302) -- 0:00:46
777500 -- (-1933.390) (-1931.879) [-1934.525] (-1937.026) * (-1942.674) [-1934.203] (-1935.284) (-1937.848) -- 0:00:46
778000 -- (-1936.868) (-1934.757) (-1939.321) [-1933.630] * (-1944.395) (-1934.439) (-1938.770) [-1938.173] -- 0:00:45
778500 -- (-1936.009) [-1935.317] (-1937.465) (-1938.400) * [-1936.809] (-1933.272) (-1944.656) (-1939.695) -- 0:00:45
779000 -- (-1936.880) (-1932.242) [-1937.920] (-1940.878) * (-1936.718) (-1936.930) (-1943.317) [-1932.353] -- 0:00:45
779500 -- (-1939.268) [-1939.416] (-1939.895) (-1935.194) * (-1945.065) (-1933.743) (-1934.506) [-1934.554] -- 0:00:45
780000 -- (-1934.091) (-1935.074) (-1936.525) [-1932.487] * (-1935.715) (-1933.167) (-1936.901) [-1933.571] -- 0:00:45
Average standard deviation of split frequencies: 0.000000
780500 -- (-1941.338) (-1937.008) (-1938.925) [-1935.642] * [-1938.792] (-1935.167) (-1944.422) (-1935.599) -- 0:00:45
781000 -- (-1944.620) (-1936.988) (-1944.334) [-1936.140] * (-1931.249) [-1935.154] (-1936.726) (-1931.153) -- 0:00:45
781500 -- (-1944.342) (-1936.058) [-1937.914] (-1933.478) * (-1940.061) (-1939.093) (-1939.312) [-1935.358] -- 0:00:45
782000 -- (-1933.257) (-1941.447) (-1936.891) [-1931.337] * (-1931.745) (-1936.577) [-1936.259] (-1945.071) -- 0:00:45
782500 -- (-1938.261) (-1938.174) (-1938.924) [-1934.195] * [-1941.462] (-1942.994) (-1937.405) (-1946.237) -- 0:00:45
783000 -- (-1935.557) (-1935.290) [-1938.663] (-1931.473) * (-1933.759) (-1942.238) [-1932.738] (-1937.816) -- 0:00:44
783500 -- [-1934.790] (-1936.384) (-1941.574) (-1935.764) * (-1933.402) (-1938.591) (-1938.997) [-1931.285] -- 0:00:45
784000 -- (-1938.784) [-1937.033] (-1938.453) (-1932.626) * [-1938.373] (-1937.211) (-1946.144) (-1938.099) -- 0:00:44
784500 -- (-1936.464) [-1935.194] (-1938.588) (-1936.064) * (-1941.811) [-1934.507] (-1938.302) (-1942.160) -- 0:00:44
785000 -- (-1938.281) (-1937.124) [-1942.760] (-1934.256) * [-1941.659] (-1933.172) (-1939.679) (-1937.901) -- 0:00:44
Average standard deviation of split frequencies: 0.000000
785500 -- (-1934.888) [-1938.389] (-1932.176) (-1938.309) * (-1934.919) (-1933.053) [-1935.335] (-1936.823) -- 0:00:44
786000 -- (-1938.461) (-1936.001) (-1931.630) [-1932.347] * (-1935.561) [-1937.983] (-1929.431) (-1938.303) -- 0:00:44
786500 -- [-1939.242] (-1936.061) (-1937.935) (-1938.974) * [-1935.626] (-1933.662) (-1944.902) (-1939.719) -- 0:00:44
787000 -- (-1942.322) (-1935.627) (-1935.500) [-1937.227] * (-1939.407) (-1932.451) (-1933.263) [-1932.047] -- 0:00:44
787500 -- (-1935.727) [-1934.840] (-1933.154) (-1932.661) * (-1933.451) [-1932.979] (-1937.621) (-1938.482) -- 0:00:44
788000 -- (-1931.905) (-1938.987) (-1933.546) [-1939.330] * [-1936.957] (-1935.561) (-1932.541) (-1941.913) -- 0:00:44
788500 -- [-1932.837] (-1942.622) (-1939.364) (-1938.870) * (-1941.954) (-1936.476) [-1930.124] (-1934.773) -- 0:00:43
789000 -- (-1934.216) (-1934.819) [-1939.069] (-1938.437) * (-1941.832) (-1934.455) (-1935.165) [-1939.583] -- 0:00:43
789500 -- (-1933.163) (-1936.062) [-1936.853] (-1941.377) * (-1939.426) (-1934.380) [-1945.904] (-1936.042) -- 0:00:43
790000 -- (-1931.944) (-1934.825) [-1932.038] (-1935.065) * (-1930.802) (-1938.823) (-1936.671) [-1936.174] -- 0:00:43
Average standard deviation of split frequencies: 0.000000
790500 -- (-1929.857) (-1931.588) [-1933.668] (-1932.258) * (-1935.215) [-1933.651] (-1932.635) (-1934.690) -- 0:00:43
791000 -- [-1930.790] (-1932.606) (-1935.802) (-1931.959) * (-1937.162) [-1934.645] (-1932.715) (-1934.421) -- 0:00:43
791500 -- [-1941.778] (-1937.990) (-1933.512) (-1942.075) * (-1937.280) [-1934.153] (-1935.448) (-1938.478) -- 0:00:43
792000 -- (-1938.046) (-1936.673) [-1933.184] (-1942.768) * [-1933.934] (-1943.731) (-1942.209) (-1932.007) -- 0:00:43
792500 -- (-1936.245) (-1932.557) (-1938.487) [-1930.860] * (-1936.352) [-1939.179] (-1939.110) (-1937.677) -- 0:00:43
793000 -- (-1934.644) (-1936.648) (-1939.129) [-1934.581] * (-1940.430) (-1938.320) (-1935.648) [-1938.521] -- 0:00:43
793500 -- [-1933.265] (-1932.866) (-1935.583) (-1939.321) * (-1938.141) [-1936.876] (-1934.898) (-1936.861) -- 0:00:42
794000 -- (-1938.511) [-1934.039] (-1937.507) (-1940.629) * (-1933.606) (-1940.075) (-1941.000) [-1930.067] -- 0:00:42
794500 -- [-1934.108] (-1933.383) (-1937.704) (-1930.388) * (-1937.191) [-1934.254] (-1934.080) (-1936.494) -- 0:00:42
795000 -- (-1932.613) (-1935.870) (-1939.920) [-1932.366] * (-1935.021) (-1930.831) (-1938.331) [-1934.713] -- 0:00:42
Average standard deviation of split frequencies: 0.000000
795500 -- (-1936.371) (-1934.163) (-1937.650) [-1932.943] * (-1935.828) (-1933.759) [-1934.804] (-1941.057) -- 0:00:42
796000 -- (-1934.184) [-1933.811] (-1937.134) (-1930.458) * (-1932.915) (-1938.805) (-1939.204) [-1932.137] -- 0:00:42
796500 -- (-1937.210) (-1937.315) (-1935.641) [-1935.693] * (-1938.027) (-1931.300) [-1940.152] (-1936.512) -- 0:00:42
797000 -- (-1935.505) (-1934.098) [-1934.240] (-1937.448) * [-1930.968] (-1931.012) (-1939.603) (-1935.144) -- 0:00:42
797500 -- (-1938.060) (-1937.576) (-1933.630) [-1937.058] * (-1945.672) (-1934.297) (-1936.983) [-1935.786] -- 0:00:42
798000 -- (-1939.277) (-1939.681) (-1935.827) [-1932.299] * (-1936.439) [-1932.180] (-1936.289) (-1944.506) -- 0:00:42
798500 -- (-1936.417) (-1940.386) [-1935.686] (-1937.293) * [-1943.595] (-1930.950) (-1939.334) (-1935.772) -- 0:00:41
799000 -- (-1934.913) [-1938.223] (-1943.650) (-1935.758) * (-1941.532) (-1938.932) (-1934.108) [-1933.678] -- 0:00:41
799500 -- (-1934.275) [-1933.292] (-1946.275) (-1932.068) * (-1934.422) (-1941.894) [-1935.180] (-1935.192) -- 0:00:41
800000 -- (-1943.201) [-1937.504] (-1940.490) (-1930.385) * (-1934.038) [-1939.368] (-1937.342) (-1934.262) -- 0:00:41
Average standard deviation of split frequencies: 0.000000
800500 -- (-1943.978) [-1931.077] (-1942.996) (-1936.202) * (-1940.559) [-1938.535] (-1934.248) (-1937.165) -- 0:00:41
801000 -- [-1934.732] (-1938.442) (-1940.690) (-1936.117) * (-1936.191) [-1932.818] (-1944.726) (-1936.273) -- 0:00:41
801500 -- (-1942.234) (-1933.835) (-1941.012) [-1932.592] * (-1938.839) [-1937.130] (-1934.324) (-1942.166) -- 0:00:41
802000 -- (-1939.809) (-1934.964) (-1939.822) [-1941.196] * (-1937.747) (-1942.136) (-1935.968) [-1936.903] -- 0:00:41
802500 -- (-1946.225) [-1930.050] (-1936.317) (-1936.781) * [-1942.945] (-1935.912) (-1944.134) (-1935.637) -- 0:00:41
803000 -- (-1943.635) [-1933.592] (-1935.435) (-1934.946) * (-1934.279) (-1938.416) [-1937.500] (-1934.550) -- 0:00:40
803500 -- (-1942.480) (-1939.291) (-1936.327) [-1933.636] * (-1938.855) (-1935.421) (-1938.406) [-1933.842] -- 0:00:40
804000 -- (-1942.068) (-1935.425) [-1935.813] (-1936.531) * [-1932.447] (-1934.503) (-1935.917) (-1935.213) -- 0:00:40
804500 -- (-1936.341) (-1939.459) (-1941.643) [-1930.253] * (-1932.426) [-1939.002] (-1935.624) (-1939.308) -- 0:00:40
805000 -- (-1936.765) [-1936.693] (-1935.684) (-1932.153) * (-1936.211) [-1932.803] (-1937.057) (-1933.763) -- 0:00:40
Average standard deviation of split frequencies: 0.000000
805500 -- (-1937.790) (-1936.789) [-1934.855] (-1936.664) * (-1935.484) (-1939.116) [-1931.667] (-1932.576) -- 0:00:40
806000 -- (-1930.747) (-1937.351) [-1933.124] (-1935.443) * [-1929.683] (-1936.560) (-1930.882) (-1934.040) -- 0:00:40
806500 -- [-1933.370] (-1937.367) (-1938.498) (-1932.419) * [-1935.788] (-1935.663) (-1932.043) (-1944.762) -- 0:00:40
807000 -- [-1932.872] (-1936.172) (-1933.321) (-1932.121) * [-1936.149] (-1935.084) (-1932.742) (-1935.359) -- 0:00:40
807500 -- (-1937.962) [-1935.330] (-1941.001) (-1933.986) * (-1930.954) [-1939.580] (-1939.539) (-1935.711) -- 0:00:40
808000 -- (-1940.608) (-1943.810) (-1943.850) [-1934.300] * [-1938.674] (-1937.739) (-1938.883) (-1934.250) -- 0:00:39
808500 -- [-1932.644] (-1936.747) (-1935.605) (-1932.031) * (-1933.634) (-1932.693) (-1940.599) [-1932.162] -- 0:00:39
809000 -- (-1946.296) (-1941.537) [-1933.670] (-1934.479) * [-1933.235] (-1936.774) (-1938.365) (-1940.803) -- 0:00:39
809500 -- (-1937.108) (-1941.770) (-1931.796) [-1938.239] * (-1933.337) (-1938.299) [-1934.679] (-1942.780) -- 0:00:39
810000 -- (-1935.452) (-1937.396) (-1931.194) [-1929.988] * (-1935.238) [-1938.086] (-1936.722) (-1939.837) -- 0:00:39
Average standard deviation of split frequencies: 0.000000
810500 -- (-1933.341) (-1935.115) (-1931.480) [-1931.781] * [-1935.276] (-1934.623) (-1936.551) (-1937.146) -- 0:00:39
811000 -- (-1938.709) (-1938.775) [-1934.483] (-1938.419) * (-1940.855) (-1939.340) (-1936.191) [-1934.474] -- 0:00:39
811500 -- (-1934.966) [-1936.649] (-1932.083) (-1932.008) * (-1934.883) [-1934.447] (-1935.771) (-1938.209) -- 0:00:39
812000 -- (-1935.385) (-1937.191) [-1939.325] (-1935.368) * [-1936.535] (-1938.986) (-1933.591) (-1949.369) -- 0:00:39
812500 -- [-1933.942] (-1935.763) (-1937.127) (-1932.330) * (-1938.262) [-1934.104] (-1933.902) (-1941.750) -- 0:00:39
813000 -- (-1937.339) (-1934.102) (-1935.767) [-1934.105] * (-1940.499) (-1935.141) (-1937.940) [-1935.392] -- 0:00:38
813500 -- [-1934.941] (-1936.689) (-1937.391) (-1932.587) * (-1936.224) [-1930.614] (-1935.967) (-1940.352) -- 0:00:38
814000 -- (-1939.042) (-1941.037) (-1934.465) [-1933.455] * [-1934.221] (-1941.377) (-1933.543) (-1937.438) -- 0:00:38
814500 -- (-1939.248) (-1937.667) [-1932.351] (-1931.394) * (-1939.720) (-1939.063) (-1935.506) [-1934.372] -- 0:00:38
815000 -- (-1939.877) (-1950.812) (-1941.394) [-1937.543] * (-1931.538) [-1932.322] (-1938.845) (-1940.433) -- 0:00:38
Average standard deviation of split frequencies: 0.000000
815500 -- (-1942.474) (-1943.224) [-1935.492] (-1937.477) * (-1930.887) (-1935.864) [-1933.086] (-1939.466) -- 0:00:38
816000 -- (-1939.145) [-1935.649] (-1934.103) (-1936.189) * (-1942.725) (-1933.326) [-1933.167] (-1932.165) -- 0:00:38
816500 -- (-1934.398) (-1938.431) (-1938.671) [-1941.176] * (-1945.125) (-1932.149) [-1931.810] (-1937.057) -- 0:00:37
817000 -- (-1939.917) (-1941.417) [-1934.239] (-1936.059) * (-1939.833) (-1936.750) [-1941.715] (-1933.161) -- 0:00:38
817500 -- (-1935.615) (-1932.763) (-1933.681) [-1934.681] * [-1940.162] (-1946.659) (-1939.608) (-1932.408) -- 0:00:37
818000 -- (-1932.315) (-1931.873) [-1934.752] (-1936.632) * (-1933.353) (-1936.867) (-1938.664) [-1934.443] -- 0:00:37
818500 -- (-1933.356) (-1938.786) [-1933.669] (-1933.649) * (-1942.798) (-1936.592) (-1938.831) [-1935.734] -- 0:00:37
819000 -- (-1940.643) (-1930.189) (-1937.620) [-1936.550] * (-1932.931) (-1936.888) (-1937.795) [-1932.572] -- 0:00:37
819500 -- (-1937.481) (-1936.556) (-1939.482) [-1934.973] * (-1935.074) [-1933.899] (-1935.660) (-1936.004) -- 0:00:37
820000 -- (-1938.476) (-1935.396) (-1933.125) [-1939.292] * (-1935.189) (-1940.723) [-1938.857] (-1931.782) -- 0:00:37
Average standard deviation of split frequencies: 0.000000
820500 -- (-1937.298) (-1932.919) (-1930.411) [-1940.289] * [-1936.609] (-1936.977) (-1937.398) (-1937.150) -- 0:00:37
821000 -- (-1936.865) (-1929.880) [-1937.576] (-1936.020) * (-1934.588) [-1939.641] (-1939.256) (-1935.566) -- 0:00:37
821500 -- (-1937.763) (-1936.369) (-1933.514) [-1936.809] * (-1935.853) (-1941.184) (-1941.802) [-1935.423] -- 0:00:36
822000 -- (-1941.422) (-1931.653) [-1938.151] (-1944.273) * (-1933.792) [-1936.385] (-1936.068) (-1941.653) -- 0:00:37
822500 -- (-1939.283) (-1936.600) (-1930.378) [-1944.254] * (-1933.150) (-1936.467) (-1937.106) [-1937.423] -- 0:00:36
823000 -- [-1938.611] (-1941.806) (-1943.313) (-1947.350) * (-1932.784) (-1933.267) [-1933.891] (-1935.545) -- 0:00:36
823500 -- (-1932.464) (-1938.447) (-1931.653) [-1937.422] * (-1935.752) [-1935.735] (-1934.069) (-1935.437) -- 0:00:36
824000 -- [-1932.260] (-1942.025) (-1933.891) (-1934.794) * (-1935.982) (-1937.385) [-1933.274] (-1934.131) -- 0:00:36
824500 -- [-1933.426] (-1939.489) (-1935.555) (-1933.434) * (-1940.853) (-1934.997) [-1931.768] (-1945.033) -- 0:00:36
825000 -- (-1936.359) (-1936.327) (-1937.574) [-1933.539] * (-1939.500) (-1933.913) [-1940.928] (-1935.193) -- 0:00:36
Average standard deviation of split frequencies: 0.000000
825500 -- (-1933.622) [-1941.297] (-1935.561) (-1931.937) * [-1938.489] (-1941.510) (-1947.163) (-1945.248) -- 0:00:36
826000 -- (-1937.233) (-1936.700) (-1936.820) [-1933.776] * (-1937.567) [-1933.418] (-1942.550) (-1934.814) -- 0:00:36
826500 -- (-1935.270) (-1939.331) [-1932.556] (-1934.374) * (-1935.921) (-1935.207) (-1938.196) [-1929.732] -- 0:00:35
827000 -- (-1937.997) (-1934.974) (-1936.186) [-1940.758] * (-1938.452) (-1941.468) (-1935.409) [-1932.707] -- 0:00:35
827500 -- (-1943.040) [-1935.070] (-1937.412) (-1941.700) * (-1934.180) [-1932.162] (-1934.467) (-1930.285) -- 0:00:35
828000 -- (-1937.254) (-1936.137) [-1932.863] (-1949.790) * (-1939.350) [-1932.757] (-1935.199) (-1933.699) -- 0:00:35
828500 -- [-1935.331] (-1935.645) (-1937.302) (-1935.153) * (-1932.330) [-1932.713] (-1935.805) (-1931.120) -- 0:00:35
829000 -- [-1930.355] (-1936.354) (-1937.368) (-1934.092) * (-1942.246) (-1931.418) [-1932.657] (-1933.935) -- 0:00:35
829500 -- [-1929.354] (-1934.425) (-1938.011) (-1936.668) * (-1938.701) (-1939.629) [-1932.339] (-1934.367) -- 0:00:35
830000 -- (-1937.095) (-1940.813) (-1939.721) [-1934.341] * (-1936.547) (-1936.028) [-1934.590] (-1931.168) -- 0:00:35
Average standard deviation of split frequencies: 0.000000
830500 -- (-1933.988) [-1940.136] (-1936.857) (-1937.815) * (-1930.381) (-1937.690) (-1930.958) [-1932.697] -- 0:00:35
831000 -- (-1934.593) (-1937.518) [-1936.384] (-1934.791) * (-1945.790) (-1931.909) [-1934.360] (-1940.735) -- 0:00:34
831500 -- (-1932.446) [-1931.619] (-1933.618) (-1934.852) * (-1939.514) (-1936.348) [-1939.459] (-1932.183) -- 0:00:35
832000 -- (-1931.647) (-1937.162) (-1941.047) [-1936.202] * [-1934.855] (-1937.610) (-1937.830) (-1932.878) -- 0:00:34
832500 -- [-1928.250] (-1932.188) (-1934.759) (-1941.320) * (-1935.955) (-1932.128) (-1936.820) [-1933.705] -- 0:00:34
833000 -- (-1933.090) (-1935.814) [-1932.867] (-1931.398) * (-1936.524) (-1935.062) [-1934.653] (-1938.689) -- 0:00:34
833500 -- [-1936.443] (-1935.547) (-1938.872) (-1934.987) * (-1941.843) (-1934.497) (-1932.448) [-1932.045] -- 0:00:34
834000 -- (-1934.180) (-1942.526) (-1932.935) [-1936.445] * (-1935.497) (-1935.158) (-1932.354) [-1932.598] -- 0:00:34
834500 -- (-1934.742) (-1937.137) (-1949.859) [-1932.290] * (-1936.557) (-1936.163) (-1932.514) [-1936.811] -- 0:00:34
835000 -- [-1934.514] (-1932.414) (-1945.489) (-1935.453) * (-1941.568) (-1935.794) (-1934.687) [-1933.943] -- 0:00:34
Average standard deviation of split frequencies: 0.000000
835500 -- (-1937.007) (-1932.105) [-1935.603] (-1940.003) * (-1942.650) (-1929.077) (-1939.239) [-1942.296] -- 0:00:34
836000 -- (-1930.323) (-1932.380) (-1936.694) [-1935.300] * [-1934.291] (-1934.973) (-1937.196) (-1942.794) -- 0:00:33
836500 -- (-1937.689) (-1936.268) [-1930.886] (-1939.781) * [-1929.602] (-1936.634) (-1937.844) (-1937.753) -- 0:00:34
837000 -- (-1935.892) [-1935.188] (-1931.789) (-1937.717) * (-1938.688) (-1945.039) (-1935.299) [-1932.116] -- 0:00:33
837500 -- (-1937.093) [-1933.438] (-1937.369) (-1936.651) * (-1937.075) [-1935.342] (-1935.044) (-1935.629) -- 0:00:33
838000 -- [-1934.465] (-1931.970) (-1934.491) (-1935.447) * (-1938.714) (-1937.664) (-1933.293) [-1934.474] -- 0:00:33
838500 -- (-1944.868) [-1930.369] (-1932.938) (-1933.920) * (-1930.456) (-1939.949) (-1939.600) [-1937.943] -- 0:00:33
839000 -- [-1941.226] (-1940.075) (-1931.344) (-1940.617) * [-1932.546] (-1936.411) (-1933.872) (-1937.684) -- 0:00:33
839500 -- (-1933.563) [-1935.009] (-1933.996) (-1937.296) * (-1935.432) [-1933.586] (-1939.590) (-1935.909) -- 0:00:33
840000 -- (-1933.970) (-1936.882) (-1933.279) [-1937.019] * (-1941.769) (-1934.946) [-1934.026] (-1936.504) -- 0:00:33
Average standard deviation of split frequencies: 0.000000
840500 -- (-1938.752) [-1933.838] (-1932.413) (-1940.115) * (-1943.202) (-1933.857) [-1933.277] (-1931.657) -- 0:00:33
841000 -- (-1935.775) (-1934.360) [-1942.083] (-1940.218) * [-1931.883] (-1936.045) (-1944.353) (-1933.349) -- 0:00:32
841500 -- (-1935.113) [-1931.721] (-1937.751) (-1937.750) * (-1935.958) (-1935.586) [-1943.306] (-1930.097) -- 0:00:32
842000 -- [-1937.161] (-1931.311) (-1941.404) (-1939.911) * (-1936.015) [-1935.429] (-1942.659) (-1933.842) -- 0:00:32
842500 -- (-1940.348) (-1934.269) (-1937.051) [-1932.640] * (-1944.372) [-1936.750] (-1939.530) (-1936.520) -- 0:00:32
843000 -- (-1938.909) [-1936.504] (-1932.683) (-1939.077) * [-1933.017] (-1940.536) (-1936.072) (-1935.651) -- 0:00:32
843500 -- [-1933.141] (-1936.794) (-1933.761) (-1936.764) * (-1937.243) (-1936.351) (-1945.080) [-1931.841] -- 0:00:32
844000 -- (-1936.092) (-1939.128) (-1930.621) [-1935.865] * (-1941.052) [-1937.984] (-1936.945) (-1935.016) -- 0:00:32
844500 -- (-1934.113) (-1934.849) [-1931.013] (-1931.482) * (-1940.675) (-1935.143) [-1942.513] (-1938.055) -- 0:00:32
845000 -- [-1933.679] (-1940.562) (-1936.523) (-1934.689) * [-1931.959] (-1935.915) (-1933.931) (-1937.317) -- 0:00:32
Average standard deviation of split frequencies: 0.000000
845500 -- (-1930.640) [-1933.057] (-1932.795) (-1931.940) * (-1934.153) (-1935.270) (-1935.918) [-1937.213] -- 0:00:31
846000 -- [-1935.186] (-1931.479) (-1939.300) (-1932.320) * [-1935.655] (-1930.755) (-1935.621) (-1941.754) -- 0:00:31
846500 -- (-1936.725) (-1929.793) [-1938.905] (-1946.659) * (-1944.965) (-1936.187) (-1931.402) [-1935.108] -- 0:00:31
847000 -- [-1931.551] (-1934.496) (-1937.970) (-1937.739) * (-1936.172) (-1937.600) [-1934.502] (-1934.551) -- 0:00:31
847500 -- [-1933.941] (-1938.776) (-1936.925) (-1939.435) * [-1932.573] (-1938.635) (-1941.427) (-1941.327) -- 0:00:31
848000 -- (-1939.423) (-1944.610) [-1934.499] (-1940.838) * [-1932.479] (-1934.253) (-1938.316) (-1940.412) -- 0:00:31
848500 -- [-1939.801] (-1938.715) (-1936.788) (-1932.347) * [-1936.840] (-1933.963) (-1939.321) (-1944.792) -- 0:00:31
849000 -- (-1936.139) (-1941.101) (-1940.915) [-1938.886] * (-1931.934) [-1934.767] (-1933.384) (-1941.311) -- 0:00:31
849500 -- [-1935.278] (-1933.318) (-1933.177) (-1939.083) * (-1931.263) (-1937.305) (-1930.696) [-1938.368] -- 0:00:31
850000 -- [-1937.760] (-1931.179) (-1934.272) (-1938.509) * (-1938.404) (-1935.293) (-1939.808) [-1934.311] -- 0:00:31
Average standard deviation of split frequencies: 0.000000
850500 -- (-1937.276) (-1940.035) (-1935.086) [-1938.350] * (-1935.385) (-1931.511) (-1940.361) [-1940.841] -- 0:00:30
851000 -- (-1937.088) (-1938.523) (-1940.906) [-1940.740] * (-1937.006) (-1939.224) [-1931.885] (-1945.449) -- 0:00:30
851500 -- (-1939.547) (-1940.495) (-1935.907) [-1928.604] * (-1942.762) [-1933.163] (-1936.617) (-1935.454) -- 0:00:30
852000 -- (-1935.101) [-1934.893] (-1932.084) (-1934.346) * (-1938.795) [-1934.091] (-1938.204) (-1934.516) -- 0:00:30
852500 -- (-1935.386) (-1934.930) (-1936.872) [-1933.574] * (-1940.056) [-1930.798] (-1934.169) (-1934.993) -- 0:00:30
853000 -- [-1932.612] (-1932.616) (-1932.638) (-1937.192) * (-1943.140) (-1930.038) (-1932.132) [-1933.510] -- 0:00:30
853500 -- (-1939.946) [-1930.279] (-1932.795) (-1942.474) * [-1934.194] (-1936.472) (-1936.370) (-1934.452) -- 0:00:30
854000 -- (-1936.651) (-1931.889) (-1940.243) [-1938.351] * (-1935.921) [-1934.776] (-1931.893) (-1938.436) -- 0:00:30
854500 -- (-1937.004) [-1947.222] (-1942.886) (-1936.647) * (-1944.751) (-1937.566) [-1936.524] (-1944.586) -- 0:00:30
855000 -- (-1936.751) [-1931.141] (-1939.839) (-1931.186) * (-1940.303) [-1937.716] (-1939.295) (-1942.640) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
855500 -- [-1942.846] (-1936.177) (-1934.697) (-1936.338) * (-1937.132) (-1938.569) (-1934.023) [-1937.892] -- 0:00:29
856000 -- (-1941.864) [-1939.589] (-1936.828) (-1935.714) * (-1945.033) (-1940.964) [-1934.574] (-1939.532) -- 0:00:29
856500 -- (-1939.187) (-1934.086) [-1935.574] (-1933.057) * (-1946.023) (-1934.661) [-1932.323] (-1936.073) -- 0:00:29
857000 -- (-1938.388) [-1935.628] (-1937.155) (-1932.024) * (-1938.667) (-1941.377) [-1937.361] (-1941.168) -- 0:00:29
857500 -- [-1932.326] (-1938.411) (-1938.673) (-1935.928) * (-1943.143) [-1938.926] (-1939.315) (-1936.849) -- 0:00:29
858000 -- (-1938.082) [-1934.145] (-1936.628) (-1937.365) * (-1942.090) (-1937.503) (-1934.468) [-1936.298] -- 0:00:29
858500 -- (-1931.960) (-1938.717) (-1944.098) [-1938.095] * (-1943.004) [-1934.673] (-1933.216) (-1937.999) -- 0:00:29
859000 -- (-1931.324) [-1940.435] (-1941.977) (-1933.740) * [-1936.675] (-1931.951) (-1933.733) (-1933.377) -- 0:00:29
859500 -- (-1932.599) (-1933.721) (-1934.522) [-1938.322] * (-1935.709) [-1931.176] (-1935.763) (-1935.192) -- 0:00:29
860000 -- [-1932.517] (-1935.061) (-1940.910) (-1942.617) * (-1935.102) (-1941.366) [-1934.454] (-1934.851) -- 0:00:28
Average standard deviation of split frequencies: 0.000000
860500 -- [-1930.519] (-1934.760) (-1936.018) (-1943.416) * (-1937.744) (-1936.162) [-1935.557] (-1938.463) -- 0:00:28
861000 -- (-1938.387) (-1934.971) [-1935.974] (-1942.220) * (-1936.570) (-1938.258) [-1933.094] (-1937.177) -- 0:00:28
861500 -- (-1941.293) (-1936.443) [-1937.918] (-1933.517) * (-1936.732) (-1936.491) [-1930.954] (-1934.949) -- 0:00:28
862000 -- (-1937.193) (-1937.947) (-1936.389) [-1932.817] * [-1938.735] (-1938.777) (-1933.564) (-1936.630) -- 0:00:28
862500 -- (-1934.649) (-1943.866) [-1939.172] (-1933.431) * (-1931.068) (-1937.517) [-1935.026] (-1949.796) -- 0:00:28
863000 -- (-1935.530) (-1935.813) (-1938.939) [-1932.411] * [-1934.890] (-1932.386) (-1941.810) (-1939.627) -- 0:00:28
863500 -- (-1934.715) (-1940.111) [-1934.388] (-1933.038) * [-1936.210] (-1934.163) (-1936.085) (-1939.813) -- 0:00:28
864000 -- (-1932.508) (-1931.610) (-1938.028) [-1930.933] * (-1939.147) (-1933.791) [-1931.246] (-1934.752) -- 0:00:28
864500 -- (-1936.010) [-1934.814] (-1937.019) (-1939.083) * [-1937.631] (-1934.869) (-1938.726) (-1934.100) -- 0:00:28
865000 -- [-1936.371] (-1935.238) (-1933.582) (-1932.645) * [-1933.819] (-1933.933) (-1932.044) (-1934.542) -- 0:00:27
Average standard deviation of split frequencies: 0.000000
865500 -- (-1939.140) (-1934.096) (-1938.202) [-1937.975] * [-1938.582] (-1938.554) (-1934.660) (-1934.241) -- 0:00:27
866000 -- [-1934.210] (-1936.339) (-1933.297) (-1940.662) * (-1941.471) (-1934.866) (-1937.812) [-1934.632] -- 0:00:27
866500 -- [-1933.534] (-1930.288) (-1938.467) (-1938.775) * (-1935.025) (-1931.989) [-1933.868] (-1936.676) -- 0:00:27
867000 -- (-1937.202) [-1933.996] (-1933.903) (-1936.781) * (-1939.851) (-1935.640) (-1933.859) [-1934.309] -- 0:00:27
867500 -- (-1937.614) (-1934.994) (-1935.963) [-1936.176] * [-1940.574] (-1931.868) (-1938.816) (-1935.937) -- 0:00:27
868000 -- [-1931.527] (-1937.490) (-1936.313) (-1938.849) * [-1934.228] (-1931.997) (-1935.577) (-1931.323) -- 0:00:27
868500 -- [-1935.815] (-1940.993) (-1939.520) (-1937.426) * (-1935.746) [-1931.453] (-1935.750) (-1936.110) -- 0:00:27
869000 -- (-1936.485) (-1930.688) (-1934.434) [-1935.461] * [-1931.900] (-1937.177) (-1937.060) (-1934.542) -- 0:00:27
869500 -- (-1943.347) (-1934.687) (-1942.573) [-1937.573] * (-1939.629) (-1941.421) (-1937.668) [-1938.244] -- 0:00:27
870000 -- (-1932.227) (-1934.057) [-1936.805] (-1945.476) * (-1932.922) [-1935.701] (-1939.205) (-1937.715) -- 0:00:26
Average standard deviation of split frequencies: 0.000000
870500 -- [-1933.655] (-1936.887) (-1939.618) (-1938.007) * [-1937.399] (-1934.530) (-1936.575) (-1940.743) -- 0:00:26
871000 -- [-1938.283] (-1940.545) (-1948.087) (-1933.084) * [-1932.783] (-1937.183) (-1929.229) (-1940.245) -- 0:00:26
871500 -- [-1931.299] (-1933.652) (-1945.230) (-1934.611) * (-1934.077) [-1939.234] (-1933.310) (-1935.919) -- 0:00:26
872000 -- (-1937.155) (-1936.951) [-1938.786] (-1936.243) * (-1938.075) (-1936.071) [-1935.016] (-1935.247) -- 0:00:26
872500 -- (-1932.983) [-1930.920] (-1934.207) (-1932.061) * [-1929.846] (-1934.801) (-1939.458) (-1929.415) -- 0:00:26
873000 -- [-1934.007] (-1935.103) (-1938.423) (-1939.961) * (-1935.267) (-1934.064) (-1935.393) [-1937.597] -- 0:00:26
873500 -- (-1932.560) (-1937.226) (-1941.030) [-1936.028] * (-1939.267) (-1936.385) [-1928.964] (-1935.158) -- 0:00:26
874000 -- (-1944.151) (-1932.975) [-1932.865] (-1939.888) * (-1939.385) (-1933.984) [-1929.521] (-1933.920) -- 0:00:26
874500 -- (-1944.484) (-1937.658) [-1942.524] (-1938.875) * (-1937.692) (-1935.910) (-1942.696) [-1934.892] -- 0:00:25
875000 -- (-1939.582) [-1939.780] (-1937.571) (-1938.302) * (-1935.356) (-1936.592) [-1933.355] (-1938.004) -- 0:00:25
Average standard deviation of split frequencies: 0.000000
875500 -- (-1934.940) [-1932.447] (-1934.604) (-1934.910) * (-1943.343) (-1949.543) [-1930.990] (-1933.397) -- 0:00:25
876000 -- (-1937.393) (-1936.115) (-1934.421) [-1932.402] * [-1935.241] (-1932.894) (-1934.582) (-1937.298) -- 0:00:25
876500 -- (-1936.184) (-1936.782) (-1935.551) [-1935.384] * (-1931.847) (-1930.209) (-1935.879) [-1938.207] -- 0:00:25
877000 -- (-1934.667) [-1934.719] (-1938.981) (-1940.396) * [-1934.836] (-1932.771) (-1933.318) (-1945.748) -- 0:00:25
877500 -- (-1934.853) (-1935.757) (-1933.410) [-1933.555] * (-1934.693) (-1934.865) (-1939.977) [-1942.717] -- 0:00:25
878000 -- [-1936.215] (-1933.624) (-1936.689) (-1933.815) * (-1938.354) [-1936.030] (-1943.479) (-1940.508) -- 0:00:25
878500 -- (-1939.851) (-1935.585) (-1933.454) [-1929.392] * (-1935.410) (-1936.644) (-1936.396) [-1942.709] -- 0:00:25
879000 -- (-1937.266) (-1935.815) (-1935.950) [-1933.269] * (-1937.023) (-1936.907) [-1934.918] (-1936.639) -- 0:00:25
879500 -- (-1943.652) [-1938.325] (-1936.551) (-1933.977) * (-1937.306) (-1932.895) (-1933.656) [-1930.976] -- 0:00:24
880000 -- (-1938.259) (-1937.427) [-1941.858] (-1935.661) * [-1933.090] (-1938.750) (-1941.274) (-1939.054) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
880500 -- [-1940.279] (-1937.663) (-1933.435) (-1941.118) * (-1934.889) (-1941.066) [-1934.267] (-1934.969) -- 0:00:24
881000 -- (-1938.464) (-1936.511) (-1945.115) [-1936.484] * (-1940.202) (-1935.293) [-1933.086] (-1933.091) -- 0:00:24
881500 -- (-1929.915) (-1941.890) [-1932.031] (-1931.784) * (-1938.090) (-1940.542) (-1935.482) [-1933.584] -- 0:00:24
882000 -- (-1935.057) (-1940.174) [-1934.198] (-1936.186) * [-1931.477] (-1937.770) (-1937.718) (-1938.640) -- 0:00:24
882500 -- [-1936.091] (-1939.250) (-1929.769) (-1940.867) * (-1940.300) [-1934.188] (-1943.922) (-1942.088) -- 0:00:24
883000 -- (-1936.139) (-1936.314) (-1937.683) [-1933.069] * (-1933.729) [-1936.625] (-1935.769) (-1933.080) -- 0:00:24
883500 -- (-1936.577) [-1936.769] (-1936.639) (-1933.422) * (-1940.473) (-1934.781) (-1932.528) [-1931.156] -- 0:00:24
884000 -- [-1937.036] (-1946.969) (-1934.835) (-1933.246) * (-1942.177) (-1937.774) (-1936.608) [-1937.607] -- 0:00:24
884500 -- (-1933.369) (-1939.127) (-1939.841) [-1941.574] * [-1936.185] (-1937.060) (-1937.049) (-1936.924) -- 0:00:23
885000 -- (-1930.002) (-1936.721) (-1931.771) [-1935.135] * (-1944.546) [-1936.063] (-1939.422) (-1935.800) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
885500 -- (-1933.466) (-1935.237) [-1934.223] (-1933.545) * (-1937.252) (-1944.199) (-1933.965) [-1929.819] -- 0:00:23
886000 -- [-1934.280] (-1935.450) (-1936.527) (-1935.040) * (-1937.301) (-1945.042) [-1934.770] (-1932.379) -- 0:00:23
886500 -- [-1934.164] (-1939.417) (-1938.229) (-1935.091) * (-1939.885) [-1940.596] (-1940.071) (-1935.334) -- 0:00:23
887000 -- (-1938.584) [-1939.185] (-1940.468) (-1937.253) * (-1944.185) (-1938.700) (-1933.103) [-1933.198] -- 0:00:23
887500 -- (-1937.738) (-1938.479) (-1936.652) [-1932.594] * (-1940.351) (-1940.907) (-1936.632) [-1939.734] -- 0:00:23
888000 -- (-1939.280) (-1934.379) [-1932.968] (-1931.739) * (-1936.390) (-1936.174) [-1934.738] (-1936.663) -- 0:00:23
888500 -- (-1938.983) (-1937.827) (-1934.777) [-1931.466] * (-1933.040) (-1936.018) [-1935.361] (-1941.390) -- 0:00:23
889000 -- (-1932.295) (-1938.259) (-1941.850) [-1936.466] * (-1936.474) [-1936.668] (-1936.466) (-1939.286) -- 0:00:22
889500 -- (-1939.214) (-1940.709) [-1933.330] (-1934.462) * (-1934.031) (-1938.356) (-1942.970) [-1930.268] -- 0:00:22
890000 -- [-1937.043] (-1942.632) (-1941.351) (-1932.251) * (-1936.624) [-1938.903] (-1937.332) (-1936.787) -- 0:00:22
Average standard deviation of split frequencies: 0.000000
890500 -- [-1936.243] (-1938.108) (-1933.789) (-1930.311) * (-1936.423) (-1937.843) (-1935.371) [-1934.050] -- 0:00:22
891000 -- (-1937.300) (-1937.429) (-1938.323) [-1932.509] * (-1935.479) [-1939.821] (-1938.896) (-1937.869) -- 0:00:22
891500 -- (-1933.251) (-1936.264) [-1933.498] (-1930.185) * [-1935.736] (-1930.989) (-1937.838) (-1933.965) -- 0:00:22
892000 -- [-1936.854] (-1937.976) (-1937.575) (-1937.434) * (-1936.708) (-1936.364) (-1937.395) [-1937.033] -- 0:00:22
892500 -- (-1946.162) [-1930.258] (-1930.330) (-1935.052) * (-1933.568) [-1932.826] (-1936.882) (-1933.869) -- 0:00:22
893000 -- [-1935.088] (-1940.736) (-1937.681) (-1938.002) * (-1938.337) (-1932.531) [-1939.011] (-1933.322) -- 0:00:22
893500 -- (-1940.755) [-1932.621] (-1931.334) (-1937.541) * (-1938.752) (-1930.119) [-1930.284] (-1934.628) -- 0:00:22
894000 -- [-1935.051] (-1935.507) (-1933.829) (-1938.219) * [-1935.324] (-1937.449) (-1946.309) (-1933.606) -- 0:00:21
894500 -- [-1938.718] (-1939.299) (-1932.181) (-1933.597) * [-1937.455] (-1942.988) (-1951.914) (-1931.255) -- 0:00:21
895000 -- (-1935.514) [-1932.343] (-1934.313) (-1934.054) * (-1935.658) [-1934.076] (-1937.151) (-1941.177) -- 0:00:21
Average standard deviation of split frequencies: 0.000000
895500 -- (-1936.923) (-1931.851) [-1941.862] (-1941.751) * (-1938.076) (-1937.786) (-1940.556) [-1936.076] -- 0:00:21
896000 -- (-1939.308) [-1934.556] (-1932.843) (-1935.706) * [-1934.741] (-1938.802) (-1932.499) (-1931.390) -- 0:00:21
896500 -- (-1937.553) (-1935.263) (-1939.552) [-1932.760] * (-1937.195) [-1931.862] (-1936.159) (-1932.878) -- 0:00:21
897000 -- (-1940.561) (-1931.566) (-1934.511) [-1938.037] * (-1938.482) (-1930.877) (-1934.570) [-1932.576] -- 0:00:21
897500 -- [-1933.845] (-1935.301) (-1943.293) (-1932.670) * (-1939.026) (-1933.669) [-1932.859] (-1933.883) -- 0:00:21
898000 -- (-1936.509) (-1932.376) (-1941.715) [-1934.316] * (-1934.736) [-1935.107] (-1933.567) (-1936.474) -- 0:00:21
898500 -- [-1934.747] (-1938.610) (-1940.767) (-1932.742) * (-1937.746) (-1938.573) [-1942.337] (-1937.717) -- 0:00:21
899000 -- [-1930.895] (-1931.655) (-1938.047) (-1941.727) * (-1935.424) (-1935.972) (-1934.759) [-1934.552] -- 0:00:20
899500 -- (-1939.063) (-1933.784) (-1939.823) [-1931.994] * (-1937.110) [-1936.955] (-1935.400) (-1936.187) -- 0:00:20
900000 -- (-1934.840) (-1937.885) [-1928.005] (-1936.587) * (-1934.827) [-1937.582] (-1932.985) (-1934.865) -- 0:00:20
Average standard deviation of split frequencies: 0.000000
900500 -- [-1928.610] (-1940.118) (-1933.412) (-1934.499) * (-1931.968) (-1932.682) (-1940.806) [-1933.998] -- 0:00:20
901000 -- (-1933.807) (-1937.666) (-1933.059) [-1943.154] * (-1936.148) (-1934.567) (-1941.560) [-1934.775] -- 0:00:20
901500 -- (-1935.041) (-1938.173) (-1935.375) [-1937.200] * [-1939.202] (-1932.444) (-1944.067) (-1935.705) -- 0:00:20
902000 -- (-1935.203) [-1941.614] (-1933.840) (-1939.292) * [-1933.890] (-1938.870) (-1933.342) (-1936.626) -- 0:00:20
902500 -- (-1934.911) (-1941.433) (-1934.722) [-1935.384] * (-1934.305) (-1931.077) (-1936.114) [-1937.771] -- 0:00:20
903000 -- [-1935.295] (-1932.481) (-1938.382) (-1938.294) * (-1933.969) (-1935.630) (-1937.037) [-1935.661] -- 0:00:20
903500 -- (-1940.966) (-1941.651) (-1939.393) [-1935.846] * (-1933.608) (-1934.026) [-1930.020] (-1931.581) -- 0:00:19
904000 -- (-1941.057) (-1939.229) (-1934.731) [-1935.779] * (-1941.236) [-1932.050] (-1938.770) (-1933.792) -- 0:00:19
904500 -- [-1933.926] (-1937.136) (-1936.612) (-1934.191) * (-1935.394) (-1932.894) [-1937.955] (-1938.775) -- 0:00:19
905000 -- (-1935.011) (-1937.624) [-1932.134] (-1936.134) * (-1935.167) [-1931.750] (-1933.008) (-1946.062) -- 0:00:19
Average standard deviation of split frequencies: 0.000000
905500 -- (-1939.626) [-1935.577] (-1949.178) (-1936.546) * [-1937.065] (-1930.531) (-1937.906) (-1933.485) -- 0:00:19
906000 -- (-1933.520) [-1939.971] (-1943.196) (-1935.401) * (-1931.594) [-1932.639] (-1933.746) (-1935.833) -- 0:00:19
906500 -- (-1942.844) (-1935.639) (-1942.172) [-1932.343] * (-1929.990) (-1938.688) [-1933.020] (-1940.187) -- 0:00:19
907000 -- (-1935.143) (-1936.118) (-1935.613) [-1934.419] * [-1939.783] (-1932.408) (-1938.637) (-1936.695) -- 0:00:19
907500 -- (-1933.754) [-1934.957] (-1941.243) (-1936.256) * (-1933.810) [-1939.719] (-1935.430) (-1935.147) -- 0:00:19
908000 -- (-1943.132) [-1937.104] (-1930.996) (-1942.715) * (-1941.255) (-1933.907) [-1936.225] (-1944.896) -- 0:00:19
908500 -- (-1939.196) (-1931.515) [-1934.410] (-1935.974) * (-1937.784) (-1940.849) [-1933.577] (-1935.001) -- 0:00:18
909000 -- (-1942.865) (-1937.156) (-1934.350) [-1938.182] * (-1933.769) (-1944.265) (-1939.182) [-1939.892] -- 0:00:18
909500 -- [-1939.115] (-1934.346) (-1937.008) (-1937.899) * (-1941.553) (-1930.834) (-1942.119) [-1934.681] -- 0:00:18
910000 -- (-1938.344) [-1933.221] (-1936.595) (-1940.873) * (-1943.217) [-1936.605] (-1937.718) (-1949.989) -- 0:00:18
Average standard deviation of split frequencies: 0.000000
910500 -- (-1937.835) (-1942.482) (-1933.211) [-1936.607] * (-1931.720) [-1932.482] (-1936.274) (-1936.359) -- 0:00:18
911000 -- [-1939.350] (-1937.447) (-1934.546) (-1937.503) * (-1940.218) [-1935.012] (-1935.819) (-1938.194) -- 0:00:18
911500 -- (-1935.259) (-1939.646) [-1932.867] (-1937.792) * (-1939.144) [-1936.699] (-1934.423) (-1942.920) -- 0:00:18
912000 -- [-1934.725] (-1940.690) (-1939.370) (-1940.634) * (-1936.716) (-1937.385) [-1927.826] (-1934.414) -- 0:00:18
912500 -- (-1937.946) [-1945.334] (-1949.790) (-1940.836) * [-1935.782] (-1938.814) (-1933.473) (-1934.131) -- 0:00:18
913000 -- (-1938.060) (-1932.196) [-1932.208] (-1940.763) * [-1933.671] (-1936.847) (-1931.564) (-1934.285) -- 0:00:18
913500 -- (-1937.331) (-1937.411) (-1932.033) [-1932.664] * (-1931.643) (-1939.425) (-1939.280) [-1934.998] -- 0:00:17
914000 -- (-1934.984) (-1939.824) [-1935.778] (-1931.528) * (-1932.205) (-1930.531) [-1934.192] (-1934.081) -- 0:00:17
914500 -- (-1935.783) [-1934.805] (-1932.678) (-1937.345) * (-1938.261) [-1930.102] (-1942.543) (-1930.853) -- 0:00:17
915000 -- (-1933.981) (-1934.016) (-1931.682) [-1935.196] * (-1932.286) (-1935.571) (-1939.009) [-1931.547] -- 0:00:17
Average standard deviation of split frequencies: 0.000000
915500 -- (-1933.836) (-1936.611) [-1933.626] (-1934.318) * (-1935.028) [-1936.302] (-1939.177) (-1942.377) -- 0:00:17
916000 -- (-1934.070) (-1936.780) (-1935.562) [-1934.239] * (-1931.555) (-1936.156) (-1935.307) [-1942.307] -- 0:00:17
916500 -- (-1938.004) (-1947.044) [-1935.306] (-1948.274) * [-1936.084] (-1933.738) (-1934.764) (-1943.914) -- 0:00:17
917000 -- [-1938.285] (-1943.842) (-1939.494) (-1938.229) * (-1937.475) [-1930.970] (-1936.607) (-1943.496) -- 0:00:17
917500 -- (-1937.226) (-1943.616) (-1938.687) [-1934.042] * (-1941.143) (-1941.607) [-1936.179] (-1940.236) -- 0:00:17
918000 -- (-1935.669) [-1940.658] (-1937.356) (-1942.752) * (-1933.404) (-1934.132) (-1935.578) [-1934.703] -- 0:00:16
918500 -- (-1940.519) [-1937.415] (-1946.841) (-1940.307) * (-1944.129) [-1935.184] (-1936.929) (-1946.921) -- 0:00:16
919000 -- (-1943.915) [-1931.055] (-1946.847) (-1936.341) * (-1936.415) (-1933.380) (-1931.562) [-1932.690] -- 0:00:16
919500 -- [-1934.453] (-1934.512) (-1935.921) (-1937.741) * (-1942.682) (-1938.444) (-1932.657) [-1932.614] -- 0:00:16
920000 -- (-1935.308) [-1942.444] (-1942.561) (-1942.456) * [-1933.027] (-1939.920) (-1938.339) (-1943.601) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
920500 -- (-1935.489) (-1942.032) [-1944.418] (-1934.214) * (-1938.957) (-1931.398) (-1936.524) [-1933.357] -- 0:00:16
921000 -- [-1936.224] (-1937.828) (-1935.570) (-1934.960) * (-1933.926) (-1936.306) (-1932.228) [-1935.788] -- 0:00:16
921500 -- [-1936.783] (-1949.004) (-1932.630) (-1938.944) * (-1937.189) (-1937.928) (-1934.195) [-1935.589] -- 0:00:16
922000 -- (-1943.655) (-1939.230) [-1933.350] (-1934.094) * (-1933.048) (-1936.214) [-1932.839] (-1936.619) -- 0:00:16
922500 -- (-1946.462) [-1932.936] (-1939.568) (-1938.046) * (-1940.526) [-1930.780] (-1931.694) (-1930.726) -- 0:00:16
923000 -- (-1947.983) [-1934.455] (-1935.486) (-1936.947) * (-1932.864) [-1932.576] (-1936.040) (-1939.946) -- 0:00:15
923500 -- (-1933.929) (-1933.852) (-1944.587) [-1933.624] * (-1936.414) (-1936.053) (-1930.416) [-1940.349] -- 0:00:15
924000 -- (-1935.078) (-1931.622) (-1936.226) [-1931.746] * [-1931.842] (-1932.118) (-1933.037) (-1932.911) -- 0:00:15
924500 -- (-1937.242) (-1939.345) [-1935.902] (-1937.424) * (-1934.855) (-1934.952) [-1932.407] (-1941.243) -- 0:00:15
925000 -- (-1937.311) (-1943.351) [-1936.806] (-1938.628) * (-1937.249) (-1932.690) [-1935.551] (-1938.263) -- 0:00:15
Average standard deviation of split frequencies: 0.000000
925500 -- (-1935.746) (-1941.281) (-1937.000) [-1936.021] * (-1937.968) (-1934.524) [-1931.132] (-1937.579) -- 0:00:15
926000 -- [-1933.884] (-1939.781) (-1938.906) (-1933.356) * [-1931.535] (-1937.495) (-1933.408) (-1943.310) -- 0:00:15
926500 -- (-1937.535) (-1938.307) (-1937.245) [-1935.896] * (-1934.986) (-1940.436) [-1935.003] (-1938.043) -- 0:00:15
927000 -- (-1935.687) (-1939.281) [-1933.346] (-1944.592) * (-1944.912) [-1934.744] (-1932.418) (-1931.170) -- 0:00:15
927500 -- [-1939.454] (-1940.723) (-1933.402) (-1930.573) * [-1935.547] (-1936.013) (-1936.583) (-1941.349) -- 0:00:15
928000 -- [-1936.409] (-1937.740) (-1945.155) (-1934.561) * (-1940.020) (-1932.303) (-1936.134) [-1935.249] -- 0:00:14
928500 -- (-1937.525) (-1933.045) [-1938.818] (-1937.475) * (-1937.546) (-1938.923) (-1936.885) [-1935.533] -- 0:00:14
929000 -- (-1946.236) (-1938.928) [-1932.666] (-1938.259) * (-1945.754) (-1936.299) (-1934.480) [-1934.729] -- 0:00:14
929500 -- (-1945.160) (-1938.842) (-1938.699) [-1935.653] * (-1938.778) [-1936.674] (-1936.688) (-1933.923) -- 0:00:14
930000 -- (-1934.760) (-1933.976) (-1938.572) [-1934.509] * (-1934.749) (-1934.571) (-1935.019) [-1935.426] -- 0:00:14
Average standard deviation of split frequencies: 0.000000
930500 -- (-1932.400) (-1935.952) (-1939.419) [-1931.013] * (-1933.089) (-1933.474) (-1939.264) [-1937.167] -- 0:00:14
931000 -- [-1938.885] (-1940.083) (-1939.958) (-1931.606) * (-1934.952) (-1939.078) (-1938.702) [-1933.503] -- 0:00:14
931500 -- (-1937.630) (-1940.272) [-1931.215] (-1940.105) * (-1935.776) [-1936.176] (-1942.807) (-1937.284) -- 0:00:14
932000 -- (-1942.696) (-1936.227) [-1933.384] (-1939.683) * (-1933.077) (-1936.828) [-1930.709] (-1940.459) -- 0:00:14
932500 -- [-1934.034] (-1935.437) (-1934.389) (-1938.953) * (-1933.202) [-1936.750] (-1932.320) (-1938.276) -- 0:00:13
933000 -- (-1935.410) (-1934.586) [-1933.109] (-1933.149) * (-1944.075) (-1937.404) (-1934.527) [-1934.977] -- 0:00:13
933500 -- (-1934.817) [-1934.010] (-1935.589) (-1930.617) * (-1933.997) [-1937.498] (-1933.582) (-1932.771) -- 0:00:13
934000 -- (-1942.770) [-1939.209] (-1931.560) (-1942.502) * (-1937.607) (-1942.148) (-1934.171) [-1937.280] -- 0:00:13
934500 -- [-1935.054] (-1940.627) (-1935.994) (-1933.482) * [-1932.799] (-1932.252) (-1938.917) (-1937.622) -- 0:00:13
935000 -- (-1940.427) (-1935.311) [-1934.375] (-1932.550) * (-1938.351) [-1936.664] (-1936.442) (-1937.078) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
935500 -- [-1935.951] (-1930.391) (-1936.216) (-1933.717) * (-1938.718) (-1936.968) (-1932.115) [-1932.705] -- 0:00:13
936000 -- (-1934.357) (-1930.637) [-1936.251] (-1935.993) * (-1930.717) (-1938.848) [-1932.014] (-1933.913) -- 0:00:13
936500 -- (-1948.578) [-1936.534] (-1930.741) (-1938.101) * (-1935.879) (-1942.376) (-1929.144) [-1932.894] -- 0:00:13
937000 -- (-1938.885) (-1937.367) (-1939.075) [-1935.821] * (-1939.062) (-1938.713) (-1929.652) [-1937.820] -- 0:00:13
937500 -- (-1940.474) (-1932.196) (-1933.645) [-1934.711] * (-1938.252) (-1934.601) [-1936.096] (-1934.963) -- 0:00:12
938000 -- (-1936.990) (-1931.438) (-1940.719) [-1933.708] * (-1935.277) (-1936.678) [-1936.173] (-1936.902) -- 0:00:12
938500 -- (-1932.834) (-1940.086) [-1936.544] (-1934.505) * [-1934.607] (-1941.162) (-1943.148) (-1933.979) -- 0:00:12
939000 -- (-1942.804) (-1945.702) [-1934.954] (-1944.454) * [-1938.756] (-1937.998) (-1939.947) (-1933.084) -- 0:00:12
939500 -- [-1933.652] (-1937.649) (-1942.007) (-1933.749) * (-1941.996) [-1931.693] (-1934.467) (-1934.872) -- 0:00:12
940000 -- (-1936.990) (-1935.642) (-1934.100) [-1938.231] * [-1933.584] (-1933.139) (-1934.982) (-1936.291) -- 0:00:12
Average standard deviation of split frequencies: 0.000000
940500 -- (-1936.270) [-1934.331] (-1936.707) (-1935.225) * (-1938.349) [-1938.338] (-1935.937) (-1934.581) -- 0:00:12
941000 -- [-1940.685] (-1933.537) (-1934.643) (-1929.513) * [-1935.368] (-1934.295) (-1940.639) (-1932.923) -- 0:00:12
941500 -- [-1931.112] (-1934.863) (-1933.869) (-1949.633) * (-1933.859) [-1930.519] (-1939.046) (-1936.214) -- 0:00:12
942000 -- [-1935.325] (-1935.961) (-1933.861) (-1934.465) * (-1934.987) [-1934.461] (-1939.123) (-1936.621) -- 0:00:12
942500 -- (-1937.410) (-1934.132) [-1933.414] (-1934.187) * (-1937.894) [-1934.188] (-1937.618) (-1933.037) -- 0:00:11
943000 -- (-1933.476) (-1935.436) (-1932.469) [-1937.149] * (-1934.738) (-1936.593) (-1938.720) [-1929.172] -- 0:00:11
943500 -- (-1931.924) (-1946.117) [-1932.024] (-1933.931) * (-1936.962) [-1936.737] (-1935.914) (-1931.448) -- 0:00:11
944000 -- (-1935.121) [-1935.871] (-1932.681) (-1932.602) * (-1933.625) (-1937.342) [-1930.447] (-1935.840) -- 0:00:11
944500 -- (-1931.437) (-1936.379) (-1933.375) [-1940.527] * (-1933.071) [-1934.662] (-1942.263) (-1930.944) -- 0:00:11
945000 -- (-1938.906) (-1934.496) (-1932.881) [-1937.966] * (-1944.963) (-1932.519) (-1943.374) [-1939.333] -- 0:00:11
Average standard deviation of split frequencies: 0.000000
945500 -- (-1935.204) (-1933.588) [-1938.223] (-1931.404) * [-1931.499] (-1935.863) (-1939.314) (-1936.551) -- 0:00:11
946000 -- (-1934.108) (-1931.699) [-1936.378] (-1936.620) * [-1933.005] (-1933.140) (-1943.549) (-1937.557) -- 0:00:11
946500 -- (-1936.882) (-1935.502) (-1934.703) [-1934.710] * (-1933.116) (-1940.571) (-1943.231) [-1934.979] -- 0:00:11
947000 -- (-1935.888) [-1933.688] (-1932.341) (-1941.051) * (-1942.029) (-1933.013) [-1938.097] (-1939.430) -- 0:00:10
947500 -- (-1932.101) [-1939.060] (-1934.535) (-1938.105) * (-1933.060) (-1935.497) [-1931.000] (-1937.900) -- 0:00:10
948000 -- (-1935.469) (-1933.671) [-1934.752] (-1947.378) * (-1935.750) [-1931.941] (-1930.377) (-1939.742) -- 0:00:10
948500 -- [-1931.276] (-1936.281) (-1931.037) (-1936.900) * [-1933.783] (-1935.472) (-1937.283) (-1931.946) -- 0:00:10
949000 -- [-1933.419] (-1937.474) (-1932.621) (-1931.504) * (-1938.737) [-1938.492] (-1934.087) (-1935.365) -- 0:00:10
949500 -- [-1936.823] (-1937.633) (-1941.521) (-1939.852) * (-1939.611) (-1932.788) (-1944.804) [-1932.068] -- 0:00:10
950000 -- [-1932.821] (-1938.055) (-1943.965) (-1946.286) * (-1936.559) (-1933.557) [-1939.444] (-1932.939) -- 0:00:10
Average standard deviation of split frequencies: 0.000000
950500 -- (-1934.106) (-1944.348) (-1942.904) [-1933.464] * [-1933.811] (-1938.923) (-1933.860) (-1941.139) -- 0:00:10
951000 -- (-1937.636) (-1937.018) (-1936.934) [-1940.364] * [-1929.135] (-1936.387) (-1931.437) (-1944.385) -- 0:00:10
951500 -- (-1939.604) [-1932.948] (-1939.898) (-1935.121) * (-1933.866) (-1931.856) [-1931.621] (-1940.918) -- 0:00:10
952000 -- (-1938.317) [-1935.539] (-1932.802) (-1934.292) * [-1930.468] (-1937.951) (-1940.028) (-1941.681) -- 0:00:09
952500 -- (-1940.950) (-1933.275) [-1931.685] (-1934.940) * (-1938.303) (-1934.739) (-1942.666) [-1936.180] -- 0:00:09
953000 -- (-1939.230) (-1935.285) [-1934.819] (-1938.975) * [-1937.786] (-1934.744) (-1939.570) (-1935.557) -- 0:00:09
953500 -- (-1938.518) [-1931.549] (-1937.492) (-1933.239) * [-1930.345] (-1938.940) (-1936.076) (-1936.907) -- 0:00:09
954000 -- (-1938.888) (-1933.064) [-1945.405] (-1931.231) * [-1932.055] (-1933.698) (-1943.116) (-1932.669) -- 0:00:09
954500 -- (-1933.672) (-1934.154) (-1944.592) [-1932.963] * (-1932.699) (-1934.088) [-1934.270] (-1937.592) -- 0:00:09
955000 -- [-1935.446] (-1945.547) (-1946.285) (-1936.312) * (-1931.903) (-1936.073) [-1936.218] (-1940.813) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
955500 -- (-1932.441) [-1936.834] (-1939.174) (-1934.898) * [-1933.449] (-1933.994) (-1936.645) (-1933.470) -- 0:00:09
956000 -- (-1936.230) (-1943.143) (-1932.219) [-1933.446] * (-1936.786) [-1930.105] (-1936.994) (-1939.707) -- 0:00:09
956500 -- (-1933.540) (-1931.903) [-1934.614] (-1940.581) * (-1941.452) (-1942.719) (-1936.580) [-1932.823] -- 0:00:09
957000 -- (-1933.944) [-1933.978] (-1933.990) (-1941.680) * [-1937.532] (-1935.776) (-1934.315) (-1939.226) -- 0:00:08
957500 -- (-1931.002) (-1936.363) (-1934.155) [-1939.484] * (-1937.151) (-1934.903) (-1934.933) [-1938.273] -- 0:00:08
958000 -- [-1933.501] (-1931.911) (-1934.172) (-1934.847) * (-1932.905) (-1937.157) (-1934.141) [-1933.450] -- 0:00:08
958500 -- (-1936.628) (-1934.086) (-1937.240) [-1931.118] * (-1943.554) (-1936.212) [-1934.541] (-1936.595) -- 0:00:08
959000 -- [-1939.342] (-1937.337) (-1935.597) (-1933.494) * (-1936.819) (-1930.816) [-1933.523] (-1939.622) -- 0:00:08
959500 -- (-1939.777) (-1933.681) (-1938.191) [-1934.155] * (-1931.529) (-1934.839) (-1938.499) [-1935.179] -- 0:00:08
960000 -- (-1936.006) (-1947.819) (-1934.493) [-1934.253] * (-1938.059) (-1933.258) [-1938.961] (-1935.804) -- 0:00:08
Average standard deviation of split frequencies: 0.000000
960500 -- (-1942.128) (-1935.372) [-1938.307] (-1938.572) * (-1932.818) (-1932.110) (-1938.588) [-1932.251] -- 0:00:08
961000 -- [-1934.179] (-1940.555) (-1935.800) (-1936.045) * (-1936.750) [-1934.465] (-1937.824) (-1935.226) -- 0:00:08
961500 -- [-1931.362] (-1936.681) (-1938.591) (-1932.210) * (-1932.605) (-1936.601) [-1935.921] (-1937.177) -- 0:00:07
962000 -- (-1933.001) (-1934.967) (-1941.216) [-1932.987] * (-1933.111) [-1930.571] (-1939.336) (-1935.387) -- 0:00:07
962500 -- (-1940.768) (-1934.388) (-1946.909) [-1931.054] * (-1935.751) (-1932.680) [-1934.924] (-1938.587) -- 0:00:07
963000 -- (-1938.299) (-1938.058) [-1934.514] (-1938.980) * (-1934.866) [-1932.932] (-1937.523) (-1933.685) -- 0:00:07
963500 -- [-1941.142] (-1939.366) (-1930.431) (-1937.531) * (-1938.770) (-1936.485) [-1930.526] (-1932.673) -- 0:00:07
964000 -- (-1936.680) (-1938.214) [-1935.853] (-1935.769) * (-1943.122) [-1935.380] (-1929.600) (-1933.606) -- 0:00:07
964500 -- [-1934.098] (-1936.888) (-1937.079) (-1935.248) * (-1934.933) (-1941.017) [-1934.395] (-1943.851) -- 0:00:07
965000 -- (-1932.996) (-1938.472) (-1933.784) [-1935.493] * (-1936.618) (-1933.886) [-1937.585] (-1936.224) -- 0:00:07
Average standard deviation of split frequencies: 0.000000
965500 -- (-1938.996) [-1939.852] (-1933.217) (-1938.967) * (-1931.225) [-1930.675] (-1934.910) (-1933.455) -- 0:00:07
966000 -- (-1938.691) (-1934.544) [-1934.372] (-1935.206) * [-1935.333] (-1930.784) (-1934.962) (-1934.743) -- 0:00:07
966500 -- (-1935.909) (-1942.493) [-1930.257] (-1938.157) * (-1935.773) [-1935.254] (-1945.465) (-1933.904) -- 0:00:06
967000 -- [-1935.880] (-1943.298) (-1938.853) (-1933.297) * [-1938.358] (-1936.887) (-1935.975) (-1931.802) -- 0:00:06
967500 -- (-1934.414) [-1939.606] (-1935.932) (-1934.711) * (-1938.972) (-1939.496) [-1939.246] (-1934.187) -- 0:00:06
968000 -- [-1937.672] (-1937.169) (-1938.953) (-1935.426) * (-1942.091) (-1932.700) [-1934.969] (-1934.512) -- 0:00:06
968500 -- (-1943.208) (-1936.434) [-1932.509] (-1932.166) * [-1936.871] (-1946.563) (-1935.061) (-1944.562) -- 0:00:06
969000 -- (-1933.093) [-1931.250] (-1936.523) (-1940.822) * (-1938.878) (-1932.439) (-1941.858) [-1934.404] -- 0:00:06
969500 -- [-1933.777] (-1940.210) (-1933.843) (-1939.898) * [-1932.195] (-1933.133) (-1935.560) (-1934.845) -- 0:00:06
970000 -- (-1932.599) [-1932.996] (-1935.519) (-1933.892) * (-1936.707) [-1933.100] (-1932.432) (-1932.660) -- 0:00:06
Average standard deviation of split frequencies: 0.000000
970500 -- (-1941.668) [-1931.749] (-1934.328) (-1931.992) * (-1934.240) [-1931.271] (-1940.296) (-1931.930) -- 0:00:06
971000 -- (-1941.595) (-1935.693) (-1940.688) [-1937.905] * (-1942.698) (-1935.362) [-1935.089] (-1931.823) -- 0:00:06
971500 -- [-1936.368] (-1938.424) (-1937.182) (-1941.689) * (-1935.153) (-1935.304) (-1939.506) [-1931.825] -- 0:00:05
972000 -- (-1934.741) (-1937.914) [-1935.303] (-1931.663) * (-1935.502) (-1936.261) [-1936.893] (-1937.432) -- 0:00:05
972500 -- [-1929.190] (-1934.807) (-1949.364) (-1934.695) * (-1933.529) (-1937.415) (-1935.327) [-1932.628] -- 0:00:05
973000 -- (-1932.719) (-1933.594) [-1934.614] (-1935.620) * [-1937.113] (-1933.023) (-1934.520) (-1935.641) -- 0:00:05
973500 -- (-1938.358) (-1938.108) [-1938.733] (-1942.207) * (-1939.747) [-1932.790] (-1941.875) (-1934.199) -- 0:00:05
974000 -- (-1934.474) (-1933.803) [-1941.356] (-1936.055) * (-1946.227) (-1938.966) [-1944.899] (-1930.320) -- 0:00:05
974500 -- (-1941.676) [-1935.142] (-1932.422) (-1934.199) * [-1940.006] (-1935.287) (-1938.992) (-1935.061) -- 0:00:05
975000 -- (-1937.778) (-1939.963) (-1931.598) [-1936.611] * (-1943.334) [-1938.692] (-1936.228) (-1938.729) -- 0:00:05
Average standard deviation of split frequencies: 0.000000
975500 -- (-1935.193) (-1938.085) [-1934.301] (-1936.450) * [-1937.482] (-1935.281) (-1937.136) (-1936.281) -- 0:00:05
976000 -- (-1933.583) (-1939.872) [-1931.421] (-1932.989) * (-1936.285) (-1934.312) [-1938.957] (-1937.026) -- 0:00:04
976500 -- [-1931.815] (-1935.902) (-1933.833) (-1936.031) * [-1936.781] (-1929.914) (-1935.045) (-1939.798) -- 0:00:04
977000 -- (-1933.670) [-1932.664] (-1942.378) (-1935.028) * (-1934.851) (-1932.837) (-1939.051) [-1934.098] -- 0:00:04
977500 -- (-1935.491) [-1931.323] (-1933.502) (-1932.515) * (-1935.320) [-1933.302] (-1934.976) (-1939.849) -- 0:00:04
978000 -- (-1934.045) [-1934.305] (-1936.198) (-1938.223) * (-1940.855) (-1932.569) [-1931.399] (-1936.024) -- 0:00:04
978500 -- (-1941.709) [-1933.300] (-1930.731) (-1932.714) * [-1935.410] (-1932.864) (-1933.482) (-1938.710) -- 0:00:04
979000 -- (-1940.774) (-1931.407) (-1934.380) [-1934.252] * (-1934.970) [-1934.046] (-1933.845) (-1934.733) -- 0:00:04
979500 -- [-1934.848] (-1933.706) (-1938.739) (-1933.161) * (-1937.251) [-1934.868] (-1939.640) (-1931.845) -- 0:00:04
980000 -- (-1937.848) [-1934.034] (-1936.388) (-1933.650) * (-1933.310) (-1930.256) (-1946.881) [-1933.913] -- 0:00:04
Average standard deviation of split frequencies: 0.000000
980500 -- (-1935.474) (-1936.721) [-1934.552] (-1938.386) * (-1943.049) [-1935.249] (-1940.163) (-1937.356) -- 0:00:04
981000 -- (-1935.547) (-1934.248) (-1944.875) [-1942.079] * (-1938.982) (-1935.188) [-1934.431] (-1940.343) -- 0:00:03
981500 -- [-1936.840] (-1931.684) (-1944.489) (-1945.278) * (-1943.675) [-1938.169] (-1941.364) (-1935.794) -- 0:00:03
982000 -- (-1947.714) [-1939.983] (-1948.919) (-1931.298) * (-1936.200) (-1934.968) [-1935.781] (-1936.061) -- 0:00:03
982500 -- (-1933.793) [-1932.350] (-1938.212) (-1935.179) * (-1940.585) (-1933.253) [-1937.300] (-1937.774) -- 0:00:03
983000 -- (-1936.887) [-1934.708] (-1934.514) (-1936.728) * [-1938.332] (-1933.878) (-1936.857) (-1937.082) -- 0:00:03
983500 -- [-1935.150] (-1934.781) (-1934.780) (-1936.340) * (-1935.479) [-1933.983] (-1935.104) (-1941.101) -- 0:00:03
984000 -- [-1939.928] (-1939.680) (-1934.465) (-1935.003) * (-1935.509) [-1933.107] (-1940.853) (-1937.542) -- 0:00:03
984500 -- (-1937.274) (-1937.290) [-1935.510] (-1939.139) * (-1934.661) (-1940.381) [-1930.922] (-1942.326) -- 0:00:03
985000 -- (-1938.369) [-1933.688] (-1934.247) (-1936.714) * [-1929.024] (-1934.306) (-1932.822) (-1935.531) -- 0:00:03
Average standard deviation of split frequencies: 0.000000
985500 -- (-1939.233) (-1934.055) [-1932.740] (-1938.616) * (-1934.639) [-1938.075] (-1937.903) (-1934.435) -- 0:00:03
986000 -- [-1940.398] (-1935.460) (-1935.756) (-1933.464) * (-1938.785) (-1937.820) (-1934.331) [-1934.399] -- 0:00:02
986500 -- (-1937.874) (-1938.434) [-1933.506] (-1938.377) * (-1938.435) (-1939.245) [-1935.203] (-1935.265) -- 0:00:02
987000 -- (-1932.813) (-1935.204) (-1938.210) [-1937.486] * (-1936.712) (-1933.669) [-1934.345] (-1933.437) -- 0:00:02
987500 -- (-1935.057) [-1933.899] (-1936.438) (-1934.114) * (-1937.734) [-1932.586] (-1937.402) (-1932.430) -- 0:00:02
988000 -- (-1931.721) (-1941.499) (-1941.888) [-1938.032] * (-1936.912) (-1931.585) [-1936.017] (-1931.205) -- 0:00:02
988500 -- (-1932.024) (-1937.823) [-1939.301] (-1936.793) * (-1936.444) (-1933.856) [-1935.723] (-1936.089) -- 0:00:02
989000 -- [-1931.585] (-1938.901) (-1929.990) (-1931.267) * (-1939.133) (-1933.142) [-1933.376] (-1943.262) -- 0:00:02
989500 -- (-1937.825) [-1932.125] (-1932.379) (-1938.529) * [-1932.010] (-1946.453) (-1941.144) (-1941.169) -- 0:00:02
990000 -- (-1947.081) [-1937.287] (-1935.471) (-1943.096) * (-1936.116) (-1929.381) [-1937.608] (-1935.344) -- 0:00:02
Average standard deviation of split frequencies: 0.000000
990500 -- (-1944.139) [-1929.770] (-1931.953) (-1937.064) * (-1939.834) [-1932.519] (-1937.048) (-1931.469) -- 0:00:01
991000 -- [-1934.882] (-1930.543) (-1941.671) (-1936.397) * (-1938.982) [-1930.689] (-1932.727) (-1931.481) -- 0:00:01
991500 -- [-1938.581] (-1934.034) (-1943.184) (-1939.761) * (-1937.776) [-1934.661] (-1935.542) (-1939.568) -- 0:00:01
992000 -- [-1935.807] (-1936.947) (-1935.536) (-1942.649) * [-1939.926] (-1933.529) (-1933.312) (-1939.728) -- 0:00:01
992500 -- (-1933.895) (-1934.899) [-1935.820] (-1936.869) * (-1935.873) [-1932.597] (-1934.369) (-1941.054) -- 0:00:01
993000 -- (-1934.746) [-1938.760] (-1932.778) (-1939.879) * [-1934.526] (-1936.138) (-1937.983) (-1932.579) -- 0:00:01
993500 -- (-1938.519) (-1934.648) [-1936.037] (-1936.325) * (-1933.356) [-1939.517] (-1937.878) (-1931.993) -- 0:00:01
994000 -- (-1931.179) [-1931.654] (-1941.878) (-1939.001) * [-1938.014] (-1942.789) (-1943.002) (-1932.355) -- 0:00:01
994500 -- (-1947.314) [-1936.863] (-1940.619) (-1933.147) * (-1935.062) (-1944.073) (-1939.158) [-1931.374] -- 0:00:01
995000 -- (-1935.007) [-1932.153] (-1936.654) (-1934.136) * (-1940.973) (-1934.879) (-1942.645) [-1932.206] -- 0:00:01
Average standard deviation of split frequencies: 0.000000
995500 -- (-1933.068) (-1930.470) [-1933.225] (-1936.949) * (-1934.623) (-1937.020) [-1934.831] (-1936.949) -- 0:00:00
996000 -- (-1934.494) [-1933.529] (-1939.753) (-1939.372) * (-1932.049) (-1937.061) [-1932.463] (-1933.853) -- 0:00:00
996500 -- (-1935.043) [-1936.086] (-1937.130) (-1935.531) * (-1933.620) [-1933.136] (-1938.181) (-1935.106) -- 0:00:00
997000 -- (-1940.014) (-1932.235) (-1935.935) [-1938.317] * (-1940.382) [-1934.373] (-1936.670) (-1938.558) -- 0:00:00
997500 -- (-1939.763) (-1933.039) (-1932.988) [-1935.010] * (-1936.565) (-1934.445) (-1939.061) [-1937.020] -- 0:00:00
998000 -- (-1949.182) [-1938.191] (-1935.134) (-1937.302) * [-1930.750] (-1937.712) (-1937.955) (-1934.781) -- 0:00:00
998500 -- (-1941.670) [-1934.278] (-1941.682) (-1933.171) * (-1938.076) (-1933.280) (-1942.538) [-1938.390] -- 0:00:00
999000 -- (-1939.789) (-1937.093) [-1937.648] (-1936.895) * [-1934.690] (-1937.272) (-1949.315) (-1934.129) -- 0:00:00
999500 -- (-1942.803) [-1936.785] (-1937.685) (-1933.758) * (-1934.670) (-1942.668) [-1940.188] (-1934.175) -- 0:00:00
1000000 -- (-1935.084) [-1930.483] (-1938.794) (-1932.843) * (-1939.664) (-1937.297) [-1936.208] (-1938.516) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1935.083517 -- 12.725404
Chain 1 -- -1935.083517 -- 12.725404
Chain 2 -- -1930.482929 -- 13.690740
Chain 2 -- -1930.482928 -- 13.690740
Chain 3 -- -1938.793984 -- 15.888204
Chain 3 -- -1938.793984 -- 15.888204
Chain 4 -- -1932.843368 -- 14.518769
Chain 4 -- -1932.843367 -- 14.518769
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1939.664130 -- 11.969942
Chain 1 -- -1939.664129 -- 11.969942
Chain 2 -- -1937.296655 -- 13.707380
Chain 2 -- -1937.296655 -- 13.707380
Chain 3 -- -1936.208468 -- 15.134852
Chain 3 -- -1936.208467 -- 15.134852
Chain 4 -- -1938.515758 -- 15.306474
Chain 4 -- -1938.515758 -- 15.306474
Analysis completed in 3 mins 27 seconds
Analysis used 207.28 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1927.35
Likelihood of best state for "cold" chain of run 2 was -1927.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.6 % ( 36 %) Dirichlet(Revmat{all})
66.0 % ( 36 %) Slider(Revmat{all})
26.1 % ( 25 %) Dirichlet(Pi{all})
27.7 % ( 19 %) Slider(Pi{all})
56.4 % ( 27 %) Multiplier(Alpha{1,2})
52.7 % ( 23 %) Multiplier(Alpha{3})
70.6 % ( 43 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
25.9 % ( 31 %) Multiplier(V{all})
25.5 % ( 30 %) Nodeslider(V{all})
25.2 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
48.8 % ( 32 %) Dirichlet(Revmat{all})
65.0 % ( 53 %) Slider(Revmat{all})
25.6 % ( 23 %) Dirichlet(Pi{all})
29.4 % ( 33 %) Slider(Pi{all})
56.3 % ( 22 %) Multiplier(Alpha{1,2})
52.4 % ( 33 %) Multiplier(Alpha{3})
70.6 % ( 49 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
25.9 % ( 35 %) Multiplier(V{all})
25.4 % ( 24 %) Nodeslider(V{all})
25.4 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.57
2 | 166553 0.85 0.72
3 | 166749 166162 0.86
4 | 166164 167119 167253
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166650 0.85 0.72
3 | 166487 167179 0.86
4 | 166470 166664 166550
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1933.77
| 2 1 2 |
| 1 2 |
|1 1 1 22 1 2 2 2 |
| 2 1 1 2 2 2 1 1 |
| 1 1 * 2 2 1 1 2 1 2 |
| 2 1 2 1 1 1 1 1 1 2 2 1 2|
|2 22 21 1 2 2 1 2 2 12 2* |
| *1 1 22 12 22 22 2 1 2 * 2 1 1 1|
| 2 1 2 2 1 2 * 2 1 2 21 1 |
| 1 1 11 1 1 22 1 |
| 2 2 2 2 1 1 |
| 11 1 |
| 1 1 1 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1936.82
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1932.35 -1941.15
2 -1932.32 -1940.77
--------------------------------------
TOTAL -1932.34 -1940.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.261397 0.000573 0.216275 0.308015 0.259909 1264.65 1332.11 1.001
r(A<->C){all} 0.132227 0.000776 0.080717 0.187850 0.130416 1038.01 1062.51 1.000
r(A<->G){all} 0.281665 0.001511 0.211156 0.360357 0.280031 994.75 1100.72 1.002
r(A<->T){all} 0.108963 0.000610 0.057919 0.154683 0.108155 926.45 1020.33 1.000
r(C<->G){all} 0.112679 0.000804 0.057744 0.165526 0.110469 962.86 1021.48 1.000
r(C<->T){all} 0.254277 0.001405 0.180870 0.328324 0.253236 951.35 1031.49 1.003
r(G<->T){all} 0.110188 0.000739 0.059244 0.161419 0.108337 781.08 923.77 1.000
pi(A){all} 0.286989 0.000231 0.257292 0.315459 0.286837 1082.90 1222.98 1.001
pi(C){all} 0.237962 0.000212 0.208125 0.265894 0.237861 1074.19 1136.36 1.000
pi(G){all} 0.217708 0.000194 0.189610 0.244662 0.217185 1174.67 1202.96 1.000
pi(T){all} 0.257342 0.000225 0.228140 0.286621 0.257060 1042.41 1081.92 1.000
alpha{1,2} 0.760251 0.194257 0.154443 1.618787 0.655520 1501.00 1501.00 1.000
alpha{3} 1.591536 0.491753 0.484521 2.884768 1.460498 1122.03 1311.51 1.000
pinvar{all} 0.094085 0.005818 0.000001 0.243325 0.075379 1125.12 1313.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 3002 1.000000 0.000000 1.000000 1.000000 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.040816 0.000073 0.024852 0.057698 0.040241 1.000 2
length{all}[2] 0.017694 0.000028 0.008718 0.028999 0.017180 1.000 2
length{all}[3] 0.013072 0.000021 0.004530 0.021676 0.012603 1.001 2
length{all}[4] 0.060667 0.000121 0.039019 0.080975 0.059693 1.000 2
length{all}[5] 0.056870 0.000119 0.037683 0.079430 0.056141 1.000 2
length{all}[6] 0.050461 0.000105 0.029729 0.068770 0.049803 1.001 2
length{all}[7] 0.021816 0.000041 0.010068 0.034332 0.021198 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000000
Maximum standard deviation of split frequencies = 0.000000
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C2 (2)
|----------------100----------------+
+ \------------------------------------ C3 (3)
|
| /------------------------------------ C4 (4)
\----------------100----------------+
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/-------------------------- C1 (1)
|
| /----------- C2 (2)
|-------------+
+ \-------- C3 (3)
|
| /--------------------------------------- C4 (4)
\--------------------------------+
\------------------------------------- C5 (5)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1 tree sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 756
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
169 patterns at 252 / 252 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
164944 bytes for conP
22984 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
247416 bytes for conP, adjusted
0.114854 0.057578 0.042833 0.037973 0.125287 0.174123 0.152478 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1987.326283
Iterating by ming2
Initial: fx= 1987.326283
x= 0.11485 0.05758 0.04283 0.03797 0.12529 0.17412 0.15248 0.30000 1.30000
1 h-m-p 0.0000 0.0015 200.9598 +++YCYYCCC 1961.426407 6 0.0012 27 | 0/9
2 h-m-p 0.0001 0.0029 2214.4956 YYCCCC 1941.154215 5 0.0002 47 | 0/9
3 h-m-p 0.0002 0.0008 276.6531 +YYCYCCC 1927.567992 6 0.0006 69 | 0/9
4 h-m-p 0.0008 0.0039 55.5784 CCC 1926.510305 2 0.0008 85 | 0/9
5 h-m-p 0.0003 0.0036 131.5960 YCCC 1924.747131 3 0.0006 102 | 0/9
6 h-m-p 0.0005 0.0061 167.6175 +YYCYYYYYYY 1903.418305 10 0.0041 125 | 0/9
7 h-m-p 0.0012 0.0058 50.7356 YCCC 1903.082877 3 0.0005 142 | 0/9
8 h-m-p 0.0047 0.0315 5.4813 YC 1903.065083 1 0.0010 155 | 0/9
9 h-m-p 0.0301 1.2616 0.1768 +YCCC 1901.837345 3 0.2477 173 | 0/9
10 h-m-p 0.0009 0.0111 48.7171 CYCC 1900.063616 3 0.0013 199 | 0/9
11 h-m-p 0.3086 2.2572 0.2037 CCCCC 1898.682932 4 0.3938 219 | 0/9
12 h-m-p 0.8335 5.4600 0.0963 YCCCC 1896.744508 4 1.4967 247 | 0/9
13 h-m-p 0.7671 3.8356 0.1307 YCCCC 1893.754688 4 1.6967 275 | 0/9
14 h-m-p 1.6000 8.0000 0.0508 CCCC 1892.690458 3 1.8928 302 | 0/9
15 h-m-p 1.6000 8.0000 0.0433 YCCC 1892.447924 3 2.6593 328 | 0/9
16 h-m-p 1.6000 8.0000 0.0423 CC 1892.335512 1 1.8778 351 | 0/9
17 h-m-p 1.6000 8.0000 0.0170 CC 1892.321395 1 1.3647 374 | 0/9
18 h-m-p 1.6000 8.0000 0.0022 YC 1892.321083 1 1.1072 396 | 0/9
19 h-m-p 1.6000 8.0000 0.0003 Y 1892.321075 0 0.8402 417 | 0/9
20 h-m-p 1.6000 8.0000 0.0001 Y 1892.321075 0 1.1425 438 | 0/9
21 h-m-p 1.6000 8.0000 0.0000 Y 1892.321075 0 1.1998 459 | 0/9
22 h-m-p 1.6000 8.0000 0.0000 -Y 1892.321075 0 0.1000 481 | 0/9
23 h-m-p 0.0958 8.0000 0.0000 ----Y 1892.321075 0 0.0001 506
Out..
lnL = -1892.321075
507 lfun, 507 eigenQcodon, 3549 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
0.114854 0.057578 0.042833 0.037973 0.125287 0.174123 0.152478 1.764351 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.771190
np = 10
lnL0 = -1897.754427
Iterating by ming2
Initial: fx= 1897.754427
x= 0.11485 0.05758 0.04283 0.03797 0.12529 0.17412 0.15248 1.76435 0.57321 0.49224
1 h-m-p 0.0000 0.0032 46.8579 +++YCCC 1897.282581 3 0.0005 23 | 0/10
2 h-m-p 0.0004 0.0111 58.0883 +YCYC 1895.264316 3 0.0024 41 | 0/10
3 h-m-p 0.0003 0.0017 218.5728 CYCCCC 1893.011703 5 0.0006 63 | 0/10
4 h-m-p 0.0002 0.0010 317.3318 YCCCCC 1891.908901 5 0.0002 85 | 0/10
5 h-m-p 0.0018 0.0089 29.8003 YCC 1891.824566 2 0.0003 101 | 0/10
6 h-m-p 0.0062 0.4403 1.5423 YC 1891.785156 1 0.0129 115 | 0/10
7 h-m-p 0.0011 0.0336 18.5285 +YCCC 1891.537930 3 0.0067 134 | 0/10
8 h-m-p 0.0049 0.0249 25.1256 C 1891.474698 0 0.0012 147 | 0/10
9 h-m-p 0.0044 0.0606 6.9311 CC 1891.446507 1 0.0018 162 | 0/10
10 h-m-p 0.0019 0.2010 6.3459 ++CCC 1890.942219 2 0.0297 181 | 0/10
11 h-m-p 0.1559 1.6740 1.2095 YCCCC 1889.799338 4 0.2851 201 | 0/10
12 h-m-p 1.6000 8.0000 0.0222 YCC 1889.723790 2 0.9106 217 | 0/10
13 h-m-p 1.6000 8.0000 0.0073 YC 1889.720808 1 0.9680 241 | 0/10
14 h-m-p 1.6000 8.0000 0.0044 YC 1889.720692 1 0.6948 265 | 0/10
15 h-m-p 1.6000 8.0000 0.0001 Y 1889.720689 0 0.9540 288 | 0/10
16 h-m-p 1.6000 8.0000 0.0000 Y 1889.720689 0 0.8364 311 | 0/10
17 h-m-p 1.6000 8.0000 0.0000 Y 1889.720689 0 1.0039 334 | 0/10
18 h-m-p 1.6000 8.0000 0.0000 C 1889.720689 0 2.3499 357 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 --C 1889.720689 0 0.0250 382
Out..
lnL = -1889.720689
383 lfun, 1149 eigenQcodon, 5362 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
initial w for M2:NSpselection reset.
0.114854 0.057578 0.042833 0.037973 0.125287 0.174123 0.152478 1.754488 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.338510
np = 12
lnL0 = -1903.688302
Iterating by ming2
Initial: fx= 1903.688302
x= 0.11485 0.05758 0.04283 0.03797 0.12529 0.17412 0.15248 1.75449 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0192 60.2287 +++YCCC 1902.941766 3 0.0004 25 | 0/12
2 h-m-p 0.0005 0.0053 50.8576 YC 1902.084860 1 0.0010 41 | 0/12
3 h-m-p 0.0007 0.0058 74.0944 YCCC 1901.083929 3 0.0011 61 | 0/12
4 h-m-p 0.0004 0.0019 207.5432 +YCYCCC 1897.411538 5 0.0011 85 | 0/12
5 h-m-p 0.0003 0.0014 129.8924 CYC 1897.018843 2 0.0003 103 | 0/12
6 h-m-p 0.0029 0.0544 12.0505 C 1896.844692 0 0.0029 118 | 0/12
7 h-m-p 0.0011 0.0425 31.4173 +CCCC 1895.776723 3 0.0076 140 | 0/12
8 h-m-p 0.0013 0.0106 180.0797 +CCY 1891.791736 2 0.0053 160 | 0/12
9 h-m-p 0.0112 0.0561 5.3964 YCC 1891.766738 2 0.0021 178 | 0/12
10 h-m-p 0.0019 0.1714 5.7656 +++YYCC 1890.593023 3 0.1087 200 | 0/12
11 h-m-p 0.0782 0.3909 1.0520 ++ 1889.750886 m 0.3909 215 | 1/12
12 h-m-p 1.6000 8.0000 0.0714 CCC 1889.726493 2 0.5027 234 | 1/12
13 h-m-p 0.5502 8.0000 0.0652 CC 1889.721100 1 0.5016 262 | 1/12
14 h-m-p 1.6000 8.0000 0.0062 YC 1889.720721 1 1.0325 289 | 1/12
15 h-m-p 1.6000 8.0000 0.0024 YC 1889.720691 1 0.8061 316 | 1/12
16 h-m-p 1.6000 8.0000 0.0012 Y 1889.720689 0 0.8009 342 | 1/12
17 h-m-p 1.6000 8.0000 0.0001 Y 1889.720689 0 0.6943 368 | 1/12
18 h-m-p 1.6000 8.0000 0.0000 Y 1889.720689 0 0.8359 394 | 1/12
19 h-m-p 1.6000 8.0000 0.0000 Y 1889.720689 0 0.4000 420 | 1/12
20 h-m-p 1.1287 8.0000 0.0000 -------C 1889.720689 0 0.0000 453
Out..
lnL = -1889.720689
454 lfun, 1816 eigenQcodon, 9534 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1896.412161 S = -1767.096269 -122.927197
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 169 patterns 0:07
did 20 / 169 patterns 0:07
did 30 / 169 patterns 0:07
did 40 / 169 patterns 0:07
did 50 / 169 patterns 0:07
did 60 / 169 patterns 0:07
did 70 / 169 patterns 0:07
did 80 / 169 patterns 0:07
did 90 / 169 patterns 0:07
did 100 / 169 patterns 0:08
did 110 / 169 patterns 0:08
did 120 / 169 patterns 0:08
did 130 / 169 patterns 0:08
did 140 / 169 patterns 0:08
did 150 / 169 patterns 0:08
did 160 / 169 patterns 0:08
did 169 / 169 patterns 0:08
Time used: 0:08
Model 3: discrete
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
0.114854 0.057578 0.042833 0.037973 0.125287 0.174123 0.152478 1.754488 0.331355 0.382499 0.196899 0.491543 0.823032
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 8.783021
np = 13
lnL0 = -1891.294985
Iterating by ming2
Initial: fx= 1891.294985
x= 0.11485 0.05758 0.04283 0.03797 0.12529 0.17412 0.15248 1.75449 0.33136 0.38250 0.19690 0.49154 0.82303
1 h-m-p 0.0000 0.0035 42.4010 ++YCCC 1891.016829 3 0.0003 25 | 0/13
2 h-m-p 0.0005 0.0106 26.5076 YCC 1890.804397 2 0.0008 44 | 0/13
3 h-m-p 0.0009 0.0092 23.3382 YCCC 1890.522282 3 0.0017 65 | 0/13
4 h-m-p 0.0003 0.0014 116.7612 YCCC 1889.991224 3 0.0007 86 | 0/13
5 h-m-p 0.0002 0.0008 114.8188 CCC 1889.813752 2 0.0003 106 | 0/13
6 h-m-p 0.0023 0.0115 8.3384 CC 1889.792411 1 0.0008 124 | 0/13
7 h-m-p 0.0030 0.0515 2.3240 YC 1889.788145 1 0.0017 141 | 0/13
8 h-m-p 0.0009 0.0239 4.6445 ++YC 1889.750132 1 0.0094 160 | 0/13
9 h-m-p 0.0033 0.0166 4.9645 CC 1889.746514 1 0.0010 178 | 0/13
10 h-m-p 0.0144 3.1633 0.3380 ++YCC 1889.680370 2 0.4332 199 | 0/13
11 h-m-p 0.2640 1.3198 0.3087 YC 1889.668765 1 0.1620 229 | 0/13
12 h-m-p 0.1596 0.7980 0.1983 YCC 1889.663460 2 0.2378 261 | 0/13
13 h-m-p 1.6000 8.0000 0.0062 YC 1889.661478 1 0.8565 291 | 0/13
14 h-m-p 1.0422 8.0000 0.0051 C 1889.661341 0 1.4193 320 | 0/13
15 h-m-p 1.6000 8.0000 0.0027 C 1889.661327 0 2.5093 349 | 0/13
16 h-m-p 1.0537 8.0000 0.0064 ++ 1889.661184 m 8.0000 378 | 0/13
17 h-m-p 0.0087 0.0433 4.8320 +YC 1889.660921 1 0.0269 409 | 0/13
18 h-m-p 0.1428 0.7141 0.1049 ++ 1889.660787 m 0.7141 425 | 1/13
19 h-m-p 0.2735 8.0000 0.2728 ---------------.. | 1/13
20 h-m-p 0.0004 0.1987 0.4367 Y 1889.660759 0 0.0003 495 | 1/13
21 h-m-p 0.0009 0.4742 0.2841 Y 1889.660736 0 0.0007 523 | 1/13
22 h-m-p 0.0022 1.0834 0.5423 C 1889.660709 0 0.0006 551 | 1/13
23 h-m-p 0.0017 0.8261 0.5603 C 1889.660641 0 0.0016 579 | 1/13
24 h-m-p 0.0042 2.1099 0.9693 Y 1889.660596 0 0.0007 607 | 1/13
25 h-m-p 0.0023 1.1343 0.3363 C 1889.660582 0 0.0007 635 | 1/13
26 h-m-p 0.0200 8.0000 0.0120 -Y 1889.660582 0 0.0023 664 | 1/13
27 h-m-p 0.0160 8.0000 0.0275 Y 1889.660578 0 0.0290 692 | 1/13
28 h-m-p 0.0144 7.2075 0.1166 -C 1889.660578 0 0.0010 721 | 1/13
29 h-m-p 0.0161 8.0000 0.0070 ++++Y 1889.660532 0 2.6077 753 | 1/13
30 h-m-p 0.2414 8.0000 0.0758 Y 1889.660505 0 0.1483 781 | 1/13
31 h-m-p 1.6000 8.0000 0.0023 C 1889.660498 0 2.0389 809 | 1/13
32 h-m-p 0.9458 8.0000 0.0049 ++ 1889.660455 m 8.0000 837 | 1/13
33 h-m-p 0.4524 8.0000 0.0875 +C 1889.660313 0 1.8096 866 | 1/13
34 h-m-p 0.8644 8.0000 0.1832 Y 1889.660196 0 0.8644 894 | 1/13
35 h-m-p 1.4917 8.0000 0.1062 C 1889.660027 0 1.5089 922 | 1/13
36 h-m-p 1.6000 8.0000 0.0973 C 1889.659999 0 0.5881 950 | 1/13
37 h-m-p 1.6000 8.0000 0.0289 Y 1889.659987 0 1.2579 978 | 1/13
38 h-m-p 1.6000 8.0000 0.0027 +C 1889.659981 0 5.9198 1007 | 1/13
39 h-m-p 0.2738 8.0000 0.0580 Y 1889.659978 0 0.4514 1035 | 1/13
40 h-m-p 1.6000 8.0000 0.0158 Y 1889.659973 0 0.9373 1063 | 1/13
41 h-m-p 1.6000 8.0000 0.0070 Y 1889.659973 0 0.7610 1091 | 1/13
42 h-m-p 1.6000 8.0000 0.0018 Y 1889.659973 0 0.9685 1119 | 1/13
43 h-m-p 1.6000 8.0000 0.0002 C 1889.659973 0 1.4144 1147 | 1/13
44 h-m-p 1.6000 8.0000 0.0001 ------------C 1889.659973 0 0.0000 1187
Out..
lnL = -1889.659973
1188 lfun, 4752 eigenQcodon, 24948 P(t)
Time used: 0:17
Model 7: beta
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
0.114854 0.057578 0.042833 0.037973 0.125287 0.174123 0.152478 1.749571 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.172376
np = 10
lnL0 = -1891.854018
Iterating by ming2
Initial: fx= 1891.854018
x= 0.11485 0.05758 0.04283 0.03797 0.12529 0.17412 0.15248 1.74957 0.66567 1.54913
1 h-m-p 0.0000 0.0029 42.1144 ++YCCC 1891.558647 3 0.0003 22 | 0/10
2 h-m-p 0.0005 0.0116 29.6403 CCC 1891.332778 2 0.0007 39 | 0/10
3 h-m-p 0.0008 0.0052 25.7172 YYC 1891.209837 2 0.0006 54 | 0/10
4 h-m-p 0.0003 0.0080 65.7762 +CCC 1890.694877 2 0.0012 72 | 0/10
5 h-m-p 0.0005 0.0103 167.8347 CYCC 1890.044245 3 0.0007 90 | 0/10
6 h-m-p 0.0061 0.0318 18.4089 YCC 1889.970180 2 0.0009 106 | 0/10
7 h-m-p 0.0092 0.0793 1.8272 -CC 1889.968987 1 0.0007 122 | 0/10
8 h-m-p 0.0038 1.8894 0.8111 +++YC 1889.919227 1 0.1572 139 | 0/10
9 h-m-p 0.0010 0.0114 123.3820 YCCC 1889.806078 3 0.0022 167 | 0/10
10 h-m-p 0.9274 6.4739 0.2914 YC 1889.795321 1 0.1830 181 | 0/10
11 h-m-p 0.3099 6.6215 0.1721 +YYYYY 1889.714608 4 1.2394 209 | 0/10
12 h-m-p 0.7904 3.9520 0.2573 YCCCC 1889.676062 4 0.9355 239 | 0/10
13 h-m-p 1.6000 8.0000 0.0259 YC 1889.663355 1 0.8404 263 | 0/10
14 h-m-p 1.6000 8.0000 0.0098 C 1889.662653 0 0.4776 286 | 0/10
15 h-m-p 0.6386 8.0000 0.0073 C 1889.662603 0 0.8785 309 | 0/10
16 h-m-p 1.6000 8.0000 0.0010 Y 1889.662601 0 0.9414 332 | 0/10
17 h-m-p 1.6000 8.0000 0.0000 Y 1889.662601 0 1.0224 355 | 0/10
18 h-m-p 1.6000 8.0000 0.0000 Y 1889.662601 0 0.7848 378 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 C 1889.662601 0 0.4000 401 | 0/10
20 h-m-p 0.4880 8.0000 0.0000 --------------Y 1889.662601 0 0.0000 438
Out..
lnL = -1889.662601
439 lfun, 4829 eigenQcodon, 30730 P(t)
Time used: 0:28
Model 8: beta&w>1
TREE # 1
(1, (2, 3), (4, 5)); MP score: 157
initial w for M8:NSbetaw>1 reset.
0.114854 0.057578 0.042833 0.037973 0.125287 0.174123 0.152478 1.749798 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.635540
np = 12
lnL0 = -1894.533915
Iterating by ming2
Initial: fx= 1894.533915
x= 0.11485 0.05758 0.04283 0.03797 0.12529 0.17412 0.15248 1.74980 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0028 47.8650 +++YYC 1893.930718 2 0.0005 22 | 0/12
2 h-m-p 0.0004 0.0212 65.8785 YCCC 1893.235334 3 0.0007 42 | 0/12
3 h-m-p 0.0005 0.0027 71.1491 YYC 1892.803467 2 0.0004 59 | 0/12
4 h-m-p 0.0005 0.0065 65.4964 +YCC 1891.822403 2 0.0014 78 | 0/12
5 h-m-p 0.0007 0.0051 131.5625 CCC 1891.069084 2 0.0006 97 | 0/12
6 h-m-p 0.0008 0.0039 41.2416 +YCCC 1890.166966 3 0.0025 118 | 0/12
7 h-m-p 0.0003 0.0015 32.2442 YC 1890.025328 1 0.0007 134 | 0/12
8 h-m-p 0.0041 0.0204 3.5143 YC 1890.020778 1 0.0008 150 | 0/12
9 h-m-p 0.0021 1.0698 1.3408 +++CCCC 1889.801948 3 0.2060 174 | 0/12
10 h-m-p 0.0015 0.0075 62.1271 YC 1889.755997 1 0.0010 190 | 0/12
11 h-m-p 0.0658 1.6490 0.9769 CC 1889.719984 1 0.0930 207 | 0/12
12 h-m-p 1.0606 5.3032 0.0434 YC 1889.699711 1 0.8241 235 | 0/12
13 h-m-p 0.4934 2.4668 0.0432 CC 1889.696825 1 0.7589 264 | 0/12
14 h-m-p 0.3680 8.0000 0.0890 +YC 1889.692146 1 0.9876 293 | 0/12
15 h-m-p 1.3537 8.0000 0.0650 +CCC 1889.667110 2 5.6090 325 | 0/12
16 h-m-p 0.1637 0.8185 0.0218 ++ 1889.662852 m 0.8185 352 | 1/12
17 h-m-p 0.4241 8.0000 0.0415 Y 1889.662768 0 0.2022 379 | 1/12
18 h-m-p 0.6462 8.0000 0.0130 C 1889.662614 0 0.6629 405 | 1/12
19 h-m-p 1.6000 8.0000 0.0037 Y 1889.662608 0 0.7933 431 | 1/12
20 h-m-p 1.6000 8.0000 0.0005 Y 1889.662608 0 0.9141 457 | 1/12
21 h-m-p 1.6000 8.0000 0.0000 C 1889.662608 0 1.6000 483 | 1/12
22 h-m-p 0.8046 8.0000 0.0000 ++ 1889.662608 m 8.0000 509 | 1/12
23 h-m-p 0.0693 8.0000 0.0018 ++Y 1889.662608 0 2.3111 537 | 1/12
24 h-m-p 1.6000 8.0000 0.0022 ++ 1889.662607 m 8.0000 563 | 1/12
25 h-m-p 0.0470 1.3724 0.3709 +++ 1889.662601 m 1.3724 590 | 2/12
26 h-m-p 1.6000 8.0000 0.0000 Y 1889.662601 0 0.9928 616 | 2/12
27 h-m-p 0.9743 8.0000 0.0000 C 1889.662601 0 0.9743 641 | 2/12
28 h-m-p 1.6000 8.0000 0.0000 +Y 1889.662601 0 6.4000 667 | 2/12
29 h-m-p 1.1791 8.0000 0.0000 ------------C 1889.662601 0 0.0000 704
Out..
lnL = -1889.662601
705 lfun, 8460 eigenQcodon, 54285 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1895.709978 S = -1767.255764 -122.477607
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 169 patterns 0:48
did 20 / 169 patterns 0:48
did 30 / 169 patterns 0:48
did 40 / 169 patterns 0:49
did 50 / 169 patterns 0:49
did 60 / 169 patterns 0:49
did 70 / 169 patterns 0:49
did 80 / 169 patterns 0:49
did 90 / 169 patterns 0:49
did 100 / 169 patterns 0:50
did 110 / 169 patterns 0:50
did 120 / 169 patterns 0:50
did 130 / 169 patterns 0:50
did 140 / 169 patterns 0:50
did 150 / 169 patterns 0:50
did 160 / 169 patterns 0:51
did 169 / 169 patterns 0:51
Time used: 0:51
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=252
D_melanogaster_zen2-PA MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF
D_sechellia_zen2-PA MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
D_simulans_zen2-PA MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF
D_yakuba_zen2-PA MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF
D_erecta_zen2-PA MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF
**. ********* ****:::****::****** *:*:*:**********
D_melanogaster_zen2-PA SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
D_sechellia_zen2-PA SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
D_simulans_zen2-PA SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK
D_yakuba_zen2-PA SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
D_erecta_zen2-PA SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK
** *****************:*****************************
D_melanogaster_zen2-PA STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ
D_sechellia_zen2-PA STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ
D_simulans_zen2-PA STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ
D_yakuba_zen2-PA STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ
D_erecta_zen2-PA STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ
***** .:* *:*:. :** *** :::*******:*..**:***.***
D_melanogaster_zen2-PA VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL
D_sechellia_zen2-PA VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL
D_simulans_zen2-PA VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL
D_yakuba_zen2-PA DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL
D_erecta_zen2-PA DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI
. .* :*:****:*****:**:.** : : ** ***** .***: *.:
D_melanogaster_zen2-PA EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL
D_sechellia_zen2-PA ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL
D_simulans_zen2-PA ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL
D_yakuba_zen2-PA ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL
D_erecta_zen2-PA ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL
*.***::*:.*: ** *:************** ****** ****:**
D_melanogaster_zen2-PA NF
D_sechellia_zen2-PA NF
D_simulans_zen2-PA SF
D_yakuba_zen2-PA NF
D_erecta_zen2-PA NF
.*
>D_melanogaster_zen2-PA ATGTTTGCCATTCAAAGCGAAAACTATTTTGTGGACAATTACTCAGTCAG TGATTTAATGATGTATCCTTGCGTCGAGTTAAACGTAGAAGCCGCTCCCA CGGCAACAACAAGGTCTTCGGAGAAATCAAAGAGATCTCGCACGGCATTC AGCAGTCTTCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA TTTAGCCCGAACCAGGCGAATCGAGATATCACAGCGTTTGGCACTCACAG AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG TCGACCAATAGGAAGGGTGCCATTGGAGCGCTGACCACATCTATTCCACT TTCTTCCCAGTCGAGCGAAGATCTTCAAAAGGACGACCAGATCGTAGAGC GTCTCCTTCGATATGCCAACACAAATGTGGAAACAGCTCCACTCCGGCAG GTTGATCACGGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG CTACGATTACCTCCATGAATTTTCTCCTGAGCCCATGGCTCTTCCCCAAC TGCCCTTCAATGAATTCGATGCTAACTGGGCGAGTTCATGGCTGGGCCTT GAGCCAACGATTCCTATCGCAGAAAATGTAATTGAACACAATACACAGGA TCAGCCAATGATACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT CATCGTCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTG AACTTT >D_sechellia_zen2-PA ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC AGTAGCCATCAGCTAATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA TTTAGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG TCGACCAATAGGAAAGGTGTCATTGGAGAGCTGACCACGTCTATTCCACC TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC GCCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTGCACTCCGGCAG GTTCATAGCAGTGTCCTGGAGGAGGGTCAAATTACACCACCCTATCAGAG CTACGACTACCTCCATGAAATTTGTCCTGAGTTCATGGCTCTTCCCCAAC TGCCTTTCAATGAATTCGACGAAAACTGGGCGAGTTCTTGGCTGGGTCTT GAGTCAACGATTCCTGTCGCAGAACATGTAATTAAACCCAATACACAGGA TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT CATCGGCGGATATTTTGGATGTTGACGATGACTTTATTCAAAATTTGTTA AACTTT >D_simulans_zen2-PA ATGTTTGGAATTCAAAGCGAAAACTATTTTGTGGACAACTACTCAGTCAG TGATTTAATGATATATCCTTGCGTCGAGTTCAACGTAGAAGCTGCTCCCG TGGCAACAACAAGATCCTCGGAGAAATCGAAGAGGTCTCGCACGGCATTC AGTAGCCATCAGCTTATCGAACTAGAAAGGGAGTTCCATCTCAACAAATA TTTAGCCCGAGCCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACGG AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG TCGACCAATAGGAAATGTGTCATTGGAGAGCTGACCACGTCTATTCCACC TTCTTCCCAGTCGAGCGAAGATCGTCAAAAGGACGAGCAGATCGTGGAGC GTCTCCTTAGATATGCCAGCACAAATGTGGAAACAGCTCCACTCCGGCAG GTTGATCACTGTGTCCTGGAGGAGGGTCACATTACACCACCCTATCAGAG CTACGACTACCTCCATGAATTTTGTCCTGAGCCCATGGCTCTTCCCCAAC TGCCTTTCAATGAATTCGATGAAAACTGGGCGAGTTCTTGGCTGGGTCTT GAGTCAACGATTCCTGTCGCAGAAAATGTAATCGAACCCAATACACAGGA TCAGCAAATGCTACAGAATTTCTGCTGGGACTCGAATAGCTCTTCTGCTT CATCGGCGGATATTTTGGATGTTGACTATGACTTTATTCAAAATTTGTTA AGCTTT >D_yakuba_zen2-PA ATGTTTGCCTTCCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG TGATTTTGTGATGTATCCTTGCGTGGACCTCAACGTAGAAGCAGCTCCCA TTGCATCAACAAAGTCCTCGGAGAAATCGAAGAGATCTCGCACGGCATTC AGCAGCCATCAGCTAATCGAACTTGAAAGGGAGTTCCATCTCAACAAATA TTTAGCCCGAACCAGGCGAATCGAAATATCCCAGCGTTTAGCACTCACAG AGAGACAGGTTAAGATCTGGTTCCAAAATCGACGAATGAAACTCAAAAAG TCGACCAATAGGAAAGGTGCCTTTGGAGCTCCGACAACATCTATTTCGCC TTCTTCCCAATCGAGCGAAGATCTTCTGGAGAACGAGCAGATCGTGGAGC GCCTCCTTAAATATGCAAGCACAAATCTTGAAACAGCTCCACTGCGGCAG GATGATCGCGGTGTCCTACAGGATGGTCAAATTACACCACCCCATCAGAG CTACGACTACCTCCATGAATTTTGTCCTGAGCCAATAGATGTTCTCCAAC TGCACTTCAACGAATTCGATTCAGGCTGGGCGAGTACTTTGCTGAGTCTT GAGTCAACAATCCCTGTCACAGAAAACCTAATTGAACCTTATATACAGGA TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCTT CATCGGAAGATATTTTGGATGTTGACTATGACTTCATTCAAAATTTGTTG AATTTT >D_erecta_zen2-PA ATGTTTGCCACTCAAAGCGAAAACTATTTTGTGGACAACTGCTCAGTCAG TGATTTTGTGATGTATCCTTGCGTAGAGTTGAACGTAGAAGCAGCGCCCG TTGCTACAACAAAGTCCGCGGAGAAATCGAAGAGATCTCGCACTGCATTC AGCAGCCATCAGCTAATCGAACTCGAAAGGGAGTTCCATCTCAACAAATA CTTGGCCCGAACCAGGCGAATCGAGATATCCCAGCGTTTGGCACTCACAG AGAGACAGGTTAAGATCTGGTTCCAAAATCGTCGCATGAAACTCAAGAAG TCGACCAATAGGAAAGGTGCCATTGGAGCTCTCACCTCGTCTGTTTCAGC TACTTCCCAATTGAGCGAAGATCTTCTCGAGGACGAGCAGATCGTAGAGC GCCTGCTTAAATATGTAAGCACAAATGTGGAAACAGCTCCACTGCGGCAG GATGAGCGCGGTTTCCTGGCGGAGGGTCAAATTACACCACCCCATCAGAG CTACGACTACTTCCACGAATTTTGTCCCGAGCCAATAGGTGTTCCCCAAC TGCGTTTCAATGAATTCGATTCAAACTGGGCAAGTACTTTGCTGGGTATT GAGTCAACGATTCCTGTCACAGAACATTTTATTGAACCCAATGCACTGGA TCAGCCAATGCTACAGAATTTCTGCTGGGACTCGAATAGTTCTTCTGCGT CTTCGGAGGATATTTTGGATGTTGACTATGACTTTATTCAACATTTGTTG AATTTT
>D_melanogaster_zen2-PA MFAIQSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAF SSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQ VDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGL EPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDYDFIQNLL NF >D_sechellia_zen2-PA MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK STNRKGVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAALRQ VHSSVLEEGQITPPYQSYDYLHEICPEFMALPQLPFNEFDENWASSWLGL ESTIPVAEHVIKPNTQDQQMLQNFCWDSNSSSASSADILDVDDDFIQNLL NF >D_simulans_zen2-PA MFGIQSENYFVDNYSVSDLMIYPCVEFNVEAAPVATTRSSEKSKRSRTAF SSHQLIELEREFHLNKYLARARRIEISQRLALTERQVKIWFQNRRMKLKK STNRKCVIGELTTSIPPSSQSSEDRQKDEQIVERLLRYASTNVETAPLRQ VDHCVLEEGHITPPYQSYDYLHEFCPEPMALPQLPFNEFDENWASSWLGL ESTIPVAENVIEPNTQDQQMLQNFCWDSNSSSASSADILDVDYDFIQNLL SF >D_yakuba_zen2-PA MFAFQSENYFVDNCSVSDFVMYPCVDLNVEAAPIASTKSSEKSKRSRTAF SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK STNRKGAFGAPTTSISPSSQSSEDLLENEQIVERLLKYASTNLETAPLRQ DDRGVLQDGQITPPHQSYDYLHEFCPEPIDVLQLHFNEFDSGWASTLLSL ESTIPVTENLIEPYIQDQPMLQNFCWDSNSSSASSEDILDVDYDFIQNLL NF >D_erecta_zen2-PA MFATQSENYFVDNCSVSDFVMYPCVELNVEAAPVATTKSAEKSKRSRTAF SSHQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK STNRKGAIGALTSSVSATSQLSEDLLEDEQIVERLLKYVSTNVETAPLRQ DERGFLAEGQITPPHQSYDYFHEFCPEPIGVPQLRFNEFDSNWASTLLGI ESTIPVTEHFIEPNALDQPMLQNFCWDSNSSSASSEDILDVDYDFIQHLL NF
#NEXUS
[ID: 4880804508]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_zen2-PA
D_sechellia_zen2-PA
D_simulans_zen2-PA
D_yakuba_zen2-PA
D_erecta_zen2-PA
;
end;
begin trees;
translate
1 D_melanogaster_zen2-PA,
2 D_sechellia_zen2-PA,
3 D_simulans_zen2-PA,
4 D_yakuba_zen2-PA,
5 D_erecta_zen2-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04024068,(2:0.01717997,3:0.01260322)1.000:0.021198,(4:0.05969323,5:0.0561411)1.000:0.04980254);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04024068,(2:0.01717997,3:0.01260322):0.021198,(4:0.05969323,5:0.0561411):0.04980254);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1932.35 -1941.15
2 -1932.32 -1940.77
--------------------------------------
TOTAL -1932.34 -1940.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zen2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.261397 0.000573 0.216275 0.308015 0.259909 1264.65 1332.11 1.001
r(A<->C){all} 0.132227 0.000776 0.080717 0.187850 0.130416 1038.01 1062.51 1.000
r(A<->G){all} 0.281665 0.001511 0.211156 0.360357 0.280031 994.75 1100.72 1.002
r(A<->T){all} 0.108963 0.000610 0.057919 0.154683 0.108155 926.45 1020.33 1.000
r(C<->G){all} 0.112679 0.000804 0.057744 0.165526 0.110469 962.86 1021.48 1.000
r(C<->T){all} 0.254277 0.001405 0.180870 0.328324 0.253236 951.35 1031.49 1.003
r(G<->T){all} 0.110188 0.000739 0.059244 0.161419 0.108337 781.08 923.77 1.000
pi(A){all} 0.286989 0.000231 0.257292 0.315459 0.286837 1082.90 1222.98 1.001
pi(C){all} 0.237962 0.000212 0.208125 0.265894 0.237861 1074.19 1136.36 1.000
pi(G){all} 0.217708 0.000194 0.189610 0.244662 0.217185 1174.67 1202.96 1.000
pi(T){all} 0.257342 0.000225 0.228140 0.286621 0.257060 1042.41 1081.92 1.000
alpha{1,2} 0.760251 0.194257 0.154443 1.618787 0.655520 1501.00 1501.00 1.000
alpha{3} 1.591536 0.491753 0.484521 2.884768 1.460498 1122.03 1311.51 1.000
pinvar{all} 0.094085 0.005818 0.000001 0.243325 0.075379 1125.12 1313.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/442/zen2-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 252
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 5 4 5 6 7 | Ser TCT 7 6 6 5 5 | Tyr TAT 6 5 6 6 4 | Cys TGT 0 1 3 1 1
TTC 6 8 7 8 8 | TCC 1 3 3 3 3 | TAC 3 3 3 2 3 | TGC 2 2 2 3 3
Leu TTA 3 3 3 2 0 | TCA 5 3 3 5 4 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 4 3 3 4 8 | TCG 6 6 6 7 5 | TAG 0 0 0 0 0 | Trp TGG 4 4 4 3 3
----------------------------------------------------------------------------------------------------------------------
Leu CTT 6 3 4 5 2 | Pro CCT 3 5 5 5 2 | His CAT 2 5 3 4 5 | Arg CGT 3 3 4 1 3
CTC 6 6 6 7 6 | CCC 5 4 5 2 5 | CAC 2 0 2 1 1 | CGC 2 3 2 3 4
CTA 2 3 2 4 2 | CCA 5 2 3 4 4 | Gln CAA 6 7 6 6 6 | CGA 3 2 2 4 2
CTG 4 4 4 4 6 | CCG 0 0 0 1 0 | CAG 10 10 10 10 8 | CGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 8 9 7 6 7 | Thr ACT 0 0 0 1 4 | Asn AAT 10 8 9 7 8 | Ser AGT 3 4 3 4 3
ATC 5 4 5 5 4 | ACC 3 3 2 2 3 | AAC 6 6 5 7 5 | AGC 5 7 7 6 6
ATA 2 2 2 3 2 | ACA 8 7 6 9 7 | Lys AAA 3 5 4 6 5 | Arg AGA 2 3 3 2 2
Met ATG 6 5 5 4 4 | ACG 3 3 4 1 1 | AAG 6 5 5 4 5 | AGG 4 4 4 3 3
----------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 5 | Ala GCT 5 5 5 4 4 | Asp GAT 8 6 7 10 7 | Gly GGT 3 3 2 3 5
GTC 3 5 5 3 2 | GCC 5 2 3 3 3 | GAC 6 7 6 6 6 | GGC 1 0 0 1 0
GTA 3 2 2 1 4 | GCA 4 5 4 5 5 | Glu GAA 10 10 11 12 10 | GGA 1 2 2 1 1
GTG 2 4 4 4 3 | GCG 2 2 2 1 4 | GAG 10 12 12 8 13 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_zen2-PA
position 1: T:0.20635 C:0.23810 A:0.29365 G:0.26190
position 2: T:0.26984 C:0.24603 A:0.34921 G:0.13492
position 3: T:0.28571 C:0.24206 A:0.22619 G:0.24603
Average T:0.25397 C:0.24206 A:0.28968 G:0.21429
#2: D_sechellia_zen2-PA
position 1: T:0.20238 C:0.23016 A:0.29762 G:0.26984
position 2: T:0.26984 C:0.22222 A:0.35317 G:0.15476
position 3: T:0.27778 C:0.25000 A:0.22222 G:0.25000
Average T:0.25000 C:0.23413 A:0.29101 G:0.22487
#3: D_simulans_zen2-PA
position 1: T:0.21429 C:0.23413 A:0.28175 G:0.26984
position 2: T:0.26587 C:0.22619 A:0.35317 G:0.15476
position 3: T:0.28571 C:0.25000 A:0.21032 G:0.25397
Average T:0.25529 C:0.23677 A:0.28175 G:0.22619
#4: D_yakuba_zen2-PA
position 1: T:0.21825 C:0.24603 A:0.27778 G:0.25794
position 2: T:0.27381 C:0.23016 A:0.35317 G:0.14286
position 3: T:0.28175 C:0.24603 A:0.25397 G:0.21825
Average T:0.25794 C:0.24074 A:0.29497 G:0.20635
#5: D_erecta_zen2-PA
position 1: T:0.21429 C:0.22619 A:0.27381 G:0.28571
position 2: T:0.27778 C:0.23413 A:0.34127 G:0.14683
position 3: T:0.28571 C:0.24603 A:0.21429 G:0.25397
Average T:0.25926 C:0.23545 A:0.27646 G:0.22884
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 27 | Ser S TCT 29 | Tyr Y TAT 27 | Cys C TGT 6
TTC 37 | TCC 13 | TAC 14 | TGC 12
Leu L TTA 11 | TCA 20 | *** * TAA 0 | *** * TGA 0
TTG 22 | TCG 30 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 20 | Pro P CCT 20 | His H CAT 19 | Arg R CGT 14
CTC 31 | CCC 21 | CAC 6 | CGC 14
CTA 13 | CCA 18 | Gln Q CAA 31 | CGA 13
CTG 22 | CCG 1 | CAG 48 | CGG 5
------------------------------------------------------------------------------
Ile I ATT 37 | Thr T ACT 5 | Asn N AAT 42 | Ser S AGT 17
ATC 23 | ACC 13 | AAC 29 | AGC 31
ATA 11 | ACA 37 | Lys K AAA 23 | Arg R AGA 12
Met M ATG 24 | ACG 12 | AAG 25 | AGG 18
------------------------------------------------------------------------------
Val V GTT 17 | Ala A GCT 23 | Asp D GAT 38 | Gly G GGT 16
GTC 18 | GCC 16 | GAC 31 | GGC 2
GTA 12 | GCA 23 | Glu E GAA 53 | GGA 7
GTG 17 | GCG 11 | GAG 55 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21111 C:0.23492 A:0.28492 G:0.26905
position 2: T:0.27143 C:0.23175 A:0.35000 G:0.14683
position 3: T:0.28333 C:0.24683 A:0.22540 G:0.24444
Average T:0.25529 C:0.23783 A:0.28677 G:0.22011
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_zen2-PA
D_sechellia_zen2-PA 0.4015 (0.0557 0.1388)
D_simulans_zen2-PA 0.3064 (0.0448 0.1462) 0.8533 (0.0259 0.0304)
D_yakuba_zen2-PA 0.2986 (0.0888 0.2974) 0.4045 (0.1005 0.2484) 0.3354 (0.0924 0.2754)
D_erecta_zen2-PA 0.3538 (0.0940 0.2658) 0.4876 (0.0996 0.2042) 0.4154 (0.0953 0.2295) 0.2590 (0.0661 0.2551)
Model 0: one-ratio
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 9): -1892.321075 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.115758 0.060158 0.048725 0.035126 0.138884 0.169901 0.157567 1.764351 0.393798
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.72612
(1: 0.115758, (2: 0.048725, 3: 0.035126): 0.060158, (4: 0.169901, 5: 0.157567): 0.138884);
(D_melanogaster_zen2-PA: 0.115758, (D_sechellia_zen2-PA: 0.048725, D_simulans_zen2-PA: 0.035126): 0.060158, (D_yakuba_zen2-PA: 0.169901, D_erecta_zen2-PA: 0.157567): 0.138884);
Detailed output identifying parameters
kappa (ts/tv) = 1.76435
omega (dN/dS) = 0.39380
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.116 564.3 191.7 0.3938 0.0278 0.0705 15.7 13.5
6..7 0.060 564.3 191.7 0.3938 0.0144 0.0366 8.1 7.0
7..2 0.049 564.3 191.7 0.3938 0.0117 0.0297 6.6 5.7
7..3 0.035 564.3 191.7 0.3938 0.0084 0.0214 4.8 4.1
6..8 0.139 564.3 191.7 0.3938 0.0333 0.0846 18.8 16.2
8..4 0.170 564.3 191.7 0.3938 0.0407 0.1034 23.0 19.8
8..5 0.158 564.3 191.7 0.3938 0.0378 0.0959 21.3 18.4
tree length for dN: 0.1741
tree length for dS: 0.4421
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 10): -1889.720689 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.117404 0.061386 0.049064 0.035617 0.141853 0.173213 0.162409 1.754488 0.722599 0.196296
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.74095
(1: 0.117404, (2: 0.049064, 3: 0.035617): 0.061386, (4: 0.173213, 5: 0.162409): 0.141853);
(D_melanogaster_zen2-PA: 0.117404, (D_sechellia_zen2-PA: 0.049064, D_simulans_zen2-PA: 0.035617): 0.061386, (D_yakuba_zen2-PA: 0.173213, D_erecta_zen2-PA: 0.162409): 0.141853);
Detailed output identifying parameters
kappa (ts/tv) = 1.75449
dN/dS (w) for site classes (K=2)
p: 0.72260 0.27740
w: 0.19630 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.117 564.5 191.5 0.4192 0.0290 0.0691 16.4 13.2
6..7 0.061 564.5 191.5 0.4192 0.0151 0.0361 8.6 6.9
7..2 0.049 564.5 191.5 0.4192 0.0121 0.0289 6.8 5.5
7..3 0.036 564.5 191.5 0.4192 0.0088 0.0210 5.0 4.0
6..8 0.142 564.5 191.5 0.4192 0.0350 0.0835 19.8 16.0
8..4 0.173 564.5 191.5 0.4192 0.0427 0.1020 24.1 19.5
8..5 0.162 564.5 191.5 0.4192 0.0401 0.0956 22.6 18.3
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 12): -1889.720689 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.117404 0.061386 0.049064 0.035617 0.141853 0.173213 0.162409 1.754488 0.722599 0.182621 0.196296 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.74095
(1: 0.117404, (2: 0.049064, 3: 0.035617): 0.061386, (4: 0.173213, 5: 0.162409): 0.141853);
(D_melanogaster_zen2-PA: 0.117404, (D_sechellia_zen2-PA: 0.049064, D_simulans_zen2-PA: 0.035617): 0.061386, (D_yakuba_zen2-PA: 0.173213, D_erecta_zen2-PA: 0.162409): 0.141853);
Detailed output identifying parameters
kappa (ts/tv) = 1.75449
dN/dS (w) for site classes (K=3)
p: 0.72260 0.18262 0.09478
w: 0.19630 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.117 564.5 191.5 0.4192 0.0290 0.0691 16.4 13.2
6..7 0.061 564.5 191.5 0.4192 0.0151 0.0361 8.6 6.9
7..2 0.049 564.5 191.5 0.4192 0.0121 0.0289 6.8 5.5
7..3 0.036 564.5 191.5 0.4192 0.0088 0.0210 5.0 4.0
6..8 0.142 564.5 191.5 0.4192 0.0350 0.0835 19.8 16.0
8..4 0.173 564.5 191.5 0.4192 0.0427 0.1020 24.1 19.5
8..5 0.162 564.5 191.5 0.4192 0.0401 0.0956 22.6 18.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zen2-PA)
Pr(w>1) post mean +- SE for w
34 T 0.549 1.583 +- 0.992
153 H 0.503 1.492 +- 0.928
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.048 0.306 0.488 0.154 0.004 0.000 0.000 0.000 0.000 0.000
w2: 0.662 0.219 0.075 0.026 0.010 0.004 0.002 0.001 0.001 0.001
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.019
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.015 0.083
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.013 0.057 0.160
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.013 0.041 0.096 0.173
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.011 0.035 0.069 0.100 0.102
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 13): -1889.659973 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.117529 0.061143 0.049144 0.035553 0.141497 0.173082 0.161935 1.749571 0.238619 0.381988 0.000001 0.273927 0.811171
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.73988
(1: 0.117529, (2: 0.049144, 3: 0.035553): 0.061143, (4: 0.173082, 5: 0.161935): 0.141497);
(D_melanogaster_zen2-PA: 0.117529, (D_sechellia_zen2-PA: 0.049144, D_simulans_zen2-PA: 0.035553): 0.061143, (D_yakuba_zen2-PA: 0.173082, D_erecta_zen2-PA: 0.161935): 0.141497);
Detailed output identifying parameters
kappa (ts/tv) = 1.74957
dN/dS (w) for site classes (K=3)
p: 0.23862 0.38199 0.37939
w: 0.00000 0.27393 0.81117
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.118 564.6 191.4 0.4124 0.0288 0.0698 16.3 13.4
6..7 0.061 564.6 191.4 0.4124 0.0150 0.0363 8.5 7.0
7..2 0.049 564.6 191.4 0.4124 0.0120 0.0292 6.8 5.6
7..3 0.036 564.6 191.4 0.4124 0.0087 0.0211 4.9 4.0
6..8 0.141 564.6 191.4 0.4124 0.0347 0.0841 19.6 16.1
8..4 0.173 564.6 191.4 0.4124 0.0424 0.1028 23.9 19.7
8..5 0.162 564.6 191.4 0.4124 0.0397 0.0962 22.4 18.4
Naive Empirical Bayes (NEB) analysis
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 10): -1889.662601 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.117508 0.061180 0.049135 0.035561 0.141540 0.173092 0.162001 1.749798 0.489689 0.695692
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.74002
(1: 0.117508, (2: 0.049135, 3: 0.035561): 0.061180, (4: 0.173092, 5: 0.162001): 0.141540);
(D_melanogaster_zen2-PA: 0.117508, (D_sechellia_zen2-PA: 0.049135, D_simulans_zen2-PA: 0.035561): 0.061180, (D_yakuba_zen2-PA: 0.173092, D_erecta_zen2-PA: 0.162001): 0.141540);
Detailed output identifying parameters
kappa (ts/tv) = 1.74980
Parameters in M7 (beta):
p = 0.48969 q = 0.69569
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00349 0.03274 0.09175 0.17885 0.29072 0.42244 0.56724 0.71611 0.85671 0.96937
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.118 564.6 191.4 0.4129 0.0288 0.0698 16.3 13.3
6..7 0.061 564.6 191.4 0.4129 0.0150 0.0363 8.5 6.9
7..2 0.049 564.6 191.4 0.4129 0.0120 0.0292 6.8 5.6
7..3 0.036 564.6 191.4 0.4129 0.0087 0.0211 4.9 4.0
6..8 0.142 564.6 191.4 0.4129 0.0347 0.0840 19.6 16.1
8..4 0.173 564.6 191.4 0.4129 0.0424 0.1027 24.0 19.7
8..5 0.162 564.6 191.4 0.4129 0.0397 0.0962 22.4 18.4
Time used: 0:28
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 157
lnL(ntime: 7 np: 12): -1889.662601 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.117508 0.061180 0.049135 0.035561 0.141540 0.173092 0.162001 1.749798 0.999990 0.489695 0.695717 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.74002
(1: 0.117508, (2: 0.049135, 3: 0.035561): 0.061180, (4: 0.173092, 5: 0.162001): 0.141540);
(D_melanogaster_zen2-PA: 0.117508, (D_sechellia_zen2-PA: 0.049135, D_simulans_zen2-PA: 0.035561): 0.061180, (D_yakuba_zen2-PA: 0.173092, D_erecta_zen2-PA: 0.162001): 0.141540);
Detailed output identifying parameters
kappa (ts/tv) = 1.74980
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.48969 q = 0.69572
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00349 0.03274 0.09175 0.17884 0.29072 0.42243 0.56723 0.71610 0.85670 0.96937 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.118 564.6 191.4 0.4129 0.0288 0.0698 16.3 13.3
6..7 0.061 564.6 191.4 0.4129 0.0150 0.0363 8.5 6.9
7..2 0.049 564.6 191.4 0.4129 0.0120 0.0292 6.8 5.6
7..3 0.036 564.6 191.4 0.4129 0.0087 0.0211 4.9 4.0
6..8 0.142 564.6 191.4 0.4129 0.0347 0.0840 19.6 16.1
8..4 0.173 564.6 191.4 0.4129 0.0424 0.1027 24.0 19.7
8..5 0.162 564.6 191.4 0.4129 0.0397 0.0962 22.4 18.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zen2-PA)
Pr(w>1) post mean +- SE for w
34 T 0.589 1.438 +- 0.821
153 H 0.538 1.362 +- 0.803
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.016 0.176 0.807
p : 0.010 0.104 0.204 0.259 0.230 0.130 0.047 0.012 0.003 0.001
q : 0.002 0.007 0.047 0.059 0.089 0.112 0.137 0.160 0.183 0.204
ws: 0.724 0.216 0.047 0.010 0.002 0.001 0.000 0.000 0.000 0.000
Time used: 0:51
Model 1: NearlyNeutral -1889.720689 Model 2: PositiveSelection -1889.720689 Model 0: one-ratio -1892.321075 Model 3: discrete -1889.659973 Model 7: beta -1889.662601 Model 8: beta&w>1 -1889.662601 Model 0 vs 1 5.200772000000143 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
