--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 22 06:22:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp53C14a-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -702.58          -711.18
2       -702.61          -713.04
--------------------------------------
TOTAL     -702.59          -712.49
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.353545    0.011869    0.173850    0.567344    0.337267   1231.73   1314.19    1.000
r(A<->C){all}   0.134583    0.004993    0.017026    0.274149    0.124185    670.55    718.75    1.001
r(A<->G){all}   0.232416    0.008162    0.062889    0.400781    0.222796    564.92    604.17    1.003
r(A<->T){all}   0.077586    0.002577    0.000307    0.176311    0.066528    459.26    575.83    1.001
r(C<->G){all}   0.073809    0.003194    0.000047    0.183551    0.060621    626.64    656.34    1.000
r(C<->T){all}   0.436022    0.010450    0.247585    0.643137    0.432490    590.03    630.17    1.001
r(G<->T){all}   0.045584    0.001442    0.000028    0.118370    0.035980    655.93    790.78    1.000
pi(A){all}      0.255807    0.000489    0.213427    0.300346    0.255303   1251.73   1326.22    1.000
pi(C){all}      0.228101    0.000440    0.186222    0.266959    0.227672   1400.61   1450.81    1.000
pi(G){all}      0.242306    0.000475    0.199529    0.282988    0.242173    723.41   1112.20    1.000
pi(T){all}      0.273785    0.000535    0.225896    0.316271    0.273308   1337.89   1385.41    1.000
alpha{1,2}      0.056572    0.001991    0.000136    0.135732    0.048303   1397.36   1449.18    1.000
alpha{3}        1.548881    0.498851    0.445427    2.952872    1.443142   1486.27   1493.64    1.000
pinvar{all}     0.574638    0.010121    0.378423    0.751864    0.587031   1299.45   1346.50    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-684.335203
Model 2: PositiveSelection	-684.335203
Model 0: one-ratio	-684.504011
Model 3: discrete	-684.272861
Model 7: beta	-684.285912
Model 8: beta&w>1	-684.28592


Model 0 vs 1	0.33761600000002545

Model 2 vs 1	0.0

Model 8 vs 7	1.5999999959603883E-5
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=121 

C1              MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
C2              MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
C3              MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
C4              MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
                ******::******:.::********************************

C1              ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
C2              ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
C3              ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
C4              VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
                :*** ***:*******:****************.****************

C1              TGVGLIRPIIAKFDSLRCFDE
C2              TGVGLIRPIIAKFDSLRCFDE
C3              TGVGLIRPIIAKFDSLRCFDE
C4              TGVGLIRPIIAKFDSLRCFEE
                *******************:*




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1452]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [1452]--->[1452]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.203 Mb, Max= 30.385 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE

FORMAT of file /tmp/tmp6425574672323053685aln Not Supported[FATAL:T-COFFEE]
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:121 S:100 BS:121
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.35 C1	 C2	 98.35
TOP	    1    0	 98.35 C2	 C1	 98.35
BOT	    0    2	 99.17 C1	 C3	 99.17
TOP	    2    0	 99.17 C3	 C1	 99.17
BOT	    0    3	 91.74 C1	 C4	 91.74
TOP	    3    0	 91.74 C4	 C1	 91.74
BOT	    1    2	 99.17 C2	 C3	 99.17
TOP	    2    1	 99.17 C3	 C2	 99.17
BOT	    1    3	 90.08 C2	 C4	 90.08
TOP	    3    1	 90.08 C4	 C2	 90.08
BOT	    2    3	 90.91 C3	 C4	 90.91
TOP	    3    2	 90.91 C4	 C3	 90.91
AVG	 0	 C1	  *	 96.42
AVG	 1	 C2	  *	 95.87
AVG	 2	 C3	  *	 96.42
AVG	 3	 C4	  *	 90.91
TOT	 TOT	  *	 94.90
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTATGCCA
C2              ATGCATTTGATTAAGATCACCTTGTTACTGAGCTTTTTGGCTTTATGCCA
C3              ATGCATTTGATTAAGATCGCCTTGTTACTGAGCTTTTTGGCTTTATGCCA
C4              ATGCATTTGATTAAGATTGCCTTTTTACTGAGCTTTTTGGCTGTAAGCCA
                ***************** .**** *****.************ **:****

C1              AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
C2              AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
C3              AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
C4              TAGGTCGCAAGTTCAAGCCGCAATAAGTTCGGAACTCGACCACTATCTGC
                :*.******************.***************** **********

C1              GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGAACTCT
C2              GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
C3              GTTGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
C4              GGTGTTTGGAAGTGGTGACTGATGCCGGCGCCCTGATGATCGAAAACTCC
                * ************************** *****.********.** ** 

C1              ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCGAAAAT
C2              ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGACTTTCAGCCGAAACT
C3              ATAACGGCCATAAGCCTTCTATCCGATTGCGTTGACTTTCAGCCGAAACT
C4              GTAACGGCCATAAGGCTCCTATCGGAATGCGTTGACTTTCAGCCCAAAAT
                .************* ** ***** **:******** ******** ***.*

C1              CAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
C2              CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
C3              CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
C4              CAAACTAACTGGCAGTATTCTAAGATTTATCAGGGTGGCCCATCAATTCG
                ************ ** *****.******** **************.** *

C1              GCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCTTTACC
C2              GCAAGAAGGCGATATACGATCGACCGGAATGCCTCGTCCAAACCTTTACC
C3              GCAAGAAGGCGATATACGATCGGCCGGAATGCCTCGTACAAACCTTTACC
C4              CCAAGAAGGCGATATACGATCGACCGGAATGCCTTGTCCAAACCTTTACC
                 *********************.******** ** **.************

C1              ACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGCTTGAG
C2              ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
C3              ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
C4              ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGACAGCCTGAG
                ***************** *********************** *** ****

C1              GTGCTTTGATGAG
C2              GTGCTTTGATGAG
C3              GTGCTTTGATGAG
C4              GTGCTTTGAGGAG
                ********* ***



>C1
ATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTATGCCA
AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGAACTCT
ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCGAAAAT
CAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
GCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCTTTACC
ACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGCTTGAG
GTGCTTTGATGAG
>C2
ATGCATTTGATTAAGATCACCTTGTTACTGAGCTTTTTGGCTTTATGCCA
AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGACTTTCAGCCGAAACT
CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
GCAAGAAGGCGATATACGATCGACCGGAATGCCTCGTCCAAACCTTTACC
ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
GTGCTTTGATGAG
>C3
ATGCATTTGATTAAGATCGCCTTGTTACTGAGCTTTTTGGCTTTATGCCA
AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
GTTGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
ATAACGGCCATAAGCCTTCTATCCGATTGCGTTGACTTTCAGCCGAAACT
CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
GCAAGAAGGCGATATACGATCGGCCGGAATGCCTCGTACAAACCTTTACC
ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
GTGCTTTGATGAG
>C4
ATGCATTTGATTAAGATTGCCTTTTTACTGAGCTTTTTGGCTGTAAGCCA
TAGGTCGCAAGTTCAAGCCGCAATAAGTTCGGAACTCGACCACTATCTGC
GGTGTTTGGAAGTGGTGACTGATGCCGGCGCCCTGATGATCGAAAACTCC
GTAACGGCCATAAGGCTCCTATCGGAATGCGTTGACTTTCAGCCCAAAAT
CAAACTAACTGGCAGTATTCTAAGATTTATCAGGGTGGCCCATCAATTCG
CCAAGAAGGCGATATACGATCGACCGGAATGCCTTGTCCAAACCTTTACC
ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGACAGCCTGAG
GTGCTTTGAGGAG
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 363 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479795634
      Setting output file names to "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 211279184
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4687896055
      Seed = 794385527
      Swapseed = 1479795634
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 10 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 22 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -817.479139 -- -26.620141
         Chain 2 -- -819.182820 -- -26.620141
         Chain 3 -- -814.824114 -- -26.620141
         Chain 4 -- -819.182820 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -817.479139 -- -26.620141
         Chain 2 -- -817.479139 -- -26.620141
         Chain 3 -- -819.182820 -- -26.620141
         Chain 4 -- -819.182820 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-817.479] (-819.183) (-814.824) (-819.183) * [-817.479] (-817.479) (-819.183) (-819.183) 
        500 -- (-717.274) [-722.267] (-720.049) (-719.757) * (-726.034) [-716.515] (-719.090) (-717.953) -- 0:00:00
       1000 -- (-719.099) (-722.031) [-715.097] (-716.330) * (-717.264) [-713.902] (-720.432) (-717.692) -- 0:00:00
       1500 -- (-715.599) (-724.763) [-712.549] (-719.199) * (-716.846) (-710.912) (-715.129) [-715.878] -- 0:11:05
       2000 -- (-710.084) (-721.931) [-712.913] (-718.087) * (-721.614) [-714.481] (-718.351) (-717.817) -- 0:08:19
       2500 -- (-710.873) (-712.845) (-711.965) [-716.402] * (-721.097) (-709.402) [-710.351] (-713.766) -- 0:06:39
       3000 -- (-709.703) (-714.019) [-707.876] (-719.421) * (-718.783) (-712.210) [-708.391] (-717.040) -- 0:05:32
       3500 -- (-711.513) (-712.859) [-707.765] (-717.294) * (-716.882) (-711.293) [-707.685] (-707.859) -- 0:04:44
       4000 -- (-709.439) (-710.617) (-709.547) [-717.123] * (-715.423) (-704.163) [-704.167] (-709.676) -- 0:04:09
       4500 -- [-707.770] (-711.274) (-711.973) (-715.650) * (-719.204) (-702.073) [-703.253] (-708.658) -- 0:03:41
       5000 -- (-705.240) (-707.665) (-710.879) [-713.377] * (-717.361) [-710.954] (-702.069) (-702.733) -- 0:03:19

      Average standard deviation of split frequencies: 0.052378

       5500 -- [-702.772] (-704.726) (-715.388) (-712.545) * [-714.273] (-709.762) (-702.061) (-704.007) -- 0:03:00
       6000 -- (-709.333) (-704.116) [-709.123] (-712.975) * (-712.919) [-703.344] (-702.532) (-702.805) -- 0:02:45
       6500 -- [-709.686] (-704.459) (-715.579) (-705.202) * (-719.773) (-703.011) [-708.037] (-703.078) -- 0:02:32
       7000 -- (-710.059) [-702.837] (-713.300) (-708.830) * (-713.820) [-703.452] (-703.831) (-703.976) -- 0:02:21
       7500 -- (-708.779) (-702.991) (-716.124) [-707.348] * (-708.005) (-702.403) (-709.273) [-702.742] -- 0:02:12
       8000 -- (-705.666) [-704.775] (-709.428) (-709.754) * (-709.406) (-700.963) (-705.476) [-700.689] -- 0:02:04
       8500 -- (-708.612) (-703.073) [-707.004] (-707.963) * (-707.175) (-705.547) [-705.558] (-710.220) -- 0:01:56
       9000 -- (-714.512) (-701.811) (-708.119) [-707.251] * (-705.735) (-703.981) [-706.597] (-705.159) -- 0:01:50
       9500 -- (-714.835) (-703.137) (-708.500) [-707.482] * (-708.121) [-702.825] (-704.276) (-704.314) -- 0:01:44
      10000 -- (-709.413) [-706.586] (-713.999) (-707.284) * (-711.395) (-703.156) (-705.714) [-709.748] -- 0:01:39

      Average standard deviation of split frequencies: 0.088388

      10500 -- [-709.868] (-704.823) (-706.444) (-708.493) * (-706.763) (-703.930) [-704.236] (-702.081) -- 0:01:34
      11000 -- (-712.070) [-705.146] (-713.345) (-706.895) * (-703.795) (-708.225) [-705.430] (-706.243) -- 0:01:29
      11500 -- [-710.208] (-708.780) (-709.865) (-708.330) * (-705.112) (-708.188) [-702.160] (-708.612) -- 0:02:51
      12000 -- (-712.381) [-700.334] (-705.220) (-705.070) * (-711.192) (-703.186) (-703.786) [-704.754] -- 0:02:44
      12500 -- [-706.087] (-699.927) (-709.720) (-708.466) * (-706.425) [-705.677] (-706.163) (-704.267) -- 0:02:38
      13000 -- (-706.870) [-703.402] (-703.830) (-717.949) * (-709.438) (-706.517) (-711.403) [-706.717] -- 0:02:31
      13500 -- [-706.365] (-704.269) (-709.616) (-712.100) * (-705.711) (-705.090) [-706.305] (-710.757) -- 0:02:26
      14000 -- (-708.489) [-706.545] (-699.284) (-708.541) * [-703.594] (-707.941) (-709.721) (-706.371) -- 0:02:20
      14500 -- (-707.086) (-708.910) [-705.933] (-705.654) * (-702.656) [-703.721] (-710.340) (-707.233) -- 0:02:15
      15000 -- (-706.293) (-709.380) [-715.068] (-711.923) * (-706.318) (-705.514) [-703.326] (-708.557) -- 0:02:11

      Average standard deviation of split frequencies: 0.078567

      15500 -- (-711.261) (-704.756) [-705.769] (-712.409) * (-702.881) [-703.286] (-705.545) (-711.425) -- 0:02:07
      16000 -- (-708.861) (-702.093) (-709.862) [-708.317] * [-708.046] (-707.706) (-703.904) (-705.022) -- 0:02:03
      16500 -- (-701.888) (-707.704) [-702.608] (-707.083) * (-705.013) (-711.164) (-705.542) [-713.855] -- 0:01:59
      17000 -- (-709.020) (-713.239) (-704.723) [-710.021] * (-702.122) (-705.135) (-707.573) [-704.292] -- 0:01:55
      17500 -- (-711.499) (-708.145) [-703.358] (-707.139) * (-706.295) [-705.733] (-716.923) (-706.304) -- 0:01:52
      18000 -- [-706.993] (-704.595) (-703.019) (-704.721) * [-704.007] (-703.209) (-710.046) (-710.238) -- 0:01:49
      18500 -- (-709.945) (-701.830) (-703.397) [-704.433] * (-701.523) [-706.208] (-709.569) (-710.682) -- 0:01:46
      19000 -- (-710.345) (-705.366) (-704.686) [-707.595] * (-712.113) (-710.185) (-708.202) [-707.848] -- 0:01:43
      19500 -- (-711.895) (-702.834) (-704.198) [-707.122] * [-707.124] (-707.987) (-711.592) (-707.049) -- 0:01:40
      20000 -- (-709.060) (-699.612) [-709.173] (-712.981) * [-700.875] (-702.625) (-711.186) (-702.231) -- 0:01:38

      Average standard deviation of split frequencies: 0.060826

      20500 -- (-708.626) [-701.698] (-704.640) (-707.792) * [-700.816] (-702.885) (-713.140) (-707.872) -- 0:01:35
      21000 -- (-718.139) (-704.418) [-708.658] (-709.236) * (-706.924) (-712.972) (-708.060) [-703.312] -- 0:01:33
      21500 -- (-710.715) [-704.875] (-704.004) (-714.013) * (-704.653) (-710.929) (-716.599) [-704.563] -- 0:01:31
      22000 -- [-706.709] (-709.434) (-707.493) (-712.975) * (-705.243) (-709.526) [-705.065] (-703.081) -- 0:02:13
      22500 -- (-712.846) (-703.050) [-704.207] (-713.118) * (-702.100) (-704.821) [-704.340] (-707.018) -- 0:02:10
      23000 -- [-706.102] (-703.512) (-704.070) (-713.388) * (-708.683) (-705.622) [-705.928] (-706.233) -- 0:02:07
      23500 -- (-707.082) [-704.875] (-703.007) (-713.924) * (-705.387) (-701.542) (-705.424) [-704.994] -- 0:02:04
      24000 -- (-706.672) (-704.947) [-704.529] (-710.951) * [-708.814] (-702.344) (-705.050) (-711.164) -- 0:02:02
      24500 -- [-706.805] (-706.215) (-707.361) (-710.184) * (-705.221) (-708.606) (-701.791) [-708.005] -- 0:01:59
      25000 -- (-703.402) [-704.077] (-703.687) (-709.294) * (-711.368) (-703.743) [-706.271] (-709.695) -- 0:01:57

      Average standard deviation of split frequencies: 0.036262

      25500 -- [-704.242] (-703.170) (-705.166) (-711.028) * [-706.709] (-702.732) (-704.378) (-703.897) -- 0:01:54
      26000 -- [-700.409] (-702.474) (-715.085) (-707.479) * (-710.924) [-709.713] (-708.580) (-704.683) -- 0:01:52
      26500 -- (-700.127) (-702.354) [-701.890] (-706.603) * [-715.987] (-701.039) (-708.651) (-708.169) -- 0:01:50
      27000 -- (-706.080) [-710.617] (-705.089) (-705.803) * (-710.466) [-709.562] (-703.993) (-703.031) -- 0:01:48
      27500 -- (-707.738) (-706.364) (-708.807) [-706.043] * (-707.576) (-703.690) (-706.529) [-702.834] -- 0:01:46
      28000 -- [-705.673] (-705.080) (-704.812) (-705.821) * (-707.779) [-703.440] (-703.442) (-701.956) -- 0:01:44
      28500 -- (-703.320) (-702.387) [-703.685] (-706.300) * (-714.392) (-708.064) (-703.035) [-705.785] -- 0:01:42
      29000 -- (-703.974) [-703.577] (-701.808) (-706.327) * (-714.221) (-701.891) (-702.005) [-705.583] -- 0:01:40
      29500 -- (-707.303) [-708.051] (-702.378) (-703.688) * (-706.681) (-703.014) [-702.678] (-708.254) -- 0:01:38
      30000 -- (-705.693) [-705.123] (-713.466) (-702.698) * [-708.259] (-705.225) (-704.617) (-706.971) -- 0:01:37

      Average standard deviation of split frequencies: 0.010248

      30500 -- (-705.057) (-706.407) [-706.664] (-705.658) * (-706.884) (-707.579) (-712.096) [-708.427] -- 0:01:35
      31000 -- (-704.714) [-707.082] (-709.601) (-700.365) * (-708.751) (-706.623) (-704.088) [-708.568] -- 0:01:33
      31500 -- (-705.394) (-703.375) (-711.502) [-700.501] * (-711.126) (-704.034) [-699.716] (-706.343) -- 0:01:32
      32000 -- (-704.923) [-707.427] (-711.905) (-705.683) * (-709.774) [-705.729] (-708.612) (-706.103) -- 0:01:30
      32500 -- (-699.293) (-708.004) (-706.379) [-707.323] * (-706.216) (-705.150) (-706.410) [-705.477] -- 0:01:29
      33000 -- [-704.197] (-704.039) (-703.138) (-709.081) * (-711.551) [-705.473] (-707.858) (-704.909) -- 0:01:57
      33500 -- (-707.924) (-706.966) (-704.479) [-700.789] * (-709.026) (-705.351) [-704.114] (-706.985) -- 0:01:55
      34000 -- (-712.582) (-705.056) (-704.871) [-701.232] * (-711.725) [-711.912] (-707.069) (-701.773) -- 0:01:53
      34500 -- [-707.720] (-707.998) (-703.357) (-706.792) * (-707.869) (-707.861) (-705.986) [-702.902] -- 0:01:51
      35000 -- (-706.715) (-702.584) (-703.906) [-706.817] * (-711.567) (-714.699) [-705.994] (-702.357) -- 0:01:50

      Average standard deviation of split frequencies: 0.026189

      35500 -- (-709.771) [-704.238] (-706.079) (-699.633) * [-709.433] (-706.620) (-706.901) (-706.581) -- 0:01:48
      36000 -- (-708.442) (-701.359) [-705.067] (-701.717) * (-709.684) [-705.728] (-704.565) (-699.759) -- 0:01:47
      36500 -- (-709.863) (-701.634) [-708.708] (-702.912) * (-709.265) (-702.424) [-702.726] (-714.837) -- 0:01:45
      37000 -- (-713.702) (-701.386) (-710.324) [-702.540] * (-707.404) (-709.198) [-711.532] (-707.003) -- 0:01:44
      37500 -- (-706.706) [-705.428] (-705.674) (-709.148) * (-707.837) (-706.050) (-708.348) [-702.683] -- 0:01:42
      38000 -- (-705.965) [-706.272] (-706.364) (-708.520) * (-710.814) [-702.425] (-704.147) (-707.220) -- 0:01:41
      38500 -- (-709.479) (-702.067) (-702.252) [-704.995] * (-711.435) (-706.780) [-701.883] (-706.759) -- 0:01:39
      39000 -- (-710.786) (-703.812) [-708.002] (-705.135) * [-707.794] (-704.083) (-709.445) (-701.939) -- 0:01:38
      39500 -- (-707.843) (-706.551) (-705.287) [-702.992] * (-711.474) (-703.061) [-702.276] (-702.692) -- 0:01:37
      40000 -- (-705.240) (-707.723) [-702.485] (-704.214) * (-717.850) [-703.621] (-710.833) (-704.033) -- 0:01:36

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-705.057) [-711.474] (-703.396) (-706.103) * (-711.824) (-703.038) [-703.740] (-701.272) -- 0:01:34
      41000 -- (-707.611) (-703.734) (-703.760) [-704.133] * (-711.891) (-705.408) [-711.496] (-706.632) -- 0:01:33
      41500 -- (-704.935) (-706.301) (-706.104) [-702.713] * (-712.977) [-705.851] (-703.445) (-707.469) -- 0:01:32
      42000 -- (-701.074) (-703.941) (-702.098) [-704.245] * (-712.211) (-708.489) [-704.804] (-708.834) -- 0:01:31
      42500 -- (-705.762) (-708.561) [-705.836] (-703.605) * (-709.481) [-703.678] (-705.445) (-706.794) -- 0:01:30
      43000 -- (-703.358) (-708.384) (-707.175) [-704.450] * (-708.492) (-707.130) [-704.736] (-705.959) -- 0:01:29
      43500 -- [-711.763] (-704.487) (-707.219) (-710.291) * (-707.092) (-703.771) (-704.453) [-707.568] -- 0:01:27
      44000 -- (-706.692) (-705.816) [-710.779] (-700.965) * (-707.881) (-702.088) (-706.381) [-707.567] -- 0:01:26
      44500 -- (-709.663) (-713.151) (-707.665) [-704.933] * (-706.178) [-703.172] (-708.063) (-707.889) -- 0:01:47
      45000 -- [-705.281] (-705.898) (-711.616) (-704.456) * (-705.196) [-703.784] (-705.491) (-705.057) -- 0:01:46

      Average standard deviation of split frequencies: 0.034160

      45500 -- (-705.907) [-703.324] (-712.102) (-706.827) * (-708.297) [-702.303] (-703.784) (-709.044) -- 0:01:44
      46000 -- (-704.444) (-705.192) [-711.147] (-704.144) * [-706.606] (-705.816) (-707.590) (-704.727) -- 0:01:43
      46500 -- (-702.483) [-706.821] (-713.458) (-703.301) * (-704.850) (-708.797) [-703.591] (-712.129) -- 0:01:42
      47000 -- (-708.029) [-706.223] (-711.853) (-709.200) * [-704.396] (-709.372) (-705.131) (-709.468) -- 0:01:41
      47500 -- (-706.990) (-710.922) (-707.545) [-700.905] * (-706.576) [-703.440] (-703.919) (-713.614) -- 0:01:40
      48000 -- (-706.857) (-707.350) (-707.981) [-702.199] * (-704.713) (-706.769) (-701.395) [-701.087] -- 0:01:39
      48500 -- [-705.674] (-706.466) (-711.774) (-700.893) * (-708.505) [-708.835] (-703.975) (-706.975) -- 0:01:38
      49000 -- (-704.527) [-705.171] (-711.658) (-704.859) * [-701.257] (-701.578) (-701.004) (-704.434) -- 0:01:37
      49500 -- (-708.154) (-702.043) (-713.630) [-704.151] * (-701.761) [-702.051] (-702.329) (-705.445) -- 0:01:36
      50000 -- (-711.277) [-702.970] (-708.097) (-706.725) * (-703.474) (-702.745) [-704.825] (-710.304) -- 0:01:35

      Average standard deviation of split frequencies: 0.006203

      50500 -- (-705.783) (-714.957) (-704.736) [-711.194] * (-704.712) (-700.560) [-703.977] (-709.570) -- 0:01:34
      51000 -- (-707.955) (-705.421) (-710.136) [-705.012] * (-706.296) (-704.268) (-703.555) [-704.384] -- 0:01:33
      51500 -- [-711.536] (-707.881) (-703.072) (-705.951) * [-703.014] (-707.420) (-704.967) (-704.067) -- 0:01:32
      52000 -- (-701.687) (-708.140) [-705.525] (-709.488) * (-707.266) [-710.604] (-708.416) (-706.545) -- 0:01:31
      52500 -- [-703.238] (-714.110) (-704.450) (-709.885) * (-707.467) (-709.913) (-708.868) [-708.264] -- 0:01:30
      53000 -- (-708.300) (-706.400) (-704.457) [-712.712] * (-710.169) [-706.332] (-705.271) (-708.758) -- 0:01:29
      53500 -- (-706.778) (-719.682) [-701.805] (-706.907) * (-704.204) (-711.416) [-706.779] (-708.206) -- 0:01:28
      54000 -- [-706.549] (-706.366) (-705.763) (-707.349) * (-701.149) (-710.188) [-700.824] (-707.498) -- 0:01:27
      54500 -- (-707.701) (-703.640) (-705.943) [-705.004] * (-705.708) (-705.353) (-711.687) [-703.192] -- 0:01:26
      55000 -- (-709.293) [-705.360] (-700.996) (-711.291) * [-705.368] (-701.069) (-706.784) (-708.348) -- 0:01:25

      Average standard deviation of split frequencies: 0.022448

      55500 -- (-709.954) [-708.892] (-704.307) (-708.586) * [-698.822] (-707.361) (-700.933) (-706.476) -- 0:01:42
      56000 -- [-705.114] (-707.678) (-703.189) (-707.221) * (-703.304) (-705.032) (-704.891) [-704.750] -- 0:01:41
      56500 -- (-702.606) [-706.618] (-703.575) (-705.791) * (-703.038) [-715.372] (-703.667) (-707.018) -- 0:01:40
      57000 -- (-708.983) (-706.702) (-700.057) [-699.757] * [-704.504] (-712.384) (-716.658) (-710.835) -- 0:01:39
      57500 -- (-702.395) [-707.265] (-705.583) (-705.222) * (-709.819) (-706.430) [-708.780] (-716.221) -- 0:01:38
      58000 -- (-711.373) (-706.675) [-704.242] (-708.229) * (-707.294) [-708.397] (-708.395) (-712.529) -- 0:01:37
      58500 -- (-711.881) (-708.737) (-710.922) [-708.997] * [-703.699] (-707.352) (-707.251) (-706.551) -- 0:01:36
      59000 -- (-707.935) [-704.695] (-710.311) (-708.688) * (-706.130) [-707.464] (-703.746) (-707.517) -- 0:01:35
      59500 -- (-712.197) [-708.660] (-709.751) (-715.662) * (-700.780) [-711.822] (-708.596) (-706.010) -- 0:01:34
      60000 -- [-707.929] (-713.925) (-710.899) (-714.241) * (-702.487) (-707.598) [-703.148] (-706.034) -- 0:01:34

      Average standard deviation of split frequencies: 0.025901

      60500 -- [-705.989] (-711.936) (-703.919) (-712.683) * (-703.667) (-708.491) [-704.964] (-709.189) -- 0:01:33
      61000 -- (-706.415) (-717.229) (-710.107) [-706.892] * [-700.848] (-705.736) (-704.111) (-712.921) -- 0:01:32
      61500 -- (-704.041) (-710.831) (-711.500) [-710.380] * (-703.700) (-704.752) [-707.345] (-715.907) -- 0:01:31
      62000 -- (-700.886) (-711.496) [-706.812] (-712.650) * (-703.535) [-706.429] (-705.116) (-716.076) -- 0:01:30
      62500 -- [-703.842] (-709.475) (-708.200) (-711.165) * (-701.788) (-702.681) (-706.724) [-711.501] -- 0:01:30
      63000 -- (-701.021) [-706.166] (-704.609) (-711.990) * [-707.404] (-713.222) (-707.315) (-710.942) -- 0:01:29
      63500 -- (-710.691) [-709.212] (-705.711) (-706.906) * (-711.147) [-704.655] (-704.321) (-714.071) -- 0:01:28
      64000 -- (-710.700) (-715.602) [-706.269] (-712.681) * (-706.693) (-703.598) (-704.116) [-706.005] -- 0:01:27
      64500 -- (-705.461) (-707.447) [-705.528] (-714.909) * [-708.061] (-703.768) (-705.434) (-704.653) -- 0:01:27
      65000 -- (-706.711) (-705.122) (-704.847) [-707.670] * [-702.675] (-708.676) (-709.814) (-709.078) -- 0:01:26

      Average standard deviation of split frequencies: 0.009523

      65500 -- (-708.239) (-712.072) (-714.250) [-707.051] * (-707.717) [-702.531] (-711.747) (-701.984) -- 0:01:25
      66000 -- (-704.002) (-704.810) (-705.123) [-700.681] * (-708.121) [-707.496] (-712.141) (-706.212) -- 0:01:39
      66500 -- (-709.045) (-707.122) (-707.431) [-701.471] * (-706.810) [-702.890] (-709.394) (-707.192) -- 0:01:38
      67000 -- (-708.122) [-702.834] (-706.912) (-704.042) * (-708.505) (-704.026) [-705.386] (-710.674) -- 0:01:37
      67500 -- [-705.410] (-703.669) (-709.562) (-716.995) * (-710.455) [-705.583] (-708.793) (-703.523) -- 0:01:36
      68000 -- (-703.789) (-707.292) [-708.839] (-707.217) * (-709.312) [-701.843] (-706.352) (-703.796) -- 0:01:35
      68500 -- (-707.786) (-703.952) (-713.090) [-708.448] * [-707.796] (-699.222) (-706.533) (-713.244) -- 0:01:35
      69000 -- (-710.011) [-705.673] (-710.714) (-703.579) * (-707.636) (-704.834) (-705.250) [-709.911] -- 0:01:34
      69500 -- (-704.218) (-705.901) (-708.166) [-704.392] * (-705.198) (-709.508) [-706.413] (-708.906) -- 0:01:33
      70000 -- (-703.451) (-705.225) [-709.656] (-709.251) * (-703.045) (-708.571) (-703.301) [-701.684] -- 0:01:33

      Average standard deviation of split frequencies: 0.031130

      70500 -- [-710.661] (-705.799) (-717.259) (-710.481) * (-709.545) (-707.099) [-705.400] (-704.540) -- 0:01:32
      71000 -- [-707.654] (-703.969) (-710.321) (-710.901) * [-711.128] (-707.171) (-706.373) (-703.767) -- 0:01:31
      71500 -- [-713.120] (-709.693) (-711.620) (-715.691) * (-707.465) (-703.820) (-706.763) [-706.961] -- 0:01:30
      72000 -- (-711.366) (-717.533) [-716.304] (-709.367) * (-714.798) (-709.182) [-706.096] (-707.288) -- 0:01:30
      72500 -- (-706.239) (-706.231) (-723.006) [-711.043] * (-714.538) (-702.950) (-709.716) [-703.438] -- 0:01:29
      73000 -- [-707.855] (-704.336) (-713.208) (-718.762) * (-713.011) (-701.705) (-712.719) [-708.047] -- 0:01:28
      73500 -- (-704.157) [-707.087] (-707.201) (-706.791) * (-712.160) (-709.289) [-706.565] (-705.103) -- 0:01:28
      74000 -- (-709.740) [-701.915] (-711.432) (-712.088) * (-707.043) [-705.912] (-706.062) (-703.689) -- 0:01:27
      74500 -- (-709.280) (-705.402) (-707.358) [-707.783] * (-711.161) (-706.088) (-703.802) [-703.428] -- 0:01:26
      75000 -- (-710.629) (-707.507) (-708.272) [-703.294] * [-706.806] (-705.318) (-706.503) (-702.217) -- 0:01:26

      Average standard deviation of split frequencies: 0.037216

      75500 -- (-710.733) (-706.102) (-709.293) [-704.250] * (-707.281) (-706.021) [-709.454] (-712.243) -- 0:01:25
      76000 -- (-703.120) (-708.624) (-711.548) [-711.451] * (-713.158) [-701.360] (-703.944) (-703.968) -- 0:01:25
      76500 -- [-706.279] (-705.658) (-708.610) (-708.697) * (-717.348) (-704.801) (-708.003) [-702.149] -- 0:01:24
      77000 -- (-705.833) [-704.742] (-709.662) (-706.983) * (-712.417) (-709.068) (-708.528) [-703.007] -- 0:01:35
      77500 -- (-703.235) (-707.365) (-707.104) [-705.776] * (-713.631) (-708.966) (-704.424) [-705.773] -- 0:01:35
      78000 -- [-703.109] (-709.567) (-707.604) (-706.169) * (-710.139) (-711.302) (-707.718) [-710.012] -- 0:01:34
      78500 -- (-711.546) (-705.409) [-704.186] (-705.880) * (-712.682) [-703.295] (-705.629) (-707.883) -- 0:01:33
      79000 -- [-704.984] (-704.913) (-704.751) (-707.003) * (-714.781) (-708.580) [-703.925] (-709.479) -- 0:01:33
      79500 -- [-703.922] (-705.032) (-704.393) (-709.073) * (-713.072) (-713.744) (-706.501) [-705.628] -- 0:01:32
      80000 -- (-709.257) (-706.160) (-703.255) [-713.259] * [-703.583] (-706.568) (-705.337) (-703.349) -- 0:01:32

      Average standard deviation of split frequencies: 0.046751

      80500 -- (-714.041) [-706.138] (-709.415) (-710.598) * (-707.118) (-708.790) [-715.251] (-709.175) -- 0:01:31
      81000 -- (-701.800) (-704.046) [-702.031] (-706.457) * [-706.710] (-707.272) (-705.973) (-717.732) -- 0:01:30
      81500 -- (-704.457) (-706.789) [-705.499] (-702.203) * (-707.552) (-705.224) [-706.684] (-705.470) -- 0:01:30
      82000 -- (-705.064) (-702.089) [-701.567] (-706.122) * (-707.065) (-701.329) [-710.482] (-702.977) -- 0:01:29
      82500 -- [-714.145] (-704.274) (-709.315) (-710.625) * (-705.784) [-702.215] (-705.272) (-705.274) -- 0:01:28
      83000 -- (-705.343) (-706.910) [-700.880] (-708.778) * (-707.705) [-703.400] (-706.314) (-707.858) -- 0:01:28
      83500 -- (-711.375) (-705.119) [-702.113] (-713.426) * (-702.144) [-706.514] (-705.295) (-705.483) -- 0:01:27
      84000 -- [-710.908] (-705.322) (-703.657) (-704.608) * (-706.219) (-716.177) (-708.468) [-708.038] -- 0:01:27
      84500 -- [-698.173] (-704.211) (-708.240) (-709.556) * (-705.315) (-706.095) (-708.852) [-703.692] -- 0:01:26
      85000 -- (-706.814) [-708.817] (-705.543) (-704.471) * (-704.064) (-704.642) [-706.179] (-704.801) -- 0:01:26

      Average standard deviation of split frequencies: 0.032889

      85500 -- (-708.365) [-702.195] (-711.379) (-704.320) * (-706.004) (-709.852) [-705.248] (-704.768) -- 0:01:25
      86000 -- (-702.792) (-706.347) (-710.322) [-700.758] * [-702.534] (-707.140) (-711.364) (-702.909) -- 0:01:25
      86500 -- (-707.875) (-704.322) [-700.456] (-700.850) * (-706.808) (-715.068) (-711.649) [-701.267] -- 0:01:24
      87000 -- [-701.889] (-709.361) (-702.277) (-703.912) * [-705.086] (-708.615) (-706.344) (-700.836) -- 0:01:23
      87500 -- (-707.092) (-706.895) [-706.666] (-715.956) * [-705.559] (-718.094) (-704.453) (-698.467) -- 0:01:23
      88000 -- (-703.945) (-706.799) (-704.799) [-707.533] * (-700.933) (-712.543) [-712.556] (-703.428) -- 0:01:33
      88500 -- (-713.875) (-703.357) (-704.799) [-705.273] * (-706.836) (-704.709) (-709.625) [-706.372] -- 0:01:32
      89000 -- (-709.211) (-706.189) [-704.106] (-703.566) * (-714.078) [-705.347] (-707.378) (-705.671) -- 0:01:32
      89500 -- (-706.225) (-703.974) (-708.729) [-705.210] * [-703.405] (-702.267) (-704.431) (-705.821) -- 0:01:31
      90000 -- [-710.256] (-708.382) (-714.267) (-704.773) * (-709.479) (-704.016) (-708.335) [-715.189] -- 0:01:31

      Average standard deviation of split frequencies: 0.031196

      90500 -- [-704.268] (-706.302) (-702.400) (-709.720) * (-705.416) [-703.403] (-706.521) (-713.311) -- 0:01:30
      91000 -- (-703.870) [-707.267] (-705.306) (-712.778) * (-707.263) [-706.776] (-706.472) (-712.819) -- 0:01:29
      91500 -- (-703.754) (-708.521) [-705.981] (-706.563) * [-712.413] (-703.933) (-704.334) (-712.824) -- 0:01:29
      92000 -- (-714.342) [-706.590] (-708.317) (-709.252) * (-711.075) (-707.232) (-703.885) [-708.918] -- 0:01:28
      92500 -- [-703.059] (-704.245) (-704.395) (-704.593) * [-706.885] (-706.297) (-704.766) (-708.435) -- 0:01:28
      93000 -- (-703.818) [-703.118] (-706.543) (-705.723) * [-705.894] (-704.747) (-705.358) (-707.390) -- 0:01:27
      93500 -- (-708.037) (-705.808) [-703.535] (-705.750) * (-712.491) (-705.560) [-705.800] (-712.720) -- 0:01:27
      94000 -- (-707.893) [-702.850] (-707.982) (-707.397) * (-708.688) (-710.152) (-702.322) [-707.957] -- 0:01:26
      94500 -- (-701.407) (-706.186) (-704.730) [-708.668] * [-709.553] (-707.687) (-705.336) (-709.311) -- 0:01:26
      95000 -- (-704.586) (-706.137) [-707.259] (-707.300) * (-704.884) (-709.356) [-706.566] (-713.113) -- 0:01:25

      Average standard deviation of split frequencies: 0.036010

      95500 -- (-706.157) [-702.592] (-704.537) (-705.622) * [-707.143] (-707.518) (-710.970) (-713.337) -- 0:01:25
      96000 -- [-706.563] (-705.043) (-706.401) (-706.086) * (-706.903) (-708.000) (-705.075) [-705.543] -- 0:01:24
      96500 -- (-701.503) (-710.963) (-702.756) [-706.099] * (-706.513) (-710.779) (-704.150) [-706.037] -- 0:01:24
      97000 -- (-705.831) (-708.815) [-709.835] (-705.664) * (-706.286) [-706.674] (-703.908) (-709.004) -- 0:01:23
      97500 -- (-702.754) (-702.351) [-702.844] (-705.651) * (-704.240) (-707.995) [-703.851] (-709.009) -- 0:01:23
      98000 -- (-708.639) (-704.139) (-703.103) [-701.598] * [-704.778] (-707.230) (-701.338) (-713.873) -- 0:01:22
      98500 -- (-708.337) [-710.330] (-706.606) (-703.832) * (-703.034) (-702.570) (-709.790) [-705.500] -- 0:01:31
      99000 -- (-704.941) (-707.868) [-704.964] (-707.232) * (-706.942) [-702.707] (-703.162) (-704.364) -- 0:01:31
      99500 -- (-707.000) (-701.618) [-703.869] (-703.537) * (-707.394) (-702.673) (-704.427) [-703.494] -- 0:01:30
      100000 -- (-710.102) [-704.909] (-708.953) (-704.810) * [-708.625] (-701.677) (-706.404) (-707.570) -- 0:01:30

      Average standard deviation of split frequencies: 0.046828

      100500 -- (-711.444) [-702.543] (-707.969) (-704.483) * (-701.889) [-701.194] (-704.923) (-704.919) -- 0:01:29
      101000 -- [-706.573] (-709.938) (-705.936) (-707.770) * (-702.704) (-713.537) [-704.610] (-711.113) -- 0:01:29
      101500 -- (-707.613) (-705.238) [-707.359] (-703.967) * (-707.845) (-707.300) [-703.181] (-709.697) -- 0:01:28
      102000 -- (-711.805) (-701.721) (-705.323) [-704.450] * [-702.726] (-703.929) (-703.530) (-705.469) -- 0:01:28
      102500 -- (-710.912) [-702.656] (-711.721) (-704.878) * (-706.028) [-701.591] (-701.699) (-707.310) -- 0:01:27
      103000 -- (-707.211) (-702.721) (-710.642) [-705.263] * (-706.638) (-702.798) (-704.452) [-709.034] -- 0:01:27
      103500 -- (-704.496) (-706.197) [-703.512] (-702.185) * [-706.106] (-708.252) (-706.074) (-708.868) -- 0:01:26
      104000 -- (-706.084) (-702.756) [-703.603] (-704.917) * (-708.207) (-703.219) (-705.178) [-708.887] -- 0:01:26
      104500 -- (-704.787) [-707.041] (-707.470) (-704.033) * (-706.586) (-705.369) [-701.597] (-703.865) -- 0:01:25
      105000 -- (-705.715) (-700.788) (-704.885) [-709.182] * (-704.514) (-708.741) [-708.041] (-707.092) -- 0:01:25

      Average standard deviation of split frequencies: 0.035578

      105500 -- (-710.584) (-705.534) (-700.994) [-703.609] * (-713.149) (-706.360) (-706.518) [-707.890] -- 0:01:24
      106000 -- (-712.574) [-705.425] (-704.496) (-701.388) * (-702.224) (-707.789) [-704.457] (-703.681) -- 0:01:24
      106500 -- [-713.458] (-702.153) (-706.242) (-703.434) * (-710.489) (-703.027) [-703.134] (-702.190) -- 0:01:23
      107000 -- (-705.326) [-706.293] (-708.135) (-702.273) * (-710.523) (-707.459) (-705.438) [-704.095] -- 0:01:23
      107500 -- (-703.723) [-705.475] (-708.817) (-708.123) * [-704.018] (-701.395) (-708.331) (-704.298) -- 0:01:23
      108000 -- (-700.626) (-706.015) (-713.962) [-708.301] * (-711.484) (-700.467) (-708.738) [-704.218] -- 0:01:22
      108500 -- [-704.781] (-709.909) (-708.166) (-705.615) * (-702.055) (-707.405) (-704.646) [-701.254] -- 0:01:22
      109000 -- (-702.803) (-703.766) (-707.258) [-710.852] * (-704.237) [-703.217] (-710.151) (-705.215) -- 0:01:21
      109500 -- (-701.729) (-703.655) (-704.671) [-703.706] * [-704.467] (-709.884) (-704.936) (-706.844) -- 0:01:29
      110000 -- (-699.457) [-701.059] (-706.953) (-703.261) * (-708.717) [-705.780] (-711.800) (-703.055) -- 0:01:29

      Average standard deviation of split frequencies: 0.031238

      110500 -- (-714.459) (-703.316) (-705.278) [-708.740] * [-705.245] (-707.672) (-708.972) (-706.148) -- 0:01:28
      111000 -- (-708.212) (-706.348) (-704.909) [-708.776] * (-711.097) (-708.342) [-705.194] (-706.549) -- 0:01:28
      111500 -- (-704.215) (-716.287) [-706.361] (-703.502) * [-710.362] (-702.566) (-705.855) (-705.512) -- 0:01:27
      112000 -- (-703.487) (-709.302) [-706.633] (-705.234) * (-712.771) [-706.950] (-709.000) (-707.148) -- 0:01:27
      112500 -- (-706.171) (-708.516) (-709.059) [-704.254] * (-707.975) [-710.744] (-707.243) (-704.045) -- 0:01:26
      113000 -- (-705.414) (-713.642) (-706.912) [-706.605] * (-706.681) (-709.195) [-704.319] (-708.682) -- 0:01:26
      113500 -- (-705.644) (-710.323) (-709.058) [-706.211] * (-707.660) (-710.820) [-701.552] (-703.830) -- 0:01:25
      114000 -- [-704.370] (-707.623) (-706.732) (-705.682) * (-709.094) (-708.388) (-705.312) [-709.354] -- 0:01:25
      114500 -- (-704.637) (-712.205) [-707.790] (-703.070) * (-706.343) (-704.479) [-707.099] (-708.621) -- 0:01:25
      115000 -- (-710.979) [-708.927] (-708.553) (-709.981) * [-709.153] (-707.111) (-706.870) (-708.337) -- 0:01:24

      Average standard deviation of split frequencies: 0.024383

      115500 -- (-708.283) (-708.037) [-704.436] (-706.039) * (-708.203) (-701.555) (-702.835) [-701.621] -- 0:01:24
      116000 -- (-709.423) [-708.307] (-702.575) (-707.970) * [-712.380] (-703.219) (-705.445) (-703.634) -- 0:01:23
      116500 -- (-707.653) [-706.568] (-704.990) (-707.903) * [-703.566] (-718.006) (-708.313) (-702.909) -- 0:01:23
      117000 -- (-710.460) [-706.667] (-707.158) (-709.223) * (-716.920) (-707.131) [-705.127] (-702.772) -- 0:01:23
      117500 -- (-709.289) [-701.974] (-703.626) (-709.127) * (-705.366) (-706.761) (-705.375) [-703.870] -- 0:01:22
      118000 -- (-707.848) (-713.019) [-704.297] (-710.607) * (-702.933) (-705.331) [-702.988] (-702.581) -- 0:01:22
      118500 -- (-708.511) (-709.983) [-703.219] (-707.260) * (-705.564) (-704.721) [-704.328] (-710.434) -- 0:01:21
      119000 -- (-707.579) (-704.419) (-707.681) [-707.372] * (-704.671) (-712.265) [-702.161] (-711.288) -- 0:01:21
      119500 -- [-707.576] (-706.232) (-707.987) (-711.859) * [-703.352] (-705.688) (-705.736) (-712.772) -- 0:01:21
      120000 -- (-703.240) (-710.164) (-709.781) [-707.669] * (-709.070) (-704.961) (-705.913) [-708.177] -- 0:01:20

      Average standard deviation of split frequencies: 0.028649

      120500 -- (-707.565) (-705.123) (-705.336) [-704.621] * [-704.027] (-706.376) (-713.193) (-708.954) -- 0:01:27
      121000 -- (-703.930) (-704.748) [-707.256] (-714.537) * (-700.803) [-706.509] (-710.542) (-706.977) -- 0:01:27
      121500 -- (-701.328) [-703.811] (-708.015) (-702.852) * (-710.891) (-709.719) [-710.547] (-713.783) -- 0:01:26
      122000 -- (-711.598) (-700.946) (-705.753) [-704.026] * (-704.450) (-705.130) [-706.550] (-712.102) -- 0:01:26
      122500 -- (-704.816) (-700.237) (-710.707) [-704.803] * [-706.773] (-701.203) (-709.959) (-704.353) -- 0:01:25
      123000 -- (-702.688) [-703.804] (-703.383) (-704.713) * [-703.585] (-707.365) (-707.949) (-708.960) -- 0:01:25
      123500 -- (-700.994) [-704.728] (-701.023) (-708.959) * (-704.056) (-712.567) (-701.763) [-708.150] -- 0:01:25
      124000 -- (-704.857) (-703.464) (-712.918) [-701.248] * (-704.048) (-708.102) [-704.974] (-704.242) -- 0:01:24
      124500 -- [-702.830] (-706.500) (-707.410) (-702.815) * (-705.556) (-706.283) [-710.394] (-707.583) -- 0:01:24
      125000 -- (-706.076) (-703.615) (-707.503) [-702.332] * [-704.860] (-704.500) (-705.363) (-703.049) -- 0:01:24

      Average standard deviation of split frequencies: 0.029930

      125500 -- (-708.376) [-702.759] (-703.098) (-705.270) * (-711.816) [-703.471] (-699.343) (-704.032) -- 0:01:23
      126000 -- (-709.726) (-708.981) [-705.309] (-701.521) * (-702.455) (-700.270) [-700.815] (-703.338) -- 0:01:23
      126500 -- (-706.119) (-705.347) [-704.093] (-702.727) * [-702.997] (-704.441) (-702.275) (-701.612) -- 0:01:22
      127000 -- (-713.967) [-709.579] (-704.738) (-700.872) * [-702.984] (-702.216) (-706.426) (-704.462) -- 0:01:22
      127500 -- (-716.862) [-707.357] (-703.305) (-703.017) * [-706.930] (-706.400) (-702.322) (-704.217) -- 0:01:22
      128000 -- (-709.621) [-706.126] (-707.118) (-705.442) * (-707.905) (-705.641) [-700.483] (-705.502) -- 0:01:21
      128500 -- (-711.655) [-704.977] (-699.017) (-713.141) * [-706.318] (-707.677) (-704.862) (-702.893) -- 0:01:21
      129000 -- [-708.310] (-706.340) (-704.607) (-709.615) * [-701.067] (-702.056) (-703.148) (-702.783) -- 0:01:21
      129500 -- (-702.586) [-706.433] (-708.531) (-705.977) * (-707.152) (-707.433) (-705.853) [-699.358] -- 0:01:20
      130000 -- [-710.376] (-701.570) (-705.078) (-710.290) * (-709.945) (-707.951) (-709.955) [-703.838] -- 0:01:20

      Average standard deviation of split frequencies: 0.043292

      130500 -- (-710.430) [-704.796] (-704.758) (-705.899) * (-705.220) (-702.201) (-709.410) [-710.475] -- 0:01:19
      131000 -- (-704.733) [-701.968] (-702.992) (-705.399) * [-706.526] (-705.242) (-710.576) (-708.079) -- 0:01:19
      131500 -- (-707.849) (-708.931) (-703.963) [-702.856] * (-707.236) (-710.239) [-704.629] (-703.561) -- 0:01:25
      132000 -- [-708.395] (-703.416) (-702.038) (-715.766) * (-701.678) (-705.460) [-702.534] (-706.502) -- 0:01:25
      132500 -- (-704.430) [-704.208] (-700.585) (-715.499) * [-701.576] (-702.496) (-705.501) (-704.148) -- 0:01:25
      133000 -- (-710.083) (-706.272) [-703.139] (-708.462) * (-709.867) (-707.739) [-701.667] (-701.580) -- 0:01:24
      133500 -- [-706.625] (-702.739) (-703.827) (-706.944) * (-706.188) (-703.403) (-702.665) [-701.236] -- 0:01:24
      134000 -- (-702.639) (-707.642) [-704.619] (-704.798) * (-707.067) (-702.890) (-706.731) [-704.989] -- 0:01:24
      134500 -- (-704.747) (-706.883) (-708.346) [-708.491] * (-705.016) (-708.420) (-713.038) [-703.123] -- 0:01:23
      135000 -- (-702.163) (-705.097) [-706.636] (-711.936) * [-705.749] (-710.664) (-714.161) (-704.455) -- 0:01:23

      Average standard deviation of split frequencies: 0.041595

      135500 -- [-702.997] (-706.565) (-706.471) (-704.148) * [-703.636] (-703.554) (-701.766) (-708.013) -- 0:01:22
      136000 -- (-705.798) (-707.635) [-701.859] (-710.296) * [-703.756] (-707.118) (-702.902) (-701.411) -- 0:01:22
      136500 -- (-707.357) [-699.380] (-703.007) (-707.008) * (-708.885) (-708.675) [-704.961] (-709.192) -- 0:01:22
      137000 -- (-702.919) (-700.572) (-715.532) [-705.198] * (-708.278) (-717.806) [-702.671] (-702.192) -- 0:01:21
      137500 -- [-703.916] (-706.205) (-704.469) (-702.854) * (-702.040) (-712.309) (-703.556) [-705.470] -- 0:01:21
      138000 -- (-704.990) (-706.105) [-702.059] (-704.026) * (-706.558) (-706.652) [-706.518] (-702.959) -- 0:01:21
      138500 -- (-707.226) [-703.541] (-701.439) (-713.040) * (-710.149) (-704.848) [-707.433] (-705.552) -- 0:01:20
      139000 -- (-705.138) [-702.978] (-702.769) (-707.568) * (-714.301) (-709.842) [-702.087] (-706.529) -- 0:01:20
      139500 -- (-706.288) (-706.972) (-702.176) [-708.908] * [-702.428] (-705.128) (-704.469) (-704.491) -- 0:01:20
      140000 -- (-704.563) (-707.477) [-707.532] (-705.695) * (-702.916) [-705.876] (-701.250) (-708.523) -- 0:01:19

      Average standard deviation of split frequencies: 0.040215

      140500 -- (-701.893) (-707.166) (-703.478) [-711.005] * (-704.855) (-703.861) (-702.168) [-707.171] -- 0:01:19
      141000 -- (-705.005) [-706.839] (-708.460) (-718.561) * (-704.075) (-704.321) [-705.961] (-705.153) -- 0:01:19
      141500 -- (-705.623) [-706.606] (-707.561) (-710.414) * (-706.014) (-703.694) [-702.120] (-704.066) -- 0:01:18
      142000 -- (-705.308) [-703.765] (-708.828) (-710.582) * (-701.636) (-705.568) [-701.870] (-705.135) -- 0:01:18
      142500 -- (-703.387) (-703.740) [-706.598] (-707.925) * [-704.129] (-706.018) (-703.937) (-701.695) -- 0:01:24
      143000 -- (-704.188) [-708.365] (-707.486) (-707.142) * (-702.722) (-704.934) (-705.798) [-707.394] -- 0:01:23
      143500 -- (-712.960) (-708.473) [-708.073] (-707.837) * (-702.296) (-701.768) (-705.844) [-701.753] -- 0:01:23
      144000 -- (-707.677) (-707.970) [-707.474] (-705.862) * (-707.220) (-706.105) [-705.381] (-704.706) -- 0:01:23
      144500 -- (-712.431) [-707.124] (-706.645) (-707.974) * (-705.538) (-713.820) [-710.460] (-709.662) -- 0:01:22
      145000 -- (-705.032) (-706.523) [-708.540] (-711.548) * (-706.204) (-706.822) [-707.105] (-706.430) -- 0:01:22

      Average standard deviation of split frequencies: 0.049508

      145500 -- [-703.531] (-704.005) (-717.189) (-706.843) * (-709.630) (-705.942) [-707.157] (-702.879) -- 0:01:22
      146000 -- (-709.409) (-711.912) [-704.965] (-708.523) * (-709.426) (-706.052) [-700.583] (-707.692) -- 0:01:21
      146500 -- (-702.528) (-709.627) (-709.659) [-706.629] * (-705.580) [-704.776] (-700.260) (-703.427) -- 0:01:21
      147000 -- (-704.397) (-704.442) (-706.960) [-706.364] * (-704.828) [-713.549] (-702.808) (-709.068) -- 0:01:21
      147500 -- (-707.436) (-705.133) (-707.685) [-702.658] * (-703.753) (-703.990) [-707.241] (-705.749) -- 0:01:20
      148000 -- [-710.609] (-701.714) (-705.088) (-710.849) * [-702.748] (-701.251) (-704.142) (-706.844) -- 0:01:20
      148500 -- (-705.778) (-706.109) [-703.734] (-713.420) * (-710.750) (-702.194) (-706.497) [-701.747] -- 0:01:20
      149000 -- (-700.698) [-707.705] (-706.699) (-705.469) * (-714.894) [-703.438] (-702.424) (-706.578) -- 0:01:19
      149500 -- [-702.274] (-703.369) (-703.220) (-707.365) * [-704.824] (-708.769) (-708.247) (-710.155) -- 0:01:19
      150000 -- (-699.877) (-705.424) (-706.746) [-702.694] * [-703.165] (-709.208) (-708.681) (-706.532) -- 0:01:19

      Average standard deviation of split frequencies: 0.039631

      150500 -- (-704.939) (-708.401) [-702.613] (-699.736) * (-708.810) [-706.540] (-713.708) (-707.433) -- 0:01:19
      151000 -- (-709.274) [-702.944] (-709.058) (-704.882) * (-712.037) (-704.969) (-707.652) [-704.060] -- 0:01:18
      151500 -- (-706.109) (-703.604) (-704.259) [-703.626] * (-703.905) [-704.642] (-706.554) (-711.523) -- 0:01:18
      152000 -- (-704.705) [-703.120] (-711.778) (-702.687) * (-706.035) [-708.642] (-710.605) (-703.177) -- 0:01:18
      152500 -- (-706.459) [-706.064] (-706.636) (-707.534) * (-705.588) (-702.339) [-707.872] (-703.830) -- 0:01:17
      153000 -- (-705.875) [-703.439] (-705.181) (-709.819) * (-715.329) [-701.002] (-704.617) (-702.814) -- 0:01:23
      153500 -- (-711.689) (-707.354) (-706.199) [-701.259] * [-700.533] (-700.365) (-702.556) (-701.887) -- 0:01:22
      154000 -- (-708.794) (-702.593) [-703.407] (-708.194) * (-708.352) (-704.644) [-704.633] (-709.194) -- 0:01:22
      154500 -- (-714.185) (-708.474) [-703.332] (-706.808) * (-707.696) (-704.608) [-706.040] (-705.117) -- 0:01:22
      155000 -- (-707.262) (-707.339) (-704.197) [-707.221] * [-707.142] (-702.416) (-705.896) (-703.747) -- 0:01:21

      Average standard deviation of split frequencies: 0.034247

      155500 -- [-702.216] (-704.057) (-707.158) (-706.314) * (-710.900) [-707.915] (-705.268) (-704.982) -- 0:01:21
      156000 -- [-706.079] (-706.713) (-707.182) (-709.948) * [-707.528] (-707.612) (-708.758) (-707.387) -- 0:01:21
      156500 -- [-701.954] (-707.312) (-707.853) (-710.239) * [-703.974] (-711.226) (-712.365) (-706.026) -- 0:01:20
      157000 -- (-701.654) [-704.155] (-706.462) (-704.040) * (-708.424) (-708.420) [-703.780] (-710.289) -- 0:01:20
      157500 -- (-707.958) [-703.851] (-703.407) (-706.465) * (-705.263) [-704.309] (-701.469) (-707.104) -- 0:01:20
      158000 -- [-703.693] (-710.265) (-700.792) (-711.911) * [-703.746] (-707.674) (-703.442) (-703.019) -- 0:01:19
      158500 -- (-700.659) (-712.897) [-705.293] (-710.664) * (-703.257) (-706.379) [-705.186] (-702.541) -- 0:01:19
      159000 -- (-700.660) (-707.497) [-704.841] (-708.206) * (-705.909) [-705.106] (-706.841) (-706.508) -- 0:01:19
      159500 -- (-704.280) (-710.451) [-702.215] (-708.516) * (-704.817) [-703.017] (-708.510) (-703.314) -- 0:01:19
      160000 -- (-708.990) [-708.459] (-703.205) (-707.442) * (-707.533) (-705.003) (-707.856) [-705.898] -- 0:01:18

      Average standard deviation of split frequencies: 0.031297

      160500 -- (-703.954) [-703.307] (-702.839) (-705.759) * [-708.108] (-709.144) (-702.023) (-703.317) -- 0:01:18
      161000 -- (-703.536) [-706.962] (-707.790) (-701.873) * (-703.641) (-702.192) (-702.881) [-708.323] -- 0:01:18
      161500 -- (-702.672) [-704.394] (-714.806) (-708.235) * (-710.534) (-706.618) (-700.988) [-704.952] -- 0:01:17
      162000 -- (-703.429) (-708.305) [-705.477] (-707.995) * (-705.479) (-701.700) [-710.018] (-702.195) -- 0:01:17
      162500 -- (-709.353) [-707.467] (-707.588) (-707.372) * (-714.874) (-703.846) [-704.479] (-703.635) -- 0:01:17
      163000 -- (-701.550) (-707.973) [-703.557] (-708.124) * (-710.771) (-703.850) [-707.294] (-705.696) -- 0:01:17
      163500 -- (-707.216) (-702.693) [-704.214] (-712.216) * (-703.955) (-707.659) (-705.387) [-702.904] -- 0:01:16
      164000 -- (-705.881) (-708.129) [-706.454] (-709.407) * (-706.941) (-701.586) [-706.173] (-706.109) -- 0:01:21
      164500 -- [-703.937] (-701.787) (-715.876) (-704.767) * [-708.632] (-708.899) (-703.478) (-705.210) -- 0:01:21
      165000 -- [-707.935] (-703.624) (-708.381) (-703.788) * [-702.210] (-709.141) (-707.044) (-704.675) -- 0:01:20

      Average standard deviation of split frequencies: 0.024611

      165500 -- (-704.148) (-707.363) [-703.560] (-704.425) * (-708.796) (-712.744) (-704.270) [-703.327] -- 0:01:20
      166000 -- (-706.366) (-706.621) [-703.951] (-704.222) * (-703.711) (-707.273) [-701.295] (-709.644) -- 0:01:20
      166500 -- (-707.422) (-704.424) [-707.875] (-707.178) * [-703.065] (-708.085) (-703.828) (-704.945) -- 0:01:20
      167000 -- (-703.214) [-702.660] (-706.746) (-702.519) * [-704.119] (-710.083) (-706.593) (-705.426) -- 0:01:19
      167500 -- (-703.848) (-707.968) [-707.749] (-708.601) * (-707.144) (-706.544) (-710.456) [-700.465] -- 0:01:19
      168000 -- (-706.836) (-706.490) [-708.095] (-706.243) * (-701.298) (-706.927) [-704.269] (-703.597) -- 0:01:19
      168500 -- [-705.716] (-703.234) (-712.173) (-706.269) * [-707.155] (-704.037) (-705.948) (-704.136) -- 0:01:18
      169000 -- (-711.798) [-705.483] (-714.073) (-703.356) * (-704.597) (-705.200) (-705.611) [-706.934] -- 0:01:18
      169500 -- (-708.390) (-708.228) [-710.078] (-706.756) * (-708.540) [-705.821] (-709.877) (-704.653) -- 0:01:18
      170000 -- (-709.569) [-701.539] (-706.648) (-705.677) * (-707.420) [-704.746] (-710.473) (-707.580) -- 0:01:18

      Average standard deviation of split frequencies: 0.031304

      170500 -- (-704.882) [-701.838] (-708.206) (-706.819) * (-702.814) (-703.309) [-705.356] (-702.692) -- 0:01:17
      171000 -- (-701.665) (-704.550) [-704.892] (-702.499) * (-710.640) [-702.476] (-704.416) (-710.861) -- 0:01:17
      171500 -- (-712.698) [-702.855] (-707.105) (-703.226) * (-714.068) (-704.902) (-704.134) [-712.339] -- 0:01:17
      172000 -- (-708.249) (-702.285) [-705.286] (-704.215) * (-705.145) [-700.460] (-703.812) (-707.907) -- 0:01:17
      172500 -- [-709.641] (-702.841) (-706.219) (-713.711) * [-705.457] (-705.245) (-708.296) (-706.345) -- 0:01:16
      173000 -- (-705.818) [-703.921] (-705.559) (-706.740) * (-705.358) (-703.544) [-710.821] (-708.155) -- 0:01:16
      173500 -- [-703.683] (-705.143) (-708.555) (-709.052) * (-707.359) [-702.926] (-709.880) (-704.962) -- 0:01:16
      174000 -- (-704.020) (-705.547) (-708.312) [-706.742] * (-706.046) [-702.285] (-711.571) (-704.733) -- 0:01:15
      174500 -- [-702.853] (-711.221) (-713.470) (-704.191) * (-707.991) [-702.410] (-712.435) (-713.581) -- 0:01:15
      175000 -- (-702.632) (-707.072) (-711.913) [-704.951] * (-706.702) [-702.730] (-707.854) (-705.016) -- 0:01:20

      Average standard deviation of split frequencies: 0.023213

      175500 -- [-705.759] (-713.389) (-708.595) (-709.034) * (-707.748) [-703.264] (-705.495) (-709.966) -- 0:01:19
      176000 -- (-708.877) (-717.133) [-712.883] (-708.027) * [-709.571] (-706.735) (-706.263) (-710.737) -- 0:01:19
      176500 -- (-705.844) (-707.595) (-702.859) [-703.950] * (-702.070) [-700.163] (-705.965) (-706.137) -- 0:01:19
      177000 -- (-705.327) [-714.159] (-703.733) (-706.198) * [-706.887] (-704.910) (-703.895) (-710.602) -- 0:01:19
      177500 -- (-707.372) (-709.009) [-703.346] (-704.725) * [-706.315] (-702.037) (-712.347) (-708.264) -- 0:01:18
      178000 -- (-704.071) [-707.902] (-706.918) (-703.920) * (-705.918) [-699.326] (-709.494) (-703.268) -- 0:01:18
      178500 -- [-707.263] (-705.850) (-704.939) (-705.215) * (-706.320) (-705.205) [-705.328] (-713.979) -- 0:01:18
      179000 -- (-704.900) [-709.272] (-708.318) (-704.875) * (-703.814) (-702.163) [-702.115] (-703.640) -- 0:01:17
      179500 -- (-704.076) [-708.223] (-710.269) (-704.573) * (-708.704) [-706.282] (-703.160) (-704.474) -- 0:01:17
      180000 -- (-704.423) [-707.660] (-705.382) (-703.996) * (-705.765) [-702.785] (-704.835) (-702.214) -- 0:01:17

      Average standard deviation of split frequencies: 0.017395

      180500 -- [-704.771] (-712.965) (-704.359) (-708.383) * (-710.404) (-700.168) [-707.831] (-705.127) -- 0:01:17
      181000 -- (-711.291) [-718.529] (-706.059) (-708.378) * (-710.841) [-714.111] (-707.040) (-707.826) -- 0:01:16
      181500 -- [-704.313] (-710.927) (-706.542) (-708.462) * [-707.952] (-708.044) (-715.293) (-707.821) -- 0:01:16
      182000 -- [-702.785] (-707.194) (-711.883) (-706.383) * (-716.181) (-709.562) [-710.527] (-710.894) -- 0:01:16
      182500 -- [-701.980] (-713.501) (-710.245) (-702.981) * (-711.978) (-710.573) [-706.358] (-705.335) -- 0:01:16
      183000 -- (-704.019) (-712.255) [-706.013] (-701.985) * (-707.951) [-708.858] (-712.927) (-714.586) -- 0:01:15
      183500 -- (-707.453) [-712.779] (-711.919) (-710.911) * (-708.161) [-703.181] (-704.761) (-709.225) -- 0:01:15
      184000 -- [-709.824] (-708.714) (-712.010) (-705.750) * [-706.831] (-705.560) (-706.245) (-707.525) -- 0:01:15
      184500 -- (-714.793) (-711.682) [-712.382] (-703.475) * (-710.035) (-705.469) (-706.974) [-712.914] -- 0:01:15
      185000 -- (-714.214) (-705.964) (-709.016) [-701.926] * (-712.068) (-710.658) (-704.316) [-709.671] -- 0:01:14

      Average standard deviation of split frequencies: 0.021965

      185500 -- (-708.346) (-707.868) (-708.444) [-700.633] * (-713.264) (-713.138) [-704.044] (-699.967) -- 0:01:19
      186000 -- (-708.829) (-709.017) [-707.349] (-699.390) * (-710.748) [-709.898] (-701.092) (-702.378) -- 0:01:18
      186500 -- (-711.314) (-708.703) [-703.372] (-703.607) * (-714.035) (-705.762) [-703.660] (-704.938) -- 0:01:18
      187000 -- [-712.283] (-707.633) (-703.657) (-708.419) * (-708.387) (-702.900) (-709.892) [-703.663] -- 0:01:18
      187500 -- (-707.806) [-708.199] (-708.652) (-713.941) * [-708.974] (-714.504) (-709.260) (-705.057) -- 0:01:18
      188000 -- (-708.547) (-706.430) (-709.274) [-703.565] * (-708.285) (-714.194) (-703.090) [-711.128] -- 0:01:17
      188500 -- (-705.979) (-708.298) [-706.697] (-705.772) * (-712.180) (-706.402) [-710.030] (-703.896) -- 0:01:17
      189000 -- (-705.798) (-705.730) (-704.617) [-707.908] * (-703.096) [-703.058] (-703.435) (-707.336) -- 0:01:17
      189500 -- (-704.646) (-710.708) [-703.660] (-705.404) * (-704.379) [-704.934] (-702.969) (-704.030) -- 0:01:16
      190000 -- (-708.865) (-707.085) [-705.805] (-702.502) * (-708.985) (-704.654) (-704.282) [-703.954] -- 0:01:16

      Average standard deviation of split frequencies: 0.031317

      190500 -- (-708.192) (-707.689) (-709.470) [-702.772] * [-701.731] (-714.400) (-711.945) (-708.829) -- 0:01:16
      191000 -- (-704.629) [-710.165] (-706.387) (-706.437) * (-709.881) (-709.278) (-713.084) [-704.592] -- 0:01:16
      191500 -- (-713.543) [-709.394] (-702.595) (-704.162) * (-709.396) (-711.564) [-702.771] (-710.929) -- 0:01:15
      192000 -- (-708.248) (-703.829) [-705.858] (-702.725) * (-703.688) (-707.281) [-707.058] (-705.862) -- 0:01:15
      192500 -- (-707.868) [-706.454] (-702.433) (-705.096) * (-712.607) (-705.506) [-704.449] (-708.282) -- 0:01:15
      193000 -- (-707.643) (-705.415) (-705.947) [-701.148] * [-708.699] (-702.919) (-708.064) (-707.741) -- 0:01:15
      193500 -- [-711.911] (-707.545) (-706.671) (-706.281) * [-707.591] (-705.119) (-710.299) (-702.417) -- 0:01:15
      194000 -- (-706.343) [-707.935] (-706.894) (-710.669) * (-701.907) [-705.019] (-703.689) (-706.184) -- 0:01:14
      194500 -- [-704.007] (-708.274) (-703.557) (-707.082) * (-708.764) (-700.819) (-704.748) [-702.986] -- 0:01:14
      195000 -- [-703.017] (-710.284) (-706.197) (-706.228) * (-705.069) (-707.141) (-703.981) [-701.764] -- 0:01:14

      Average standard deviation of split frequencies: 0.027258

      195500 -- (-704.720) (-703.503) [-708.137] (-710.360) * (-700.564) (-704.901) [-703.974] (-711.402) -- 0:01:14
      196000 -- (-703.949) [-705.959] (-705.330) (-709.314) * (-703.002) (-706.789) (-706.061) [-702.693] -- 0:01:17
      196500 -- [-702.381] (-703.279) (-707.612) (-709.803) * (-704.298) (-707.061) [-704.517] (-702.469) -- 0:01:17
      197000 -- [-701.012] (-703.894) (-706.542) (-705.161) * (-703.858) [-703.439] (-706.711) (-703.726) -- 0:01:17
      197500 -- (-704.371) [-703.516] (-704.802) (-707.186) * (-705.635) [-701.801] (-704.069) (-704.212) -- 0:01:17
      198000 -- [-703.723] (-704.367) (-705.580) (-710.444) * (-705.649) [-703.151] (-706.459) (-702.940) -- 0:01:16
      198500 -- (-703.683) (-703.760) [-704.760] (-716.341) * (-706.446) [-701.025] (-703.028) (-707.940) -- 0:01:16
      199000 -- [-708.016] (-704.855) (-706.889) (-706.002) * (-710.694) (-704.528) [-703.204] (-707.777) -- 0:01:16
      199500 -- (-709.359) [-704.701] (-702.622) (-707.904) * [-707.040] (-704.997) (-702.742) (-709.336) -- 0:01:16
      200000 -- (-703.494) [-704.262] (-698.042) (-704.698) * [-703.978] (-701.926) (-709.590) (-708.474) -- 0:01:16

      Average standard deviation of split frequencies: 0.028190

      200500 -- (-707.741) (-708.193) (-713.785) [-715.049] * (-703.073) (-714.372) [-704.968] (-706.610) -- 0:01:15
      201000 -- (-708.774) (-704.736) (-710.959) [-706.629] * (-700.527) (-706.883) [-706.756] (-705.898) -- 0:01:15
      201500 -- (-700.739) (-703.670) (-706.833) [-703.967] * (-707.007) (-702.776) [-706.163] (-705.458) -- 0:01:15
      202000 -- [-701.729] (-706.771) (-712.314) (-712.345) * (-708.195) [-706.591] (-703.899) (-710.780) -- 0:01:15
      202500 -- (-701.866) (-706.919) (-704.653) [-710.153] * (-702.489) (-706.544) (-706.930) [-703.699] -- 0:01:14
      203000 -- (-705.627) (-711.654) (-708.340) [-705.819] * (-703.478) [-707.680] (-703.235) (-704.688) -- 0:01:14
      203500 -- (-704.732) (-707.054) (-705.193) [-706.472] * [-703.095] (-711.298) (-707.548) (-708.976) -- 0:01:14
      204000 -- (-707.158) (-709.043) [-704.432] (-706.210) * (-708.228) (-710.713) [-702.253] (-704.646) -- 0:01:14
      204500 -- [-702.108] (-705.639) (-704.368) (-708.340) * (-712.440) (-703.310) (-703.844) [-700.521] -- 0:01:13
      205000 -- (-703.159) (-703.710) [-701.303] (-703.994) * (-714.859) [-701.608] (-704.613) (-710.413) -- 0:01:13

      Average standard deviation of split frequencies: 0.028986

      205500 -- (-705.591) (-709.379) (-703.781) [-702.500] * (-708.333) [-704.727] (-707.118) (-708.359) -- 0:01:13
      206000 -- (-704.893) (-706.332) [-708.003] (-704.970) * (-706.349) (-704.090) (-704.402) [-707.716] -- 0:01:13
      206500 -- (-700.439) (-707.996) [-705.564] (-707.017) * (-712.089) [-703.213] (-709.375) (-706.625) -- 0:01:13
      207000 -- (-702.211) [-705.967] (-702.991) (-709.514) * [-705.948] (-705.039) (-703.378) (-706.826) -- 0:01:16
      207500 -- (-705.373) [-700.894] (-701.818) (-705.796) * [-709.312] (-705.218) (-713.337) (-705.132) -- 0:01:16
      208000 -- (-709.800) [-708.818] (-703.330) (-707.627) * (-703.955) (-703.338) [-710.830] (-704.067) -- 0:01:16
      208500 -- (-703.143) (-706.437) [-706.346] (-713.619) * (-707.453) [-703.865] (-708.389) (-701.131) -- 0:01:15
      209000 -- (-706.625) (-705.362) [-710.303] (-711.996) * (-705.806) [-706.508] (-712.029) (-708.694) -- 0:01:15
      209500 -- [-701.490] (-706.564) (-703.895) (-704.389) * (-700.918) (-706.487) (-709.169) [-700.852] -- 0:01:15
      210000 -- (-704.300) (-711.687) [-710.805] (-706.361) * (-701.123) (-703.047) [-707.189] (-707.071) -- 0:01:15

      Average standard deviation of split frequencies: 0.025360

      210500 -- [-701.729] (-708.531) (-706.881) (-706.192) * (-705.277) (-707.589) (-708.012) [-701.696] -- 0:01:15
      211000 -- (-710.545) [-706.762] (-708.576) (-705.626) * (-708.575) (-706.133) (-709.037) [-706.747] -- 0:01:14
      211500 -- (-704.549) [-708.106] (-711.740) (-710.858) * (-708.671) (-701.164) [-710.433] (-708.450) -- 0:01:14
      212000 -- (-703.130) (-705.186) [-712.722] (-703.871) * (-714.403) (-703.489) (-706.028) [-707.088] -- 0:01:14
      212500 -- (-707.342) (-705.950) (-708.178) [-700.868] * (-713.489) (-703.358) [-707.287] (-710.425) -- 0:01:14
      213000 -- (-705.003) (-715.518) (-707.202) [-705.623] * (-708.348) [-706.443] (-701.393) (-703.302) -- 0:01:13
      213500 -- (-705.986) (-707.483) (-704.584) [-705.783] * (-705.032) [-704.004] (-702.398) (-704.874) -- 0:01:13
      214000 -- (-700.640) (-709.080) (-705.915) [-700.365] * (-705.677) (-710.832) [-703.267] (-700.604) -- 0:01:13
      214500 -- (-711.720) [-704.394] (-706.166) (-710.256) * (-705.988) (-708.192) (-706.185) [-703.799] -- 0:01:13
      215000 -- [-707.655] (-714.270) (-708.836) (-702.933) * (-705.862) [-703.779] (-706.221) (-708.520) -- 0:01:13

      Average standard deviation of split frequencies: 0.021824

      215500 -- [-708.315] (-705.763) (-708.472) (-702.879) * [-705.452] (-703.988) (-704.409) (-707.409) -- 0:01:12
      216000 -- [-704.113] (-710.419) (-711.981) (-706.020) * (-707.016) (-713.323) (-713.110) [-704.627] -- 0:01:12
      216500 -- [-701.229] (-708.196) (-701.426) (-703.121) * (-709.025) [-704.580] (-703.733) (-706.466) -- 0:01:12
      217000 -- [-706.705] (-710.816) (-701.504) (-704.913) * (-702.949) (-703.584) (-707.196) [-706.266] -- 0:01:12
      217500 -- (-702.927) [-703.046] (-700.416) (-701.606) * (-710.831) (-710.251) (-705.446) [-700.636] -- 0:01:11
      218000 -- (-703.943) (-710.020) (-703.807) [-701.001] * (-714.779) (-709.782) (-703.990) [-706.608] -- 0:01:15
      218500 -- (-711.463) (-706.175) (-709.184) [-703.254] * (-707.483) (-712.994) [-704.492] (-706.378) -- 0:01:15
      219000 -- [-707.624] (-706.015) (-711.221) (-701.989) * [-707.211] (-712.364) (-706.831) (-704.176) -- 0:01:14
      219500 -- [-704.919] (-706.168) (-709.381) (-710.186) * [-702.258] (-715.339) (-704.128) (-705.308) -- 0:01:14
      220000 -- (-715.308) [-706.901] (-709.133) (-707.067) * [-704.724] (-707.787) (-704.678) (-702.088) -- 0:01:14

      Average standard deviation of split frequencies: 0.019939

      220500 -- [-708.871] (-707.681) (-707.005) (-700.985) * [-701.851] (-709.643) (-705.922) (-704.235) -- 0:01:14
      221000 -- (-708.274) (-709.955) [-703.275] (-712.501) * (-704.289) (-700.182) [-702.483] (-704.890) -- 0:01:14
      221500 -- [-704.205] (-707.809) (-701.361) (-708.694) * (-709.906) (-704.740) (-709.613) [-704.280] -- 0:01:13
      222000 -- (-705.237) [-704.375] (-700.942) (-704.650) * [-704.492] (-706.588) (-710.660) (-707.067) -- 0:01:13
      222500 -- (-709.745) (-701.117) [-706.320] (-705.777) * (-715.591) (-704.340) (-707.736) [-705.954] -- 0:01:13
      223000 -- [-703.481] (-704.237) (-704.491) (-707.707) * (-708.409) (-707.809) (-709.602) [-702.571] -- 0:01:13
      223500 -- (-703.461) (-705.565) [-705.931] (-705.565) * (-707.714) (-708.374) [-712.011] (-705.322) -- 0:01:12
      224000 -- (-703.699) [-702.388] (-711.319) (-705.036) * (-706.301) (-710.449) [-705.849] (-704.528) -- 0:01:12
      224500 -- [-702.790] (-708.829) (-700.572) (-708.890) * [-703.838] (-708.919) (-704.342) (-706.088) -- 0:01:12
      225000 -- (-703.970) (-711.248) [-703.045] (-706.572) * [-700.939] (-711.479) (-706.792) (-706.789) -- 0:01:12

      Average standard deviation of split frequencies: 0.023640

      225500 -- [-701.488] (-708.899) (-700.881) (-711.286) * (-707.333) (-706.335) (-709.794) [-707.540] -- 0:01:12
      226000 -- (-699.783) [-706.888] (-705.227) (-712.532) * (-702.139) (-702.066) (-712.081) [-702.503] -- 0:01:11
      226500 -- (-703.932) (-706.478) (-702.812) [-705.455] * (-711.094) (-708.529) (-703.548) [-701.810] -- 0:01:11
      227000 -- (-705.419) (-702.840) [-703.671] (-707.776) * [-702.842] (-706.563) (-706.326) (-702.128) -- 0:01:11
      227500 -- [-699.797] (-705.795) (-706.200) (-707.061) * (-708.521) (-702.857) [-701.113] (-708.100) -- 0:01:11
      228000 -- (-703.887) (-703.980) (-709.318) [-703.825] * (-709.680) (-709.435) (-702.631) [-701.983] -- 0:01:11
      228500 -- (-705.521) (-711.669) (-705.920) [-705.960] * (-712.964) [-713.116] (-704.043) (-703.940) -- 0:01:10
      229000 -- (-712.922) (-708.787) (-706.433) [-703.279] * (-706.763) (-704.584) [-704.411] (-704.518) -- 0:01:14
      229500 -- [-707.100] (-708.188) (-708.395) (-703.190) * (-705.450) [-705.865] (-707.856) (-714.115) -- 0:01:13
      230000 -- (-704.415) (-708.460) (-703.962) [-704.450] * (-704.926) [-705.982] (-706.018) (-701.086) -- 0:01:13

      Average standard deviation of split frequencies: 0.024524

      230500 -- (-704.474) (-709.158) [-704.222] (-704.337) * [-707.335] (-711.706) (-708.180) (-706.463) -- 0:01:13
      231000 -- (-707.057) [-706.304] (-704.991) (-704.105) * [-701.290] (-716.786) (-706.922) (-710.409) -- 0:01:13
      231500 -- (-710.744) (-704.318) [-705.108] (-702.669) * (-706.122) (-711.772) (-705.540) [-703.543] -- 0:01:13
      232000 -- (-712.466) (-705.339) (-703.561) [-702.489] * [-704.739] (-703.481) (-707.806) (-703.616) -- 0:01:12
      232500 -- (-704.924) [-704.309] (-700.693) (-704.339) * (-708.406) [-705.744] (-707.327) (-699.732) -- 0:01:12
      233000 -- (-709.569) [-705.184] (-700.665) (-704.287) * (-705.371) (-710.468) (-707.501) [-705.172] -- 0:01:12
      233500 -- (-703.561) (-702.740) (-701.913) [-703.586] * [-703.279] (-706.820) (-702.167) (-702.916) -- 0:01:12
      234000 -- (-709.635) (-710.103) [-701.968] (-704.567) * (-705.262) (-707.667) [-701.910] (-707.616) -- 0:01:12
      234500 -- (-707.035) (-704.485) [-702.389] (-708.851) * (-708.242) (-711.225) [-702.608] (-703.399) -- 0:01:11
      235000 -- (-706.490) (-706.074) [-707.985] (-707.409) * [-704.101] (-717.423) (-709.298) (-704.610) -- 0:01:11

      Average standard deviation of split frequencies: 0.019975

      235500 -- [-711.146] (-703.572) (-704.650) (-708.147) * (-709.423) [-708.062] (-707.703) (-701.814) -- 0:01:11
      236000 -- [-707.898] (-705.024) (-703.053) (-703.603) * (-706.775) (-704.264) (-700.833) [-706.087] -- 0:01:11
      236500 -- (-710.542) [-708.356] (-702.522) (-702.265) * (-703.651) (-707.665) (-709.607) [-703.019] -- 0:01:11
      237000 -- (-711.045) (-718.310) [-706.685] (-708.372) * (-706.239) (-710.139) (-707.946) [-703.933] -- 0:01:10
      237500 -- (-715.232) (-708.600) (-705.168) [-706.891] * (-704.617) (-715.496) [-710.780] (-702.388) -- 0:01:10
      238000 -- (-711.170) (-709.423) (-710.990) [-704.581] * (-703.404) (-709.686) (-707.146) [-700.763] -- 0:01:10
      238500 -- [-704.943] (-705.024) (-708.672) (-707.586) * (-707.133) (-714.694) [-702.793] (-711.315) -- 0:01:10
      239000 -- (-705.494) (-703.881) (-704.185) [-709.000] * [-699.517] (-704.925) (-706.641) (-702.844) -- 0:01:10
      239500 -- [-707.035] (-707.223) (-710.685) (-707.508) * [-706.516] (-711.148) (-703.832) (-703.468) -- 0:01:13
      240000 -- (-712.281) [-707.226] (-704.885) (-706.704) * (-707.716) (-721.639) [-700.805] (-705.408) -- 0:01:12

      Average standard deviation of split frequencies: 0.019587

      240500 -- [-709.123] (-705.744) (-707.355) (-708.783) * (-703.066) (-715.268) [-706.349] (-705.014) -- 0:01:12
      241000 -- (-712.293) [-703.878] (-710.567) (-704.226) * (-707.804) [-708.537] (-703.634) (-707.038) -- 0:01:12
      241500 -- [-702.328] (-704.455) (-708.149) (-705.067) * (-708.849) (-712.058) (-705.430) [-706.273] -- 0:01:12
      242000 -- (-706.187) [-710.048] (-709.025) (-708.287) * [-708.819] (-711.996) (-706.643) (-705.650) -- 0:01:12
      242500 -- (-706.013) (-704.907) (-707.638) [-704.808] * [-710.627] (-707.455) (-705.739) (-709.176) -- 0:01:11
      243000 -- (-715.556) [-703.876] (-710.383) (-710.596) * (-708.776) [-708.396] (-715.908) (-706.592) -- 0:01:11
      243500 -- (-709.685) [-706.042] (-702.045) (-707.791) * (-708.593) [-704.142] (-702.977) (-707.562) -- 0:01:11
      244000 -- (-700.897) [-702.315] (-706.503) (-707.014) * (-709.015) (-711.925) (-705.512) [-704.148] -- 0:01:11
      244500 -- (-702.981) [-703.424] (-705.374) (-707.589) * (-708.712) [-702.986] (-706.963) (-712.261) -- 0:01:11
      245000 -- [-708.206] (-704.962) (-701.074) (-708.935) * [-705.047] (-702.679) (-706.353) (-710.774) -- 0:01:10

      Average standard deviation of split frequencies: 0.019163

      245500 -- (-706.493) [-699.488] (-714.188) (-703.687) * (-711.715) [-710.028] (-704.538) (-709.392) -- 0:01:10
      246000 -- (-709.898) [-707.394] (-703.735) (-703.535) * (-711.704) (-710.561) [-707.247] (-704.406) -- 0:01:10
      246500 -- (-709.787) (-703.824) (-702.601) [-710.043] * (-705.099) [-705.742] (-705.503) (-703.368) -- 0:01:10
      247000 -- (-707.422) [-708.730] (-705.700) (-705.934) * [-705.011] (-706.043) (-708.701) (-709.655) -- 0:01:10
      247500 -- (-707.624) (-704.104) [-704.839] (-704.020) * [-706.637] (-704.513) (-709.365) (-700.076) -- 0:01:09
      248000 -- (-711.120) (-711.443) (-704.326) [-704.557] * (-713.904) [-709.432] (-706.193) (-703.449) -- 0:01:09
      248500 -- [-707.687] (-711.517) (-707.147) (-709.047) * (-708.188) (-708.235) [-705.407] (-699.275) -- 0:01:09
      249000 -- (-706.331) (-708.334) (-712.260) [-703.902] * (-718.946) (-703.723) (-701.217) [-701.407] -- 0:01:09
      249500 -- [-704.571] (-706.826) (-707.039) (-706.258) * [-713.503] (-703.187) (-701.645) (-709.712) -- 0:01:09
      250000 -- (-706.593) [-705.969] (-707.433) (-705.449) * (-705.758) (-704.665) (-703.754) [-701.195] -- 0:01:12

      Average standard deviation of split frequencies: 0.017552

      250500 -- (-704.506) (-708.917) (-707.041) [-702.118] * (-703.525) (-705.058) [-701.304] (-706.618) -- 0:01:11
      251000 -- (-705.157) [-704.018] (-705.647) (-702.833) * (-705.059) (-704.361) [-705.397] (-704.960) -- 0:01:11
      251500 -- (-706.802) [-703.151] (-708.884) (-708.243) * (-709.132) (-705.176) (-703.722) [-700.879] -- 0:01:11
      252000 -- (-709.308) (-708.818) [-704.763] (-709.845) * (-702.407) (-705.236) (-710.893) [-703.159] -- 0:01:11
      252500 -- [-709.676] (-705.651) (-709.165) (-705.560) * (-708.882) (-701.040) (-709.949) [-703.742] -- 0:01:11
      253000 -- [-711.579] (-711.486) (-704.135) (-706.215) * (-707.312) (-707.826) [-709.077] (-707.081) -- 0:01:10
      253500 -- [-700.296] (-711.104) (-706.582) (-710.302) * [-705.005] (-706.381) (-709.733) (-703.283) -- 0:01:10
      254000 -- (-703.503) (-705.337) (-704.586) [-704.920] * [-704.635] (-703.981) (-707.852) (-703.458) -- 0:01:10
      254500 -- (-701.222) (-707.863) (-704.020) [-711.054] * [-700.116] (-702.685) (-712.616) (-704.972) -- 0:01:10
      255000 -- [-708.122] (-707.191) (-709.727) (-707.740) * (-701.927) (-703.476) (-707.510) [-705.530] -- 0:01:10

      Average standard deviation of split frequencies: 0.015959

      255500 -- (-701.649) (-712.836) (-705.497) [-706.878] * (-715.071) (-709.521) [-704.893] (-700.343) -- 0:01:09
      256000 -- (-705.461) (-708.273) [-710.819] (-705.580) * (-705.645) [-711.070] (-706.301) (-715.308) -- 0:01:09
      256500 -- (-709.625) (-708.651) [-707.263] (-710.281) * (-707.305) (-703.411) [-708.893] (-711.557) -- 0:01:09
      257000 -- (-707.586) (-702.233) (-708.754) [-708.343] * [-701.802] (-705.250) (-706.409) (-707.681) -- 0:01:09
      257500 -- (-711.457) [-702.697] (-710.388) (-707.985) * (-705.985) (-704.798) (-706.914) [-704.615] -- 0:01:09
      258000 -- (-707.606) (-709.601) (-706.110) [-710.531] * [-702.267] (-706.236) (-702.145) (-703.923) -- 0:01:09
      258500 -- (-712.728) (-702.892) (-702.771) [-707.077] * (-707.895) (-712.354) [-701.141] (-713.704) -- 0:01:08
      259000 -- (-708.679) [-699.319] (-702.951) (-706.821) * (-702.319) (-706.280) [-705.777] (-707.305) -- 0:01:08
      259500 -- (-713.247) (-703.500) [-703.045] (-707.514) * (-703.762) (-707.020) (-704.839) [-706.925] -- 0:01:08
      260000 -- (-706.257) (-702.428) [-703.228] (-709.641) * (-708.135) (-706.567) (-707.393) [-704.238] -- 0:01:08

      Average standard deviation of split frequencies: 0.012056

      260500 -- (-706.624) [-707.896] (-704.578) (-704.546) * [-703.764] (-710.984) (-711.430) (-702.470) -- 0:01:08
      261000 -- (-708.166) (-706.016) [-704.103] (-705.798) * (-704.069) [-710.240] (-709.934) (-704.440) -- 0:01:10
      261500 -- (-708.537) [-705.249] (-707.539) (-707.914) * (-704.547) (-706.234) [-703.582] (-705.839) -- 0:01:10
      262000 -- (-702.577) (-704.476) (-706.384) [-707.904] * (-701.490) (-703.533) (-702.364) [-706.591] -- 0:01:10
      262500 -- (-706.465) [-703.954] (-705.437) (-706.817) * (-705.647) (-705.366) (-705.172) [-704.051] -- 0:01:10
      263000 -- (-704.819) (-703.625) (-707.559) [-702.680] * (-703.123) (-706.208) [-704.501] (-713.683) -- 0:01:10
      263500 -- (-700.614) (-705.456) (-700.304) [-705.692] * (-701.534) (-713.562) (-705.908) [-703.480] -- 0:01:09
      264000 -- (-703.463) [-703.475] (-703.432) (-707.654) * [-707.129] (-711.556) (-709.826) (-713.248) -- 0:01:09
      264500 -- [-705.873] (-707.420) (-704.314) (-709.914) * [-701.549] (-703.012) (-705.549) (-702.360) -- 0:01:09
      265000 -- (-710.790) [-703.753] (-703.202) (-707.941) * (-704.377) (-705.123) [-704.104] (-703.956) -- 0:01:09

      Average standard deviation of split frequencies: 0.016541

      265500 -- (-708.055) (-704.840) (-704.350) [-704.605] * [-711.122] (-713.803) (-708.220) (-702.483) -- 0:01:09
      266000 -- (-713.929) (-704.715) [-700.245] (-706.821) * (-709.383) [-707.728] (-706.889) (-710.088) -- 0:01:08
      266500 -- (-712.703) [-704.204] (-704.247) (-704.500) * (-706.372) (-710.589) [-712.060] (-707.549) -- 0:01:08
      267000 -- (-713.117) (-705.107) [-705.954] (-704.032) * (-703.911) [-705.442] (-708.699) (-701.760) -- 0:01:08
      267500 -- (-715.597) [-703.339] (-700.645) (-706.622) * (-706.341) (-703.334) [-706.384] (-707.274) -- 0:01:08
      268000 -- (-716.871) (-707.781) (-706.282) [-703.541] * [-708.490] (-704.110) (-706.493) (-707.466) -- 0:01:08
      268500 -- (-712.805) [-704.638] (-706.273) (-705.180) * (-704.519) (-705.934) (-706.822) [-707.229] -- 0:01:08
      269000 -- (-712.183) (-707.528) (-705.714) [-705.019] * (-703.626) (-704.792) [-705.175] (-705.679) -- 0:01:07
      269500 -- (-713.135) [-702.399] (-706.218) (-702.890) * (-706.135) (-706.894) [-700.949] (-708.241) -- 0:01:07
      270000 -- (-712.364) (-704.306) [-700.175] (-709.269) * (-712.813) (-703.680) [-703.990] (-712.232) -- 0:01:07

      Average standard deviation of split frequencies: 0.012772

      270500 -- (-721.781) (-709.228) (-705.863) [-703.275] * (-707.053) (-705.275) (-705.198) [-710.898] -- 0:01:07
      271000 -- (-712.373) [-711.300] (-703.428) (-706.113) * (-708.341) [-704.454] (-709.931) (-708.907) -- 0:01:07
      271500 -- (-712.660) [-706.892] (-703.578) (-711.910) * (-705.359) (-711.874) [-705.948] (-708.667) -- 0:01:09
      272000 -- (-714.208) (-704.630) [-708.471] (-703.920) * [-708.706] (-702.658) (-707.680) (-710.923) -- 0:01:09
      272500 -- (-707.785) (-706.731) (-705.682) [-705.669] * [-705.677] (-704.083) (-706.473) (-707.672) -- 0:01:09
      273000 -- (-706.451) [-708.316] (-706.549) (-705.161) * (-710.762) (-702.877) (-710.330) [-704.909] -- 0:01:09
      273500 -- (-707.230) (-708.688) [-706.560] (-707.497) * [-699.851] (-702.067) (-705.551) (-710.862) -- 0:01:09
      274000 -- (-706.719) (-707.056) [-703.209] (-703.638) * (-704.068) [-705.170] (-710.072) (-707.838) -- 0:01:08
      274500 -- [-708.908] (-704.955) (-704.880) (-705.920) * (-701.417) (-706.139) (-710.068) [-708.132] -- 0:01:08
      275000 -- [-702.342] (-705.861) (-705.793) (-709.247) * [-700.929] (-704.304) (-707.685) (-712.034) -- 0:01:08

      Average standard deviation of split frequencies: 0.012525

      275500 -- (-705.944) (-708.354) (-707.939) [-706.099] * [-699.921] (-705.881) (-706.889) (-706.629) -- 0:01:08
      276000 -- (-708.044) (-708.933) [-709.161] (-706.687) * (-701.620) (-700.902) (-701.592) [-703.564] -- 0:01:08
      276500 -- (-712.783) (-705.382) (-703.754) [-702.469] * (-702.214) [-701.686] (-702.772) (-706.135) -- 0:01:08
      277000 -- (-702.427) [-703.087] (-703.296) (-704.913) * (-706.717) [-702.071] (-707.548) (-706.289) -- 0:01:07
      277500 -- (-701.671) [-699.943] (-704.191) (-702.749) * [-703.010] (-707.700) (-706.383) (-705.678) -- 0:01:07
      278000 -- (-707.378) (-703.273) [-701.772] (-704.524) * [-709.485] (-703.447) (-708.280) (-705.837) -- 0:01:07
      278500 -- (-713.210) (-708.934) (-704.816) [-709.280] * [-705.421] (-705.776) (-712.568) (-707.214) -- 0:01:07
      279000 -- (-707.912) [-704.678] (-709.246) (-704.776) * (-702.967) (-706.012) [-703.732] (-703.762) -- 0:01:07
      279500 -- (-708.862) [-709.035] (-704.196) (-703.702) * (-705.747) [-700.937] (-705.263) (-701.969) -- 0:01:07
      280000 -- (-712.630) (-700.609) (-700.734) [-705.702] * (-708.475) [-704.475] (-706.830) (-703.424) -- 0:01:06

      Average standard deviation of split frequencies: 0.015676

      280500 -- (-704.783) (-704.588) (-709.872) [-703.506] * (-704.598) (-709.667) (-706.966) [-705.764] -- 0:01:06
      281000 -- (-705.318) (-710.696) [-706.192] (-704.661) * [-710.781] (-704.787) (-704.622) (-706.863) -- 0:01:06
      281500 -- (-707.720) [-704.721] (-701.290) (-712.768) * [-706.620] (-703.320) (-714.761) (-703.333) -- 0:01:06
      282000 -- (-706.061) [-699.913] (-706.075) (-705.621) * (-708.907) [-705.159] (-707.563) (-705.449) -- 0:01:06
      282500 -- [-707.284] (-701.403) (-714.011) (-703.507) * (-704.805) (-707.096) (-708.762) [-700.869] -- 0:01:08
      283000 -- (-702.819) [-705.130] (-712.054) (-707.698) * (-710.117) (-702.862) [-705.685] (-705.877) -- 0:01:08
      283500 -- (-705.928) [-711.266] (-707.000) (-708.957) * (-708.081) [-706.356] (-702.914) (-706.199) -- 0:01:08
      284000 -- (-707.866) (-711.964) [-709.397] (-708.430) * (-703.670) (-707.968) [-711.090] (-702.849) -- 0:01:08
      284500 -- (-706.432) [-700.880] (-711.613) (-702.241) * (-707.806) (-705.601) (-702.890) [-705.362] -- 0:01:07
      285000 -- [-702.630] (-705.511) (-704.568) (-700.926) * (-709.598) [-703.780] (-708.038) (-710.882) -- 0:01:07

      Average standard deviation of split frequencies: 0.012087

      285500 -- [-707.035] (-707.148) (-705.750) (-704.486) * [-702.710] (-703.101) (-707.604) (-710.766) -- 0:01:07
      286000 -- (-708.283) (-705.834) [-705.127] (-705.541) * (-705.702) (-707.111) [-704.764] (-706.818) -- 0:01:07
      286500 -- (-708.316) (-705.428) (-703.077) [-713.041] * (-708.357) (-709.687) (-702.984) [-704.248] -- 0:01:07
      287000 -- (-712.667) (-705.181) [-708.652] (-710.781) * (-706.839) (-708.646) [-704.708] (-712.332) -- 0:01:07
      287500 -- (-706.270) (-704.141) (-707.263) [-710.093] * [-705.757] (-707.933) (-704.055) (-721.876) -- 0:01:06
      288000 -- (-701.563) [-709.354] (-710.933) (-708.400) * (-706.970) (-708.651) [-706.781] (-712.900) -- 0:01:06
      288500 -- (-708.433) [-702.691] (-705.679) (-705.859) * (-701.934) [-708.988] (-704.819) (-715.940) -- 0:01:06
      289000 -- (-705.900) (-704.912) (-711.989) [-704.660] * [-710.162] (-709.288) (-707.388) (-705.204) -- 0:01:06
      289500 -- (-707.140) (-702.612) [-703.958] (-702.386) * (-706.947) (-706.564) [-708.215] (-704.157) -- 0:01:06
      290000 -- (-709.745) (-705.095) (-702.637) [-703.712] * (-708.733) [-703.288] (-702.332) (-704.942) -- 0:01:06

      Average standard deviation of split frequencies: 0.009731

      290500 -- (-709.168) [-704.447] (-707.846) (-706.110) * (-710.784) (-706.093) (-702.769) [-705.118] -- 0:01:05
      291000 -- (-709.139) (-702.151) [-701.126] (-706.824) * (-707.567) [-705.682] (-707.330) (-705.084) -- 0:01:05
      291500 -- [-701.728] (-701.953) (-710.671) (-702.439) * (-708.893) (-706.195) [-720.110] (-706.146) -- 0:01:05
      292000 -- (-706.989) (-703.690) [-707.129] (-709.695) * (-712.107) [-706.080] (-712.334) (-708.347) -- 0:01:05
      292500 -- (-706.551) (-705.706) [-706.325] (-708.507) * [-704.534] (-703.172) (-712.833) (-704.474) -- 0:01:05
      293000 -- (-707.534) [-711.576] (-708.032) (-705.896) * [-701.798] (-706.700) (-708.325) (-703.405) -- 0:01:05
      293500 -- (-706.212) (-704.929) [-703.467] (-705.995) * [-707.553] (-709.727) (-708.048) (-704.769) -- 0:01:07
      294000 -- (-706.009) (-709.919) (-707.102) [-703.702] * (-706.489) [-708.201] (-710.263) (-712.977) -- 0:01:07
      294500 -- (-709.714) [-706.337] (-704.848) (-708.957) * [-702.156] (-707.769) (-706.195) (-703.328) -- 0:01:07
      295000 -- (-706.556) (-709.353) [-705.303] (-701.546) * (-705.494) (-705.822) [-705.473] (-707.922) -- 0:01:06

      Average standard deviation of split frequencies: 0.009555

      295500 -- (-710.485) [-703.164] (-706.139) (-700.718) * [-704.801] (-708.766) (-707.066) (-713.437) -- 0:01:06
      296000 -- (-706.492) (-707.628) [-702.479] (-703.289) * [-704.272] (-706.848) (-708.995) (-712.147) -- 0:01:06
      296500 -- (-706.150) (-705.114) (-705.202) [-699.268] * [-702.058] (-703.036) (-706.202) (-710.237) -- 0:01:06
      297000 -- (-704.276) [-704.439] (-711.852) (-701.814) * (-710.273) [-706.238] (-711.860) (-712.805) -- 0:01:06
      297500 -- (-706.678) (-704.385) (-711.962) [-706.469] * (-702.572) (-702.143) [-709.376] (-704.059) -- 0:01:06
      298000 -- (-707.787) (-708.369) (-714.203) [-706.100] * (-707.245) [-703.427] (-705.114) (-710.286) -- 0:01:05
      298500 -- (-705.392) [-702.383] (-710.328) (-706.398) * [-700.210] (-703.848) (-703.287) (-711.116) -- 0:01:05
      299000 -- (-703.956) (-706.434) [-716.503] (-703.625) * [-701.296] (-706.630) (-705.924) (-710.312) -- 0:01:05
      299500 -- (-710.658) [-701.279] (-701.788) (-705.829) * (-709.289) [-707.081] (-710.782) (-705.138) -- 0:01:05
      300000 -- (-710.493) (-704.038) (-709.975) [-707.135] * (-710.081) (-707.401) [-703.556] (-707.646) -- 0:01:05

      Average standard deviation of split frequencies: 0.006271

      300500 -- [-705.800] (-712.374) (-711.449) (-705.481) * (-705.389) [-703.795] (-709.441) (-709.106) -- 0:01:05
      301000 -- (-701.685) [-702.613] (-708.752) (-705.601) * (-706.409) [-702.369] (-713.252) (-708.266) -- 0:01:05
      301500 -- (-704.492) [-708.658] (-706.198) (-703.926) * [-701.991] (-711.508) (-708.477) (-706.863) -- 0:01:04
      302000 -- (-704.190) (-710.554) [-706.376] (-704.396) * (-707.337) (-708.094) (-709.535) [-703.837] -- 0:01:04
      302500 -- (-712.345) (-708.296) (-710.152) [-705.413] * (-702.206) (-709.554) [-708.079] (-709.686) -- 0:01:04
      303000 -- (-699.895) [-702.835] (-709.784) (-706.033) * (-704.575) (-712.220) [-709.606] (-704.571) -- 0:01:04
      303500 -- (-702.195) (-707.689) (-707.272) [-703.373] * (-707.503) (-709.192) (-705.424) [-705.725] -- 0:01:04
      304000 -- (-702.319) [-705.967] (-705.303) (-701.977) * (-704.731) (-707.323) [-709.081] (-703.556) -- 0:01:06
      304500 -- (-707.772) (-711.478) (-703.034) [-705.399] * [-705.614] (-710.603) (-703.925) (-703.152) -- 0:01:06
      305000 -- (-710.464) [-703.375] (-701.372) (-703.135) * (-706.013) (-712.780) [-706.891] (-703.415) -- 0:01:06

      Average standard deviation of split frequencies: 0.004108

      305500 -- (-706.992) (-708.356) (-705.358) [-703.327] * (-704.155) (-703.012) (-702.093) [-707.137] -- 0:01:05
      306000 -- (-704.413) (-709.496) [-701.695] (-700.555) * [-705.547] (-715.988) (-707.255) (-702.528) -- 0:01:05
      306500 -- (-705.544) (-707.015) (-703.637) [-700.973] * (-702.076) (-722.346) [-710.296] (-710.640) -- 0:01:05
      307000 -- [-703.842] (-709.955) (-704.889) (-707.786) * (-711.028) (-709.012) (-704.106) [-707.063] -- 0:01:05
      307500 -- (-713.592) [-712.191] (-702.879) (-709.924) * (-706.308) (-710.874) [-708.648] (-707.901) -- 0:01:05
      308000 -- [-703.476] (-704.399) (-709.182) (-707.229) * (-707.118) [-712.161] (-707.444) (-708.205) -- 0:01:05
      308500 -- (-706.159) (-709.716) [-706.071] (-712.336) * (-707.700) (-707.305) (-704.520) [-708.123] -- 0:01:05
      309000 -- (-706.386) (-709.063) (-709.967) [-704.891] * (-707.153) (-711.518) (-706.656) [-705.834] -- 0:01:04
      309500 -- [-701.324] (-717.402) (-709.189) (-704.091) * (-710.888) (-715.301) [-707.859] (-705.673) -- 0:01:04
      310000 -- (-711.322) (-710.359) (-710.331) [-704.124] * (-711.743) (-700.768) [-702.757] (-704.416) -- 0:01:04

      Average standard deviation of split frequencies: 0.005058

      310500 -- (-710.156) (-715.606) (-704.503) [-699.831] * (-717.771) [-708.278] (-706.686) (-707.783) -- 0:01:04
      311000 -- (-704.227) [-704.526] (-704.332) (-704.396) * [-707.056] (-709.580) (-706.795) (-707.497) -- 0:01:04
      311500 -- [-704.211] (-710.096) (-711.880) (-703.219) * [-707.217] (-705.645) (-706.694) (-709.230) -- 0:01:04
      312000 -- [-705.131] (-709.053) (-715.161) (-703.727) * (-712.108) (-703.725) (-711.349) [-700.947] -- 0:01:03
      312500 -- (-706.783) (-710.676) (-705.470) [-711.886] * (-714.661) (-707.344) (-703.480) [-707.198] -- 0:01:03
      313000 -- (-706.537) (-702.692) [-703.786] (-711.491) * (-702.840) [-702.865] (-701.598) (-706.047) -- 0:01:03
      313500 -- (-704.536) [-702.574] (-703.614) (-717.405) * (-707.964) [-702.811] (-703.594) (-708.372) -- 0:01:03
      314000 -- (-705.045) (-705.742) (-700.562) [-701.104] * (-709.129) (-700.677) [-706.774] (-706.830) -- 0:01:03
      314500 -- [-707.344] (-704.019) (-706.760) (-701.047) * (-700.937) [-705.119] (-705.704) (-707.782) -- 0:01:03
      315000 -- [-704.178] (-702.134) (-702.927) (-713.702) * (-705.530) (-702.310) (-706.847) [-703.230] -- 0:01:05

      Average standard deviation of split frequencies: 0.008951

      315500 -- [-705.504] (-715.486) (-713.483) (-701.279) * (-700.211) [-703.285] (-708.516) (-704.151) -- 0:01:05
      316000 -- (-704.938) [-705.719] (-703.480) (-707.207) * (-706.408) (-707.997) (-704.875) [-710.917] -- 0:01:04
      316500 -- (-710.917) [-706.092] (-701.617) (-704.442) * (-713.670) (-709.627) (-706.185) [-707.022] -- 0:01:04
      317000 -- (-709.316) [-707.432] (-710.949) (-712.274) * (-711.531) (-703.270) (-707.371) [-707.178] -- 0:01:04
      317500 -- [-708.474] (-709.229) (-703.819) (-709.046) * (-711.917) (-702.653) (-705.672) [-709.307] -- 0:01:04
      318000 -- (-711.954) (-706.507) (-702.886) [-703.295] * (-703.840) [-703.866] (-704.452) (-713.995) -- 0:01:04
      318500 -- (-708.252) [-701.677] (-704.252) (-704.321) * (-703.617) (-708.068) (-700.835) [-703.028] -- 0:01:04
      319000 -- (-707.907) [-704.133] (-708.071) (-705.037) * [-707.480] (-701.135) (-705.635) (-705.968) -- 0:01:04
      319500 -- (-709.860) (-704.248) (-704.478) [-704.128] * (-704.075) (-706.010) (-708.627) [-705.427] -- 0:01:03
      320000 -- (-709.109) (-703.741) (-700.746) [-710.781] * (-712.004) [-705.027] (-700.891) (-712.159) -- 0:01:03

      Average standard deviation of split frequencies: 0.009801

      320500 -- (-706.955) (-708.953) [-702.211] (-708.908) * (-705.175) (-705.822) [-705.230] (-708.531) -- 0:01:03
      321000 -- [-700.578] (-710.002) (-699.661) (-705.684) * (-704.669) (-709.274) (-706.844) [-703.245] -- 0:01:03
      321500 -- (-703.760) (-705.395) (-709.262) [-703.488] * (-703.795) (-708.501) [-704.224] (-702.451) -- 0:01:03
      322000 -- (-705.117) (-711.051) (-704.662) [-704.406] * (-705.353) (-708.690) [-703.367] (-706.554) -- 0:01:03
      322500 -- (-705.026) (-713.140) (-703.631) [-704.683] * (-704.930) (-711.776) [-706.992] (-709.889) -- 0:01:03
      323000 -- (-704.991) [-702.853] (-699.064) (-709.359) * (-708.979) (-711.416) [-703.533] (-707.858) -- 0:01:02
      323500 -- (-703.085) [-703.936] (-705.398) (-711.922) * (-703.114) [-704.111] (-706.310) (-706.137) -- 0:01:02
      324000 -- (-704.711) (-706.437) (-704.245) [-705.615] * (-707.356) (-702.877) [-705.262] (-705.781) -- 0:01:02
      324500 -- (-699.403) (-703.487) [-703.264] (-699.952) * (-702.774) [-701.710] (-701.959) (-706.762) -- 0:01:02
      325000 -- (-708.243) (-704.065) (-703.213) [-701.089] * (-707.740) (-702.884) [-702.802] (-705.555) -- 0:01:02

      Average standard deviation of split frequencies: 0.011568

      325500 -- (-709.362) [-702.788] (-702.662) (-701.009) * (-708.698) (-707.068) [-703.393] (-705.243) -- 0:01:04
      326000 -- (-708.341) (-703.208) [-707.842] (-704.060) * (-708.020) (-707.179) [-707.628] (-707.687) -- 0:01:04
      326500 -- [-701.318] (-705.035) (-712.010) (-705.686) * (-705.347) [-705.652] (-706.335) (-704.264) -- 0:01:03
      327000 -- (-705.019) (-705.005) (-711.295) [-704.479] * (-706.239) (-705.711) (-703.642) [-702.195] -- 0:01:03
      327500 -- (-705.965) (-704.999) (-704.193) [-707.326] * (-705.669) [-710.779] (-701.108) (-700.938) -- 0:01:03
      328000 -- (-711.051) (-706.194) (-707.082) [-705.717] * (-708.880) (-703.715) (-703.230) [-702.060] -- 0:01:03
      328500 -- (-707.986) (-705.281) (-703.885) [-713.830] * (-709.854) (-705.246) [-704.056] (-697.959) -- 0:01:03
      329000 -- (-703.886) (-711.720) [-702.084] (-702.612) * (-705.973) (-706.481) (-703.672) [-703.495] -- 0:01:03
      329500 -- [-705.527] (-711.732) (-707.671) (-706.664) * [-705.322] (-706.724) (-703.600) (-707.925) -- 0:01:03
      330000 -- [-703.912] (-706.506) (-706.542) (-706.497) * (-700.556) (-706.139) (-716.398) [-702.173] -- 0:01:02

      Average standard deviation of split frequencies: 0.012355

      330500 -- [-706.789] (-706.392) (-710.008) (-704.880) * (-710.485) [-705.251] (-708.020) (-704.428) -- 0:01:02
      331000 -- (-708.724) (-706.605) (-710.814) [-703.547] * (-706.600) (-704.871) [-706.824] (-703.034) -- 0:01:02
      331500 -- (-701.917) [-704.668] (-699.128) (-703.267) * (-705.862) (-706.197) (-702.280) [-700.811] -- 0:01:02
      332000 -- (-707.677) (-705.527) [-704.074] (-706.663) * (-705.488) [-705.467] (-707.695) (-709.599) -- 0:01:02
      332500 -- (-709.824) (-702.373) (-705.505) [-707.538] * [-702.874] (-707.146) (-703.865) (-711.506) -- 0:01:02
      333000 -- [-701.337] (-706.168) (-712.302) (-708.704) * (-704.440) (-702.613) [-703.773] (-710.252) -- 0:01:02
      333500 -- [-707.232] (-705.493) (-705.476) (-700.815) * [-704.685] (-702.725) (-712.121) (-708.430) -- 0:01:01
      334000 -- (-711.254) (-714.770) (-704.336) [-707.711] * (-709.043) (-705.536) [-702.213] (-709.294) -- 0:01:01
      334500 -- (-713.797) [-703.950] (-708.237) (-703.287) * (-714.087) (-706.353) (-708.543) [-707.401] -- 0:01:01
      335000 -- (-711.977) (-713.915) [-715.541] (-705.753) * (-701.859) [-706.199] (-708.089) (-706.738) -- 0:01:01

      Average standard deviation of split frequencies: 0.014965

      335500 -- [-703.878] (-713.490) (-713.841) (-700.970) * (-702.503) (-706.043) (-709.933) [-705.449] -- 0:01:01
      336000 -- (-715.200) (-713.635) (-710.536) [-705.124] * (-705.846) (-710.639) [-708.665] (-702.401) -- 0:01:03
      336500 -- (-705.235) (-704.852) (-709.076) [-705.609] * (-701.223) (-708.730) (-707.903) [-707.356] -- 0:01:03
      337000 -- [-703.965] (-710.052) (-705.274) (-704.769) * (-702.118) [-705.012] (-711.671) (-706.529) -- 0:01:02
      337500 -- (-705.379) (-705.558) (-706.625) [-705.731] * (-705.827) (-703.875) (-706.029) [-703.364] -- 0:01:02
      338000 -- [-709.783] (-704.069) (-701.705) (-711.965) * [-708.706] (-709.662) (-701.696) (-701.260) -- 0:01:02
      338500 -- (-713.103) (-710.572) (-703.449) [-711.752] * (-705.620) (-712.389) [-702.740] (-709.626) -- 0:01:02
      339000 -- [-712.050] (-702.654) (-712.827) (-710.498) * (-705.460) (-710.402) [-707.296] (-709.291) -- 0:01:02
      339500 -- [-710.739] (-706.059) (-703.895) (-706.673) * (-713.615) (-716.353) (-705.840) [-709.112] -- 0:01:02
      340000 -- (-713.564) [-703.194] (-709.080) (-705.560) * (-704.570) (-707.900) (-709.528) [-705.798] -- 0:01:02

      Average standard deviation of split frequencies: 0.013838

      340500 -- (-708.770) (-709.870) (-703.803) [-705.224] * (-705.488) [-710.995] (-705.535) (-705.860) -- 0:01:01
      341000 -- (-710.173) (-705.761) (-704.664) [-709.077] * [-709.384] (-704.338) (-707.886) (-704.235) -- 0:01:01
      341500 -- (-706.980) (-707.665) (-700.219) [-709.279] * (-708.649) [-706.480] (-713.191) (-708.358) -- 0:01:01
      342000 -- (-705.425) (-706.560) (-703.296) [-705.403] * (-703.865) [-704.494] (-708.637) (-703.270) -- 0:01:01
      342500 -- (-707.076) [-702.754] (-702.434) (-704.351) * [-702.200] (-706.915) (-709.515) (-704.539) -- 0:01:01
      343000 -- [-702.770] (-701.080) (-703.553) (-710.357) * (-707.431) (-710.110) [-713.698] (-707.132) -- 0:01:01
      343500 -- (-705.405) [-701.524] (-707.672) (-703.897) * (-713.955) (-710.600) (-707.542) [-708.567] -- 0:01:01
      344000 -- (-702.851) [-702.928] (-708.941) (-712.122) * (-706.531) [-704.322] (-705.014) (-713.795) -- 0:01:01
      344500 -- [-708.925] (-703.145) (-700.946) (-702.681) * (-717.742) (-703.083) [-703.952] (-708.240) -- 0:01:00
      345000 -- (-705.957) (-708.623) [-702.358] (-704.850) * [-708.317] (-699.680) (-707.169) (-717.013) -- 0:01:00

      Average standard deviation of split frequencies: 0.016349

      345500 -- [-705.229] (-701.942) (-706.390) (-704.946) * [-704.733] (-705.109) (-711.121) (-712.159) -- 0:01:02
      346000 -- (-710.948) [-706.386] (-705.690) (-707.232) * [-705.677] (-703.742) (-714.260) (-715.906) -- 0:01:02
      346500 -- (-701.921) (-707.548) [-703.777] (-709.132) * (-706.294) [-706.069] (-706.488) (-707.943) -- 0:01:02
      347000 -- (-700.028) (-708.277) (-702.173) [-705.495] * [-702.890] (-713.940) (-708.906) (-706.755) -- 0:01:02
      347500 -- [-700.944] (-709.534) (-700.689) (-708.683) * (-704.044) (-704.436) (-704.863) [-701.727] -- 0:01:01
      348000 -- (-701.991) [-701.341] (-704.213) (-706.614) * (-706.417) (-706.048) (-709.075) [-707.507] -- 0:01:01
      348500 -- [-703.418] (-707.511) (-709.067) (-703.616) * (-705.191) (-706.900) [-709.784] (-701.309) -- 0:01:01
      349000 -- (-708.400) (-703.556) (-704.141) [-706.025] * (-704.558) (-705.636) (-704.197) [-703.110] -- 0:01:01
      349500 -- (-706.470) (-710.131) [-702.337] (-706.231) * [-705.562] (-706.441) (-704.803) (-702.344) -- 0:01:01
      350000 -- (-710.250) [-705.965] (-705.431) (-703.974) * (-708.863) (-705.670) [-700.247] (-706.411) -- 0:01:01

      Average standard deviation of split frequencies: 0.017028

      350500 -- (-703.356) (-707.181) (-706.526) [-701.953] * (-703.386) (-705.363) [-705.026] (-713.677) -- 0:01:01
      351000 -- [-709.999] (-711.489) (-700.900) (-701.001) * [-702.623] (-704.032) (-707.136) (-708.100) -- 0:01:01
      351500 -- [-702.508] (-703.247) (-705.264) (-702.987) * (-702.893) [-705.539] (-705.856) (-707.580) -- 0:01:00
      352000 -- (-702.611) (-711.224) [-702.412] (-702.173) * (-704.068) (-710.934) [-702.405] (-714.609) -- 0:01:00
      352500 -- (-706.520) (-706.780) (-701.785) [-702.698] * [-702.642] (-705.658) (-702.997) (-708.969) -- 0:01:00
      353000 -- [-705.061] (-704.512) (-704.297) (-703.694) * (-705.062) (-708.754) [-708.044] (-713.753) -- 0:01:00
      353500 -- (-701.381) (-707.434) [-705.425] (-703.147) * [-703.832] (-705.516) (-701.831) (-711.524) -- 0:01:00
      354000 -- (-701.966) (-706.173) [-700.608] (-704.181) * (-705.932) [-699.739] (-706.665) (-714.679) -- 0:01:00
      354500 -- (-705.031) (-703.951) (-709.498) [-701.325] * (-712.093) [-701.942] (-715.021) (-710.588) -- 0:01:00
      355000 -- (-710.309) (-707.241) (-711.595) [-701.722] * (-703.825) (-703.830) (-709.707) [-706.778] -- 0:00:59

      Average standard deviation of split frequencies: 0.017656

      355500 -- (-708.702) [-706.285] (-706.139) (-700.782) * (-715.132) [-705.048] (-704.795) (-702.796) -- 0:00:59
      356000 -- (-701.423) (-707.907) (-704.630) [-704.448] * (-711.440) (-702.321) (-700.614) [-704.384] -- 0:01:01
      356500 -- (-706.008) (-710.442) [-702.090] (-710.511) * (-701.664) (-703.091) (-702.896) [-698.828] -- 0:01:01
      357000 -- (-711.293) (-708.418) (-703.646) [-706.440] * (-707.993) [-707.071] (-705.679) (-702.095) -- 0:01:01
      357500 -- (-707.457) (-705.095) [-711.726] (-708.176) * (-705.713) (-705.353) (-705.434) [-703.361] -- 0:01:01
      358000 -- [-701.701] (-709.599) (-707.968) (-704.653) * (-709.191) [-705.390] (-703.575) (-704.648) -- 0:01:00
      358500 -- (-707.701) (-705.386) (-705.053) [-705.538] * (-704.944) (-706.247) [-706.035] (-701.226) -- 0:01:00
      359000 -- (-703.545) (-701.941) [-706.434] (-708.703) * (-704.196) (-704.591) (-704.220) [-706.408] -- 0:01:00
      359500 -- (-703.761) [-703.542] (-701.463) (-703.920) * [-699.390] (-703.190) (-704.474) (-706.334) -- 0:01:00
      360000 -- (-703.413) [-701.935] (-704.575) (-705.659) * [-708.988] (-706.019) (-705.873) (-702.359) -- 0:01:00

      Average standard deviation of split frequencies: 0.019170

      360500 -- (-707.572) [-699.890] (-705.223) (-706.285) * (-702.909) (-708.076) [-703.165] (-713.518) -- 0:01:00
      361000 -- (-701.561) (-704.763) (-702.313) [-705.524] * (-704.728) [-702.972] (-710.600) (-705.769) -- 0:01:00
      361500 -- [-704.540] (-703.130) (-707.849) (-710.994) * [-702.735] (-702.384) (-701.895) (-706.760) -- 0:01:00
      362000 -- (-709.140) (-705.855) (-713.324) [-709.296] * (-714.108) (-702.847) [-700.331] (-709.638) -- 0:00:59
      362500 -- (-706.944) [-708.059] (-708.631) (-706.244) * (-708.727) (-706.872) (-702.756) [-707.540] -- 0:00:59
      363000 -- (-706.593) [-702.596] (-701.950) (-707.714) * (-710.953) [-702.702] (-706.902) (-703.131) -- 0:00:59
      363500 -- (-709.693) [-704.078] (-700.363) (-706.396) * (-706.403) (-705.378) (-703.811) [-705.500] -- 0:00:59
      364000 -- [-703.120] (-706.579) (-711.730) (-712.281) * [-706.680] (-706.543) (-711.072) (-709.226) -- 0:00:59
      364500 -- (-705.187) [-704.919] (-706.340) (-705.382) * [-704.399] (-706.487) (-703.381) (-707.373) -- 0:00:59
      365000 -- (-704.088) [-707.824] (-703.210) (-704.924) * (-706.709) (-706.011) [-702.336] (-709.791) -- 0:00:59

      Average standard deviation of split frequencies: 0.020608

      365500 -- (-709.438) (-705.750) (-704.686) [-700.395] * (-705.685) [-703.596] (-703.030) (-706.271) -- 0:00:59
      366000 -- (-705.768) (-706.398) [-704.218] (-706.883) * (-703.402) [-709.110] (-709.243) (-706.206) -- 0:00:58
      366500 -- (-708.713) (-706.167) (-708.214) [-713.152] * (-709.826) (-713.851) [-707.666] (-704.343) -- 0:00:58
      367000 -- (-703.576) (-702.952) (-703.473) [-708.280] * (-706.025) (-712.724) (-706.558) [-702.815] -- 0:01:00
      367500 -- (-708.715) [-701.900] (-702.063) (-704.646) * (-702.605) (-710.482) [-703.478] (-706.152) -- 0:01:00
      368000 -- [-711.025] (-707.087) (-708.160) (-704.839) * [-699.930] (-704.966) (-706.273) (-708.804) -- 0:01:00
      368500 -- [-701.799] (-703.889) (-707.796) (-702.944) * (-706.606) [-704.714] (-705.579) (-710.909) -- 0:00:59
      369000 -- (-709.405) [-706.782] (-707.047) (-707.624) * (-705.837) [-703.792] (-706.029) (-709.886) -- 0:00:59
      369500 -- [-704.701] (-705.929) (-707.090) (-706.455) * (-700.560) [-704.501] (-707.759) (-707.175) -- 0:00:59
      370000 -- (-709.284) [-703.287] (-699.384) (-701.362) * [-707.394] (-708.498) (-705.854) (-707.585) -- 0:00:59

      Average standard deviation of split frequencies: 0.020348

      370500 -- (-711.457) (-702.472) [-698.374] (-706.950) * [-710.349] (-707.848) (-699.770) (-713.836) -- 0:00:59
      371000 -- [-708.518] (-702.702) (-705.373) (-704.033) * [-704.862] (-709.337) (-709.525) (-702.089) -- 0:00:59
      371500 -- [-708.037] (-707.641) (-706.739) (-703.937) * [-699.712] (-704.448) (-713.613) (-704.467) -- 0:00:59
      372000 -- (-712.394) [-703.629] (-711.212) (-704.621) * (-709.844) (-704.177) (-707.497) [-702.926] -- 0:00:59
      372500 -- [-707.200] (-698.989) (-705.042) (-706.079) * (-707.884) [-706.525] (-714.499) (-705.614) -- 0:00:58
      373000 -- (-708.109) [-703.350] (-704.476) (-706.229) * (-709.330) (-702.872) (-709.942) [-701.450] -- 0:00:58
      373500 -- (-703.735) (-702.662) (-707.284) [-709.265] * (-701.519) (-708.801) (-705.654) [-705.343] -- 0:00:58
      374000 -- (-715.538) (-705.939) (-707.243) [-704.152] * (-713.556) (-701.253) (-706.015) [-705.312] -- 0:00:58
      374500 -- (-708.590) (-704.992) (-703.621) [-705.456] * (-703.804) (-707.670) [-705.136] (-712.847) -- 0:00:58
      375000 -- (-706.358) (-702.262) [-702.693] (-702.829) * (-702.208) (-713.411) [-704.908] (-703.938) -- 0:00:58

      Average standard deviation of split frequencies: 0.015881

      375500 -- (-703.216) (-704.464) [-705.399] (-703.056) * (-702.587) (-706.005) (-708.764) [-713.497] -- 0:00:58
      376000 -- (-707.040) (-702.351) (-711.232) [-706.141] * [-710.109] (-706.510) (-711.312) (-706.140) -- 0:00:58
      376500 -- (-705.277) (-706.015) [-703.878] (-709.133) * (-705.930) (-711.159) (-706.660) [-704.776] -- 0:00:57
      377000 -- [-700.573] (-703.204) (-706.296) (-705.094) * (-705.825) [-711.300] (-703.439) (-702.162) -- 0:00:57
      377500 -- [-708.312] (-706.985) (-709.785) (-709.337) * (-707.376) (-706.575) (-709.503) [-700.304] -- 0:00:57
      378000 -- (-709.448) (-710.324) (-706.209) [-707.406] * (-707.147) (-710.126) (-702.233) [-702.004] -- 0:00:59
      378500 -- (-711.871) (-704.854) (-701.855) [-713.026] * (-708.147) (-714.028) [-701.488] (-711.258) -- 0:00:59
      379000 -- (-705.933) (-708.461) [-705.701] (-709.754) * (-707.822) (-707.868) [-704.192] (-706.521) -- 0:00:58
      379500 -- [-708.228] (-700.907) (-706.618) (-709.636) * (-705.231) (-702.305) [-705.815] (-711.810) -- 0:00:58
      380000 -- (-710.024) (-708.793) (-706.898) [-704.240] * (-704.426) [-707.663] (-707.779) (-711.566) -- 0:00:58

      Average standard deviation of split frequencies: 0.016512

      380500 -- (-712.168) (-708.907) (-706.363) [-711.136] * [-703.221] (-705.032) (-703.731) (-703.929) -- 0:00:58
      381000 -- (-706.520) [-708.309] (-705.444) (-707.199) * (-706.760) (-710.862) [-705.801] (-705.405) -- 0:00:58
      381500 -- (-709.501) [-709.596] (-708.667) (-706.520) * (-705.918) (-703.496) (-709.543) [-703.593] -- 0:00:58
      382000 -- (-706.117) (-709.890) (-706.252) [-704.578] * (-709.989) (-704.246) [-706.797] (-706.487) -- 0:00:58
      382500 -- [-708.008] (-709.776) (-706.731) (-705.634) * (-706.613) [-704.128] (-705.847) (-702.039) -- 0:00:58
      383000 -- (-704.960) (-705.334) [-704.426] (-702.756) * (-705.611) (-711.790) [-700.938] (-703.173) -- 0:00:57
      383500 -- (-705.021) (-704.265) (-707.298) [-712.083] * (-708.515) (-709.281) (-709.047) [-705.156] -- 0:00:57
      384000 -- (-707.371) (-702.618) [-704.582] (-704.296) * (-705.639) [-710.410] (-710.286) (-706.326) -- 0:00:57
      384500 -- [-702.934] (-706.590) (-703.054) (-708.657) * (-709.684) [-707.419] (-707.929) (-705.956) -- 0:00:57
      385000 -- (-703.637) (-703.074) (-705.329) [-705.450] * (-708.813) (-712.222) (-706.875) [-703.095] -- 0:00:57

      Average standard deviation of split frequencies: 0.015469

      385500 -- (-705.874) (-707.652) (-710.019) [-704.052] * (-710.940) [-707.419] (-710.986) (-702.892) -- 0:00:57
      386000 -- [-705.915] (-703.210) (-705.703) (-706.998) * (-704.089) [-705.362] (-708.937) (-707.015) -- 0:00:57
      386500 -- (-708.982) [-706.412] (-709.239) (-705.884) * (-706.433) (-707.770) [-703.375] (-710.593) -- 0:00:57
      387000 -- (-705.193) [-710.421] (-710.270) (-706.055) * (-707.257) (-713.087) [-704.963] (-704.086) -- 0:00:57
      387500 -- (-702.903) (-704.135) (-704.357) [-712.719] * (-702.002) (-708.591) [-707.783] (-702.847) -- 0:00:56
      388000 -- (-703.323) (-704.202) (-704.562) [-707.374] * [-700.696] (-707.843) (-704.490) (-711.185) -- 0:00:56
      388500 -- (-703.062) [-701.388] (-706.192) (-704.777) * (-706.258) (-706.759) [-703.381] (-703.063) -- 0:00:56
      389000 -- (-710.810) (-704.775) [-704.097] (-709.516) * (-706.263) (-702.199) (-705.615) [-701.257] -- 0:00:58
      389500 -- (-710.765) (-705.634) (-705.372) [-703.814] * (-701.323) [-702.499] (-702.686) (-704.552) -- 0:00:57
      390000 -- (-714.101) [-703.919] (-704.576) (-707.896) * (-713.639) (-703.419) (-702.454) [-703.490] -- 0:00:57

      Average standard deviation of split frequencies: 0.014480

      390500 -- (-715.135) (-708.783) (-705.604) [-702.763] * [-703.481] (-712.626) (-705.314) (-703.456) -- 0:00:57
      391000 -- (-708.825) (-704.125) [-707.418] (-707.678) * (-705.979) (-706.230) (-700.281) [-701.278] -- 0:00:57
      391500 -- (-704.539) (-703.845) (-705.330) [-709.039] * (-708.486) (-709.201) [-702.625] (-710.523) -- 0:00:57
      392000 -- [-702.378] (-701.147) (-709.246) (-704.939) * (-706.188) [-705.225] (-703.313) (-703.981) -- 0:00:57
      392500 -- (-706.618) (-708.705) [-709.335] (-705.899) * (-704.241) (-713.624) (-709.083) [-706.067] -- 0:00:57
      393000 -- [-705.993] (-706.448) (-704.414) (-703.324) * [-705.227] (-709.971) (-711.227) (-707.125) -- 0:00:57
      393500 -- (-705.405) (-702.806) [-707.494] (-711.120) * (-701.498) (-700.569) (-707.393) [-705.262] -- 0:00:57
      394000 -- (-705.564) (-701.349) (-713.618) [-703.361] * [-703.781] (-704.371) (-700.460) (-707.883) -- 0:00:56
      394500 -- (-707.626) (-701.230) [-706.244] (-703.859) * [-703.483] (-705.173) (-706.153) (-706.840) -- 0:00:56
      395000 -- [-707.143] (-706.655) (-701.711) (-703.379) * [-709.561] (-702.983) (-703.223) (-713.965) -- 0:00:56

      Average standard deviation of split frequencies: 0.016666

      395500 -- (-712.758) (-711.473) (-705.013) [-699.678] * (-705.512) (-703.715) (-704.512) [-704.515] -- 0:00:56
      396000 -- [-704.682] (-709.258) (-704.703) (-704.011) * (-709.711) (-707.939) (-700.689) [-707.874] -- 0:00:56
      396500 -- (-706.944) [-701.870] (-703.877) (-701.970) * [-704.174] (-706.563) (-709.044) (-709.556) -- 0:00:56
      397000 -- (-713.370) (-706.522) (-707.495) [-700.321] * (-713.889) (-710.563) [-706.953] (-706.011) -- 0:00:56
      397500 -- (-705.925) (-702.741) [-703.908] (-703.086) * (-708.498) (-705.981) (-706.058) [-711.500] -- 0:00:56
      398000 -- (-716.526) (-704.439) (-703.849) [-704.885] * [-706.887] (-709.682) (-707.976) (-708.243) -- 0:00:55
      398500 -- [-710.523] (-707.572) (-708.284) (-705.725) * (-709.716) [-706.251] (-712.661) (-708.020) -- 0:00:55
      399000 -- (-704.251) (-706.166) [-705.855] (-704.194) * (-704.379) (-709.024) [-706.109] (-713.110) -- 0:00:55
      399500 -- (-704.042) (-706.874) (-706.251) [-706.826] * (-707.645) [-704.470] (-706.727) (-712.079) -- 0:00:57
      400000 -- [-708.681] (-711.317) (-704.162) (-707.977) * (-705.670) (-702.325) (-707.285) [-709.829] -- 0:00:57

      Average standard deviation of split frequencies: 0.016472

      400500 -- [-702.629] (-708.947) (-705.621) (-711.081) * (-712.510) [-707.130] (-710.502) (-704.385) -- 0:00:56
      401000 -- [-702.752] (-708.600) (-701.739) (-705.736) * (-700.719) (-709.079) (-702.460) [-705.001] -- 0:00:56
      401500 -- (-705.483) [-705.670] (-701.093) (-702.050) * [-705.389] (-712.505) (-703.258) (-708.205) -- 0:00:56
      402000 -- (-707.949) [-712.919] (-705.578) (-704.342) * (-704.204) (-704.885) (-710.693) [-712.631] -- 0:00:56
      402500 -- [-701.998] (-707.526) (-705.261) (-705.101) * (-709.600) (-713.830) [-706.679] (-704.658) -- 0:00:56
      403000 -- (-701.277) (-706.709) (-710.906) [-702.929] * (-706.060) (-707.802) (-700.673) [-704.131] -- 0:00:56
      403500 -- (-702.511) (-703.205) [-708.884] (-704.341) * (-707.169) (-706.567) (-706.235) [-705.327] -- 0:00:56
      404000 -- (-701.984) [-713.679] (-703.745) (-703.145) * [-703.409] (-709.483) (-710.249) (-708.468) -- 0:00:56
      404500 -- [-703.083] (-700.334) (-708.222) (-705.389) * (-701.251) (-704.817) [-700.776] (-707.375) -- 0:00:55
      405000 -- (-703.563) (-702.854) (-713.180) [-702.127] * (-701.401) [-706.457] (-709.217) (-711.551) -- 0:00:55

      Average standard deviation of split frequencies: 0.013933

      405500 -- (-705.274) (-705.558) (-703.484) [-712.266] * (-703.669) (-709.656) (-705.465) [-703.704] -- 0:00:55
      406000 -- [-704.640] (-706.197) (-704.125) (-714.285) * (-705.704) (-710.030) [-705.705] (-713.527) -- 0:00:55
      406500 -- (-708.409) (-708.049) (-708.184) [-708.220] * (-715.490) (-711.261) [-702.788] (-705.428) -- 0:00:55
      407000 -- (-705.813) (-708.577) (-710.717) [-705.139] * (-710.036) (-707.087) [-705.343] (-706.794) -- 0:00:55
      407500 -- [-708.292] (-706.683) (-706.074) (-706.458) * [-711.014] (-703.374) (-709.673) (-701.746) -- 0:00:55
      408000 -- (-706.511) (-710.106) (-707.829) [-709.490] * (-705.947) [-704.976] (-710.796) (-705.892) -- 0:00:55
      408500 -- (-707.480) (-704.596) [-705.304] (-704.013) * (-703.819) (-704.707) (-713.509) [-705.100] -- 0:00:55
      409000 -- [-701.233] (-708.685) (-706.627) (-704.970) * (-703.453) [-705.814] (-702.489) (-709.197) -- 0:00:54
      409500 -- (-707.497) [-701.687] (-705.223) (-703.052) * [-705.984] (-701.213) (-705.655) (-706.481) -- 0:00:54
      410000 -- [-706.083] (-702.291) (-705.780) (-700.494) * (-706.750) [-702.204] (-712.515) (-704.527) -- 0:00:56

      Average standard deviation of split frequencies: 0.011479

      410500 -- (-703.064) (-705.573) [-707.514] (-702.993) * (-705.130) (-707.713) [-707.029] (-711.760) -- 0:00:56
      411000 -- (-704.641) [-699.715] (-711.371) (-704.154) * [-702.933] (-703.765) (-705.718) (-712.253) -- 0:00:55
      411500 -- (-707.080) [-702.728] (-702.865) (-709.896) * (-708.914) (-705.939) [-705.747] (-709.599) -- 0:00:55
      412000 -- (-715.665) (-708.109) [-706.094] (-703.761) * (-703.475) [-705.801] (-706.680) (-710.707) -- 0:00:55
      412500 -- (-706.026) [-706.859] (-708.991) (-707.595) * (-706.631) (-709.454) (-703.198) [-707.008] -- 0:00:55
      413000 -- (-710.317) [-704.558] (-706.048) (-703.310) * (-714.354) (-711.307) (-709.857) [-708.616] -- 0:00:55
      413500 -- (-706.971) [-701.917] (-707.995) (-706.530) * [-703.738] (-705.027) (-705.714) (-703.227) -- 0:00:55
      414000 -- (-710.114) (-705.447) (-705.270) [-706.611] * (-705.225) [-702.118] (-702.889) (-707.001) -- 0:00:55
      414500 -- (-710.314) [-702.805] (-713.364) (-707.636) * (-704.338) (-704.981) [-702.640] (-709.214) -- 0:00:55
      415000 -- (-709.088) [-705.982] (-705.098) (-711.340) * (-701.142) (-712.370) [-702.808] (-713.021) -- 0:00:54

      Average standard deviation of split frequencies: 0.012087

      415500 -- [-704.609] (-705.998) (-706.230) (-710.236) * [-704.161] (-703.202) (-715.284) (-710.620) -- 0:00:54
      416000 -- [-706.913] (-711.634) (-708.194) (-704.331) * (-707.338) (-707.089) [-706.966] (-705.925) -- 0:00:54
      416500 -- (-707.413) (-712.317) (-703.367) [-704.699] * (-703.920) [-706.741] (-708.543) (-699.468) -- 0:00:54
      417000 -- (-704.381) [-710.401] (-701.081) (-702.777) * (-706.095) (-704.157) [-707.448] (-709.291) -- 0:00:54
      417500 -- (-706.266) (-711.393) (-708.457) [-705.091] * (-704.264) (-710.967) (-712.079) [-707.992] -- 0:00:54
      418000 -- [-704.117] (-709.655) (-704.560) (-705.009) * (-703.980) (-707.921) [-704.077] (-706.185) -- 0:00:54
      418500 -- [-710.893] (-702.898) (-707.012) (-710.912) * [-708.153] (-708.375) (-710.132) (-705.986) -- 0:00:54
      419000 -- (-709.754) (-706.847) (-707.328) [-703.374] * (-704.606) [-704.392] (-707.148) (-705.474) -- 0:00:54
      419500 -- (-709.111) (-711.706) [-703.462] (-702.411) * (-703.202) (-706.870) (-709.573) [-704.934] -- 0:00:53
      420000 -- [-704.180] (-708.496) (-710.733) (-704.199) * (-706.313) (-710.191) [-702.501] (-705.743) -- 0:00:53

      Average standard deviation of split frequencies: 0.013447

      420500 -- (-703.670) (-712.755) (-703.530) [-706.251] * (-707.592) (-710.197) (-711.021) [-712.680] -- 0:00:53
      421000 -- (-708.516) (-705.549) (-704.975) [-709.102] * (-704.540) (-703.181) [-702.824] (-716.145) -- 0:00:55
      421500 -- (-710.175) (-716.176) [-704.305] (-703.984) * (-707.783) (-710.059) [-705.722] (-720.015) -- 0:00:54
      422000 -- (-703.312) [-708.735] (-703.182) (-704.683) * (-702.390) (-707.632) [-711.112] (-709.882) -- 0:00:54
      422500 -- [-703.074] (-704.279) (-701.701) (-709.545) * (-710.719) (-701.839) [-708.953] (-707.425) -- 0:00:54
      423000 -- [-700.880] (-702.237) (-703.640) (-705.701) * (-712.364) [-701.746] (-713.068) (-706.567) -- 0:00:54
      423500 -- [-703.669] (-704.279) (-709.843) (-706.397) * [-704.916] (-705.932) (-701.728) (-703.872) -- 0:00:54
      424000 -- (-705.278) (-708.367) [-704.959] (-704.583) * (-716.227) (-707.674) [-701.592] (-705.188) -- 0:00:54
      424500 -- (-705.376) (-703.617) (-709.355) [-705.429] * (-708.758) (-705.371) [-705.034] (-709.055) -- 0:00:54
      425000 -- (-709.354) [-706.044] (-702.893) (-700.200) * (-706.866) (-704.827) [-706.157] (-709.514) -- 0:00:54

      Average standard deviation of split frequencies: 0.013279

      425500 -- (-701.886) (-703.626) [-699.929] (-703.675) * [-706.039] (-705.814) (-712.299) (-705.216) -- 0:00:54
      426000 -- (-703.528) (-706.515) (-702.297) [-707.953] * (-712.093) [-703.329] (-710.785) (-710.304) -- 0:00:53
      426500 -- [-708.927] (-704.834) (-707.590) (-711.545) * (-706.304) (-707.315) (-712.603) [-702.686] -- 0:00:53
      427000 -- [-708.098] (-706.049) (-710.367) (-705.399) * [-701.906] (-704.003) (-707.309) (-702.874) -- 0:00:53
      427500 -- [-703.692] (-705.552) (-707.321) (-702.223) * [-710.629] (-706.959) (-706.585) (-709.623) -- 0:00:53
      428000 -- (-704.597) [-702.149] (-708.847) (-708.863) * (-708.355) [-706.328] (-709.583) (-704.650) -- 0:00:53
      428500 -- [-700.931] (-703.587) (-714.879) (-701.590) * (-713.838) [-707.291] (-701.286) (-706.311) -- 0:00:53
      429000 -- (-707.359) (-705.553) (-702.720) [-705.066] * [-711.550] (-705.770) (-706.334) (-706.319) -- 0:00:53
      429500 -- (-706.184) [-707.864] (-701.126) (-707.410) * [-710.202] (-709.917) (-710.545) (-709.034) -- 0:00:53
      430000 -- [-700.998] (-707.539) (-707.917) (-704.702) * (-714.835) (-701.267) (-702.232) [-702.824] -- 0:00:53

      Average standard deviation of split frequencies: 0.014595

      430500 -- (-704.573) (-707.160) [-711.192] (-709.726) * (-713.138) [-705.651] (-714.319) (-703.388) -- 0:00:52
      431000 -- (-710.825) [-707.003] (-711.186) (-705.115) * (-708.257) (-711.472) [-706.332] (-707.378) -- 0:00:52
      431500 -- (-707.569) (-702.110) (-708.071) [-701.065] * (-709.947) [-706.205] (-704.194) (-701.483) -- 0:00:52
      432000 -- (-703.165) (-706.474) [-709.781] (-712.470) * (-709.603) [-703.888] (-703.250) (-705.553) -- 0:00:53
      432500 -- (-713.664) (-704.825) [-704.838] (-708.524) * (-710.676) (-710.417) (-711.244) [-703.054] -- 0:00:53
      433000 -- (-709.351) (-704.384) (-708.497) [-698.969] * (-709.663) [-706.531] (-707.748) (-707.683) -- 0:00:53
      433500 -- (-707.737) [-704.651] (-710.557) (-705.467) * [-713.800] (-712.020) (-704.139) (-707.505) -- 0:00:53
      434000 -- (-705.175) (-707.953) [-704.288] (-705.382) * (-711.070) (-707.913) (-703.095) [-705.994] -- 0:00:53
      434500 -- [-703.497] (-702.895) (-702.786) (-710.618) * [-718.043] (-705.212) (-700.381) (-704.562) -- 0:00:53
      435000 -- (-708.335) (-701.831) [-702.061] (-700.984) * (-708.240) (-701.017) (-708.332) [-709.743] -- 0:00:53

      Average standard deviation of split frequencies: 0.015858

      435500 -- (-709.787) [-704.261] (-705.456) (-705.326) * [-704.051] (-709.286) (-705.865) (-703.306) -- 0:00:53
      436000 -- (-711.844) [-702.136] (-704.896) (-702.987) * (-705.317) (-707.331) (-706.772) [-703.985] -- 0:00:53
      436500 -- (-709.291) [-703.616] (-702.816) (-704.744) * (-705.364) (-701.469) [-705.544] (-703.323) -- 0:00:52
      437000 -- (-704.115) (-702.141) [-704.581] (-704.176) * (-708.128) (-706.701) [-713.300] (-705.265) -- 0:00:52
      437500 -- [-706.531] (-701.402) (-702.294) (-700.327) * (-705.973) (-700.819) (-710.387) [-703.968] -- 0:00:52
      438000 -- (-705.118) [-700.304] (-706.990) (-702.346) * (-707.411) (-706.107) (-715.994) [-703.603] -- 0:00:52
      438500 -- (-702.414) (-699.502) [-701.710] (-705.745) * (-710.065) (-704.812) (-711.871) [-704.122] -- 0:00:52
      439000 -- [-705.801] (-701.806) (-702.370) (-708.991) * (-702.625) (-708.075) (-708.194) [-703.893] -- 0:00:52
      439500 -- (-704.270) (-705.341) [-700.181] (-710.660) * (-700.746) (-706.189) [-704.136] (-711.441) -- 0:00:52
      440000 -- (-709.996) (-702.188) (-703.764) [-703.797] * (-705.421) (-707.235) (-707.266) [-708.144] -- 0:00:52

      Average standard deviation of split frequencies: 0.017116

      440500 -- (-708.567) [-705.603] (-708.435) (-703.637) * (-704.449) (-704.725) [-704.409] (-710.853) -- 0:00:52
      441000 -- (-702.180) [-703.032] (-705.057) (-711.055) * (-704.185) (-706.847) (-706.974) [-711.150] -- 0:00:51
      441500 -- (-703.342) [-706.669] (-705.814) (-710.119) * [-704.785] (-704.735) (-711.644) (-711.397) -- 0:00:51
      442000 -- (-704.041) (-707.025) (-707.610) [-703.759] * (-705.016) [-706.279] (-710.917) (-709.688) -- 0:00:51
      442500 -- (-703.489) (-711.694) (-706.456) [-705.062] * (-717.181) [-710.503] (-706.458) (-702.664) -- 0:00:52
      443000 -- [-703.705] (-701.805) (-702.268) (-705.965) * (-707.643) (-706.835) (-707.292) [-704.060] -- 0:00:52
      443500 -- (-709.057) (-707.537) (-703.046) [-705.468] * (-711.015) (-706.583) [-707.345] (-700.228) -- 0:00:52
      444000 -- (-712.542) (-706.879) [-703.048] (-702.641) * [-706.504] (-711.605) (-706.186) (-704.253) -- 0:00:52
      444500 -- (-708.198) (-709.124) [-706.013] (-707.451) * (-701.991) (-703.570) (-706.001) [-704.266] -- 0:00:52
      445000 -- [-703.216] (-708.828) (-703.013) (-707.041) * (-712.002) (-701.619) [-705.233] (-715.915) -- 0:00:52

      Average standard deviation of split frequencies: 0.017616

      445500 -- [-706.032] (-709.844) (-701.476) (-701.533) * (-706.329) (-704.848) (-706.041) [-707.358] -- 0:00:52
      446000 -- (-707.718) (-704.186) [-703.191] (-707.450) * (-712.506) [-709.230] (-709.266) (-702.024) -- 0:00:52
      446500 -- [-703.417] (-704.494) (-702.344) (-711.705) * [-705.442] (-707.379) (-711.128) (-704.067) -- 0:00:52
      447000 -- (-708.713) (-707.947) (-705.508) [-704.659] * [-703.698] (-714.554) (-706.527) (-705.245) -- 0:00:51
      447500 -- (-702.883) [-706.757] (-701.443) (-707.678) * (-702.704) (-718.560) (-707.181) [-703.622] -- 0:00:51
      448000 -- (-705.841) [-700.890] (-703.871) (-707.804) * (-704.239) [-712.054] (-710.968) (-710.919) -- 0:00:51
      448500 -- (-702.630) (-707.490) [-704.367] (-704.017) * (-701.164) (-706.107) [-703.927] (-712.742) -- 0:00:51
      449000 -- [-704.690] (-706.709) (-715.549) (-704.004) * (-709.485) [-703.478] (-705.225) (-707.604) -- 0:00:51
      449500 -- (-705.466) (-703.594) [-703.931] (-706.872) * (-710.417) [-704.135] (-706.358) (-701.331) -- 0:00:51
      450000 -- (-711.078) [-702.314] (-711.262) (-705.538) * (-706.328) (-703.604) [-705.956] (-703.270) -- 0:00:51

      Average standard deviation of split frequencies: 0.018828

      450500 -- (-704.323) (-710.854) [-701.679] (-702.111) * (-702.941) (-705.053) (-706.198) [-703.728] -- 0:00:51
      451000 -- (-704.608) (-706.200) [-703.589] (-706.688) * (-705.918) [-706.551] (-707.005) (-708.978) -- 0:00:51
      451500 -- (-708.867) (-704.257) (-708.688) [-706.884] * (-702.562) (-707.683) (-704.574) [-706.349] -- 0:00:51
      452000 -- (-705.557) (-702.533) [-708.375] (-707.708) * (-700.847) (-706.784) [-705.530] (-710.438) -- 0:00:50
      452500 -- (-706.483) [-704.413] (-707.929) (-708.954) * (-703.892) [-704.139] (-705.262) (-708.192) -- 0:00:52
      453000 -- (-707.439) (-705.499) [-706.828] (-703.378) * (-704.895) (-710.088) (-704.135) [-712.045] -- 0:00:51
      453500 -- (-704.586) [-704.274] (-704.204) (-706.488) * [-708.984] (-712.633) (-706.293) (-703.011) -- 0:00:51
      454000 -- [-707.473] (-706.265) (-704.179) (-707.797) * (-703.093) (-703.872) (-707.480) [-709.140] -- 0:00:51
      454500 -- (-707.778) [-703.149] (-705.489) (-704.396) * (-704.425) (-703.996) (-702.623) [-704.921] -- 0:00:51
      455000 -- (-701.147) [-704.957] (-704.730) (-706.763) * [-709.574] (-707.613) (-703.173) (-706.143) -- 0:00:51

      Average standard deviation of split frequencies: 0.019297

      455500 -- [-714.039] (-707.069) (-705.831) (-708.267) * (-708.203) [-710.284] (-702.914) (-715.179) -- 0:00:51
      456000 -- [-703.795] (-706.246) (-703.061) (-706.509) * (-708.985) (-705.557) [-704.985] (-704.884) -- 0:00:51
      456500 -- (-704.434) [-704.680] (-712.321) (-702.212) * (-709.711) (-706.352) [-703.463] (-701.910) -- 0:00:51
      457000 -- (-706.199) [-711.714] (-704.654) (-705.483) * (-708.141) [-708.865] (-707.750) (-704.943) -- 0:00:51
      457500 -- (-706.275) (-707.253) (-707.643) [-702.176] * [-708.670] (-709.427) (-702.082) (-705.891) -- 0:00:50
      458000 -- (-708.432) [-705.489] (-704.653) (-709.300) * (-709.321) (-704.285) (-706.232) [-707.114] -- 0:00:50
      458500 -- [-704.856] (-703.871) (-703.485) (-709.062) * [-702.477] (-707.544) (-708.123) (-704.846) -- 0:00:50
      459000 -- (-702.646) (-706.036) (-707.187) [-710.274] * (-711.001) [-708.749] (-707.317) (-704.486) -- 0:00:50
      459500 -- (-704.859) [-712.497] (-708.981) (-704.363) * [-706.284] (-702.574) (-701.321) (-706.634) -- 0:00:50
      460000 -- (-709.982) [-702.919] (-708.202) (-709.793) * (-710.085) (-706.477) [-703.314] (-703.393) -- 0:00:50

      Average standard deviation of split frequencies: 0.021148

      460500 -- (-703.409) (-710.400) (-702.670) [-702.601] * (-701.469) [-708.785] (-708.118) (-718.254) -- 0:00:50
      461000 -- [-705.111] (-708.956) (-701.556) (-707.286) * [-709.612] (-705.556) (-705.898) (-709.039) -- 0:00:50
      461500 -- (-701.349) (-704.749) (-706.123) [-703.160] * (-711.096) [-702.751] (-704.683) (-702.738) -- 0:00:50
      462000 -- (-702.292) [-699.568] (-711.187) (-705.057) * (-706.181) (-702.836) [-707.980] (-702.417) -- 0:00:51
      462500 -- [-704.132] (-702.295) (-703.284) (-702.521) * (-704.741) (-708.366) [-703.964] (-709.083) -- 0:00:51
      463000 -- [-701.815] (-707.259) (-709.971) (-709.093) * (-707.836) (-705.292) [-703.104] (-704.643) -- 0:00:51
      463500 -- (-705.044) (-704.833) (-703.529) [-712.110] * (-704.281) [-707.118] (-706.075) (-707.474) -- 0:00:50
      464000 -- [-702.511] (-704.502) (-708.199) (-707.564) * [-703.242] (-708.961) (-704.403) (-701.637) -- 0:00:50
      464500 -- [-701.863] (-707.360) (-704.928) (-708.995) * (-705.088) (-707.209) (-705.602) [-702.624] -- 0:00:50
      465000 -- [-703.691] (-702.958) (-709.182) (-704.904) * (-705.451) [-702.815] (-707.146) (-705.284) -- 0:00:50

      Average standard deviation of split frequencies: 0.022930

      465500 -- (-709.075) (-705.990) (-703.711) [-705.419] * (-709.149) [-704.791] (-705.742) (-711.139) -- 0:00:50
      466000 -- (-700.693) [-705.653] (-702.235) (-705.129) * (-705.385) (-701.535) [-703.896] (-706.837) -- 0:00:50
      466500 -- [-701.775] (-704.004) (-703.198) (-705.125) * [-710.246] (-701.404) (-707.398) (-700.740) -- 0:00:50
      467000 -- (-706.748) [-701.580] (-703.990) (-707.898) * (-705.259) (-705.156) [-704.791] (-711.104) -- 0:00:50
      467500 -- (-709.883) [-709.570] (-703.776) (-709.992) * (-703.041) [-703.751] (-710.403) (-708.102) -- 0:00:50
      468000 -- (-707.104) (-704.716) [-704.539] (-710.008) * (-710.878) (-702.900) (-706.992) [-704.732] -- 0:00:50
      468500 -- (-706.730) (-707.933) (-703.001) [-707.700] * [-701.351] (-704.737) (-713.287) (-706.452) -- 0:00:49
      469000 -- (-701.404) (-700.356) [-703.115] (-705.481) * (-709.783) (-705.592) [-714.713] (-711.735) -- 0:00:49
      469500 -- (-708.577) [-702.639] (-702.008) (-706.450) * (-700.759) [-704.576] (-711.583) (-704.208) -- 0:00:49
      470000 -- (-704.380) (-703.542) [-706.216] (-705.876) * [-703.747] (-702.082) (-708.038) (-706.011) -- 0:00:49

      Average standard deviation of split frequencies: 0.020699

      470500 -- [-708.433] (-702.302) (-703.413) (-703.929) * (-701.016) (-709.943) [-706.913] (-706.510) -- 0:00:49
      471000 -- (-706.728) [-703.965] (-716.248) (-706.500) * (-706.421) (-703.993) (-705.993) [-705.436] -- 0:00:49
      471500 -- (-705.346) (-703.750) (-701.920) [-703.951] * (-703.990) (-711.678) (-713.449) [-704.795] -- 0:00:49
      472000 -- (-706.038) (-704.210) [-707.012] (-703.458) * [-703.211] (-707.311) (-708.052) (-704.082) -- 0:00:50
      472500 -- (-709.498) [-705.893] (-703.872) (-709.173) * (-705.085) [-706.715] (-711.285) (-707.735) -- 0:00:50
      473000 -- (-702.913) (-700.451) [-702.626] (-713.820) * (-708.879) [-705.865] (-714.482) (-703.530) -- 0:00:50
      473500 -- (-709.109) (-702.634) (-710.976) [-710.114] * (-705.160) [-704.158] (-713.491) (-708.874) -- 0:00:50
      474000 -- (-703.419) [-706.461] (-707.533) (-707.707) * (-701.830) (-705.062) (-710.474) [-709.662] -- 0:00:49
      474500 -- [-704.808] (-700.085) (-707.638) (-712.491) * [-700.209] (-706.797) (-705.335) (-710.174) -- 0:00:49
      475000 -- (-704.635) (-704.578) [-702.481] (-707.707) * (-708.428) (-705.555) [-707.555] (-713.021) -- 0:00:49

      Average standard deviation of split frequencies: 0.020467

      475500 -- [-705.702] (-709.484) (-709.476) (-705.431) * (-704.586) (-708.535) (-703.738) [-705.922] -- 0:00:49
      476000 -- (-701.973) [-705.650] (-712.443) (-706.868) * (-705.507) (-708.618) [-710.220] (-707.749) -- 0:00:49
      476500 -- (-703.158) [-703.415] (-706.278) (-708.308) * [-705.884] (-709.566) (-702.700) (-707.094) -- 0:00:49
      477000 -- (-708.269) [-706.920] (-704.687) (-712.582) * [-707.068] (-705.289) (-700.765) (-708.710) -- 0:00:49
      477500 -- (-710.197) [-713.814] (-714.093) (-709.110) * (-705.976) (-707.483) [-701.432] (-705.945) -- 0:00:49
      478000 -- (-704.189) (-713.358) (-707.618) [-707.983] * (-705.689) [-704.797] (-705.258) (-704.566) -- 0:00:49
      478500 -- (-705.363) [-704.145] (-715.923) (-713.062) * [-706.139] (-713.434) (-703.949) (-702.786) -- 0:00:49
      479000 -- (-701.100) (-704.690) [-704.543] (-705.907) * (-707.344) (-702.284) (-702.899) [-704.913] -- 0:00:48
      479500 -- [-705.740] (-705.389) (-706.715) (-709.204) * (-707.061) (-707.158) [-704.520] (-702.066) -- 0:00:48
      480000 -- (-709.960) (-707.904) [-704.286] (-703.160) * (-702.181) [-707.269] (-710.423) (-707.446) -- 0:00:48

      Average standard deviation of split frequencies: 0.020268

      480500 -- [-704.500] (-710.205) (-706.252) (-706.243) * [-705.013] (-709.688) (-704.005) (-700.879) -- 0:00:48
      481000 -- (-711.269) (-704.222) [-705.183] (-708.495) * (-703.642) (-701.839) (-711.032) [-701.215] -- 0:00:48
      481500 -- (-705.015) [-708.035] (-708.389) (-709.796) * [-710.300] (-706.280) (-711.421) (-706.096) -- 0:00:48
      482000 -- (-720.927) [-713.897] (-708.057) (-706.040) * (-709.855) (-706.170) [-707.469] (-703.959) -- 0:00:49
      482500 -- (-708.880) (-713.618) (-711.041) [-710.686] * (-710.434) [-703.499] (-706.572) (-710.505) -- 0:00:49
      483000 -- (-704.127) [-710.011] (-702.475) (-707.703) * (-711.222) (-707.694) [-702.944] (-711.036) -- 0:00:49
      483500 -- (-705.981) (-699.986) (-706.964) [-708.316] * (-706.468) (-709.170) [-701.462] (-704.401) -- 0:00:49
      484000 -- [-705.609] (-705.923) (-710.155) (-708.752) * (-709.036) (-705.269) [-706.632] (-703.553) -- 0:00:49
      484500 -- (-709.719) (-708.738) [-707.378] (-714.374) * [-703.290] (-705.655) (-705.698) (-707.730) -- 0:00:48
      485000 -- (-710.523) [-708.183] (-708.291) (-707.358) * (-702.185) (-706.079) [-707.671] (-699.996) -- 0:00:48

      Average standard deviation of split frequencies: 0.019399

      485500 -- [-708.155] (-710.153) (-708.065) (-710.178) * (-701.807) (-707.968) (-699.614) [-707.837] -- 0:00:48
      486000 -- (-704.395) (-712.888) (-709.029) [-709.590] * (-706.947) (-709.205) (-705.012) [-700.896] -- 0:00:48
      486500 -- (-706.317) (-708.712) [-704.333] (-710.020) * (-704.077) [-702.992] (-705.588) (-703.960) -- 0:00:48
      487000 -- (-703.614) (-711.038) (-705.325) [-707.240] * (-702.964) [-708.136] (-708.795) (-707.476) -- 0:00:48
      487500 -- (-705.680) (-705.771) (-715.936) [-703.089] * (-713.254) [-708.029] (-701.585) (-707.523) -- 0:00:48
      488000 -- (-702.915) (-703.482) [-711.736] (-707.265) * (-716.828) (-706.491) [-702.907] (-703.222) -- 0:00:48
      488500 -- (-704.543) [-701.342] (-705.899) (-702.464) * (-708.502) (-706.777) (-708.202) [-704.606] -- 0:00:48
      489000 -- (-701.827) (-702.369) [-703.002] (-707.538) * (-708.128) [-709.276] (-705.092) (-704.782) -- 0:00:48
      489500 -- (-704.037) [-710.192] (-708.797) (-702.916) * [-700.953] (-702.330) (-705.716) (-714.908) -- 0:00:47
      490000 -- (-709.222) [-708.200] (-710.899) (-704.788) * [-704.278] (-709.164) (-704.677) (-703.526) -- 0:00:47

      Average standard deviation of split frequencies: 0.019855

      490500 -- (-706.320) (-711.856) (-711.629) [-707.987] * (-710.548) (-705.134) (-703.768) [-703.929] -- 0:00:47
      491000 -- (-710.079) [-708.244] (-710.430) (-712.936) * (-704.446) (-712.568) [-711.903] (-710.331) -- 0:00:47
      491500 -- (-705.888) (-703.133) [-701.546] (-703.219) * (-709.945) (-706.267) (-705.196) [-706.981] -- 0:00:47
      492000 -- (-704.984) (-704.389) (-704.562) [-704.593] * (-704.227) (-705.088) [-706.417] (-701.849) -- 0:00:48
      492500 -- (-709.079) (-705.118) (-714.857) [-705.232] * [-703.678] (-704.248) (-707.318) (-707.737) -- 0:00:48
      493000 -- (-706.741) [-708.640] (-709.340) (-703.612) * (-704.004) [-703.066] (-705.473) (-704.406) -- 0:00:48
      493500 -- (-709.335) (-704.476) (-708.676) [-703.709] * (-716.251) [-704.338] (-710.174) (-705.336) -- 0:00:48
      494000 -- (-711.267) (-700.904) [-709.610] (-704.884) * (-701.017) (-707.240) [-706.194] (-705.523) -- 0:00:48
      494500 -- (-704.524) (-707.760) (-704.598) [-704.700] * (-706.621) [-702.914] (-704.042) (-711.472) -- 0:00:48
      495000 -- (-717.072) [-704.894] (-706.396) (-705.247) * (-710.210) (-709.066) (-708.017) [-706.967] -- 0:00:47

      Average standard deviation of split frequencies: 0.018375

      495500 -- [-706.893] (-705.737) (-707.989) (-702.507) * [-701.529] (-703.611) (-711.337) (-707.114) -- 0:00:47
      496000 -- [-702.981] (-704.473) (-714.012) (-701.525) * (-705.274) (-706.674) [-707.792] (-705.593) -- 0:00:47
      496500 -- (-706.217) (-705.771) (-705.283) [-700.422] * (-704.113) [-706.628] (-703.268) (-704.091) -- 0:00:47
      497000 -- (-707.855) (-704.009) (-708.872) [-704.985] * (-711.765) (-708.878) [-712.720] (-708.630) -- 0:00:47
      497500 -- (-713.659) (-712.322) (-708.920) [-707.182] * (-707.909) (-704.339) (-708.181) [-701.707] -- 0:00:47
      498000 -- [-704.161] (-709.121) (-706.956) (-707.077) * (-706.590) (-707.674) (-704.995) [-704.305] -- 0:00:47
      498500 -- (-710.059) (-709.145) [-701.317] (-708.463) * [-702.436] (-709.172) (-703.172) (-706.843) -- 0:00:47
      499000 -- (-711.701) (-710.168) [-703.162] (-707.455) * [-703.989] (-705.553) (-699.317) (-702.549) -- 0:00:47
      499500 -- (-708.031) (-708.413) (-703.121) [-702.486] * [-703.612] (-707.537) (-700.829) (-704.179) -- 0:00:47
      500000 -- [-704.563] (-705.455) (-704.702) (-709.431) * (-704.755) [-704.733] (-704.320) (-701.915) -- 0:00:47

      Average standard deviation of split frequencies: 0.020086

      500500 -- (-706.331) [-707.134] (-706.575) (-708.850) * (-705.062) (-709.674) [-702.650] (-704.298) -- 0:00:46
      501000 -- [-708.750] (-706.737) (-707.429) (-705.334) * (-702.254) (-707.777) (-710.134) [-703.587] -- 0:00:46
      501500 -- [-706.091] (-703.787) (-706.326) (-704.082) * (-709.873) [-707.915] (-713.520) (-704.192) -- 0:00:46
      502000 -- (-706.956) [-705.204] (-707.727) (-706.498) * (-703.946) (-702.758) (-707.850) [-706.058] -- 0:00:46
      502500 -- [-709.363] (-708.908) (-704.181) (-706.172) * [-705.682] (-711.370) (-708.242) (-703.140) -- 0:00:47
      503000 -- (-710.095) (-709.801) (-708.893) [-699.746] * [-701.294] (-704.988) (-701.005) (-703.456) -- 0:00:47
      503500 -- (-708.112) (-713.511) [-703.419] (-704.829) * (-710.704) (-704.479) [-706.577] (-702.957) -- 0:00:47
      504000 -- (-710.748) (-707.682) (-703.078) [-701.964] * (-706.843) (-704.570) [-703.992] (-714.067) -- 0:00:47
      504500 -- (-711.229) (-708.123) [-703.417] (-704.193) * (-709.664) (-706.797) (-705.835) [-707.386] -- 0:00:47
      505000 -- (-702.880) (-703.976) (-706.025) [-703.101] * (-708.970) (-708.814) [-704.226] (-715.316) -- 0:00:47

      Average standard deviation of split frequencies: 0.020496

      505500 -- [-710.257] (-710.816) (-707.750) (-708.971) * (-705.366) (-700.636) (-701.440) [-711.051] -- 0:00:46
      506000 -- (-706.949) [-700.402] (-703.441) (-701.836) * (-704.912) [-704.454] (-707.405) (-706.312) -- 0:00:46
      506500 -- [-706.297] (-704.132) (-704.921) (-702.962) * (-707.838) (-703.555) [-702.624] (-702.458) -- 0:00:46
      507000 -- (-705.809) (-701.146) [-706.003] (-704.883) * (-707.796) [-701.395] (-711.931) (-712.802) -- 0:00:46
      507500 -- (-704.878) [-702.853] (-709.860) (-704.080) * (-702.520) [-705.349] (-700.470) (-709.441) -- 0:00:46
      508000 -- (-707.259) (-704.165) (-706.580) [-701.968] * (-706.768) [-706.419] (-709.362) (-707.660) -- 0:00:46
      508500 -- [-708.772] (-705.363) (-704.330) (-705.262) * (-710.397) (-700.224) [-706.022] (-710.170) -- 0:00:46
      509000 -- (-704.578) [-703.982] (-703.182) (-708.002) * [-702.820] (-710.590) (-702.007) (-704.958) -- 0:00:46
      509500 -- (-702.024) (-721.573) [-704.746] (-705.588) * (-706.334) [-704.657] (-698.489) (-708.240) -- 0:00:46
      510000 -- (-704.868) (-703.305) (-715.870) [-702.634] * [-704.764] (-709.227) (-702.861) (-704.757) -- 0:00:46

      Average standard deviation of split frequencies: 0.023386

      510500 -- (-709.574) [-709.593] (-710.746) (-708.172) * [-706.756] (-705.377) (-708.404) (-711.635) -- 0:00:46
      511000 -- [-705.137] (-705.756) (-708.067) (-702.617) * (-702.914) (-701.817) [-703.959] (-706.174) -- 0:00:45
      511500 -- (-711.000) (-711.461) (-708.561) [-702.106] * [-708.464] (-703.723) (-703.196) (-707.494) -- 0:00:45
      512000 -- (-708.017) (-706.211) [-703.467] (-702.357) * [-706.440] (-711.500) (-699.755) (-703.421) -- 0:00:45
      512500 -- [-710.224] (-711.206) (-715.325) (-702.586) * (-717.018) (-705.604) (-701.843) [-705.163] -- 0:00:45
      513000 -- (-702.292) (-705.044) [-708.983] (-708.532) * (-706.780) (-708.076) [-701.529] (-700.192) -- 0:00:46
      513500 -- (-710.075) [-704.322] (-710.933) (-716.641) * (-708.389) (-711.632) (-705.841) [-700.753] -- 0:00:46
      514000 -- (-708.155) (-703.467) (-708.177) [-705.096] * (-700.776) (-704.132) (-714.315) [-702.935] -- 0:00:46
      514500 -- (-714.025) (-703.797) [-704.204] (-703.745) * [-707.240] (-704.572) (-710.472) (-704.964) -- 0:00:46
      515000 -- (-712.121) [-711.470] (-702.381) (-705.183) * (-703.464) (-712.045) (-705.769) [-700.236] -- 0:00:46

      Average standard deviation of split frequencies: 0.023144

      515500 -- [-703.607] (-704.648) (-708.959) (-708.809) * (-707.574) (-707.196) [-707.973] (-701.946) -- 0:00:46
      516000 -- (-704.498) (-704.977) (-710.198) [-705.633] * (-705.323) (-710.126) [-704.159] (-705.653) -- 0:00:45
      516500 -- [-703.672] (-704.757) (-705.041) (-706.834) * (-708.111) (-706.759) [-702.132] (-705.983) -- 0:00:45
      517000 -- [-705.795] (-711.768) (-705.522) (-708.329) * (-709.840) (-704.930) (-707.399) [-703.289] -- 0:00:45
      517500 -- (-705.955) (-706.811) [-704.783] (-709.108) * (-702.905) (-704.992) (-711.686) [-700.192] -- 0:00:45
      518000 -- (-705.205) (-704.161) [-704.018] (-713.627) * (-699.903) (-707.803) (-712.570) [-702.833] -- 0:00:45
      518500 -- (-700.235) (-706.408) [-702.317] (-708.442) * [-700.879] (-711.096) (-706.597) (-702.820) -- 0:00:45
      519000 -- (-703.290) (-701.962) [-706.176] (-716.933) * [-701.603] (-711.028) (-704.142) (-702.230) -- 0:00:45
      519500 -- (-704.329) (-707.461) [-706.728] (-711.954) * (-708.180) (-713.129) [-704.005] (-710.439) -- 0:00:45
      520000 -- (-708.466) [-703.144] (-700.280) (-708.134) * (-700.928) (-711.984) [-705.445] (-705.574) -- 0:00:45

      Average standard deviation of split frequencies: 0.021126

      520500 -- (-703.045) [-706.353] (-705.511) (-705.821) * (-709.355) [-705.605] (-704.932) (-701.666) -- 0:00:45
      521000 -- [-702.566] (-703.796) (-706.748) (-701.657) * (-713.713) (-706.908) (-706.562) [-705.611] -- 0:00:45
      521500 -- (-704.770) (-707.566) [-700.596] (-706.022) * (-703.288) (-707.758) [-705.616] (-701.629) -- 0:00:44
      522000 -- (-707.955) [-703.261] (-704.564) (-708.274) * (-704.498) (-700.367) [-707.902] (-701.663) -- 0:00:44
      522500 -- (-705.395) (-706.107) [-703.611] (-703.349) * [-706.565] (-710.088) (-707.792) (-703.937) -- 0:00:44
      523000 -- (-710.980) (-706.938) [-702.391] (-709.615) * [-703.134] (-703.060) (-714.802) (-710.312) -- 0:00:44
      523500 -- (-707.558) (-704.236) [-702.525] (-710.624) * [-706.542] (-705.220) (-705.194) (-708.569) -- 0:00:45
      524000 -- (-707.533) (-706.728) (-704.524) [-712.904] * (-704.982) (-704.455) (-712.515) [-700.910] -- 0:00:45
      524500 -- (-707.572) [-710.523] (-705.410) (-706.446) * (-705.129) [-701.599] (-712.638) (-701.599) -- 0:00:45
      525000 -- (-707.297) [-705.379] (-711.051) (-707.814) * [-702.220] (-704.491) (-721.390) (-703.592) -- 0:00:45

      Average standard deviation of split frequencies: 0.022704

      525500 -- (-704.207) [-705.952] (-707.237) (-707.028) * (-703.075) (-705.821) (-701.931) [-709.332] -- 0:00:45
      526000 -- (-701.123) (-702.675) (-708.408) [-703.013] * (-706.174) (-704.998) (-702.872) [-705.605] -- 0:00:45
      526500 -- (-710.286) (-701.305) (-707.695) [-704.396] * (-707.381) [-707.157] (-705.781) (-704.981) -- 0:00:44
      527000 -- [-704.146] (-706.137) (-704.977) (-706.777) * (-704.994) [-709.917] (-708.421) (-704.738) -- 0:00:44
      527500 -- [-709.496] (-710.487) (-704.332) (-701.112) * (-713.704) [-701.198] (-707.230) (-700.990) -- 0:00:44
      528000 -- (-708.499) [-707.924] (-703.061) (-707.533) * (-702.935) (-705.893) [-703.063] (-704.112) -- 0:00:44
      528500 -- [-704.634] (-709.533) (-701.427) (-705.061) * (-704.798) (-708.424) (-703.794) [-705.175] -- 0:00:44
      529000 -- (-712.830) (-707.545) (-702.146) [-699.805] * [-706.792] (-703.072) (-702.153) (-705.020) -- 0:00:44
      529500 -- (-706.722) (-709.239) (-706.366) [-702.655] * (-704.263) (-706.552) [-707.704] (-705.416) -- 0:00:44
      530000 -- (-705.799) [-713.535] (-706.060) (-711.657) * (-707.999) (-704.339) [-705.342] (-704.863) -- 0:00:44

      Average standard deviation of split frequencies: 0.023689

      530500 -- (-706.369) (-710.906) (-703.408) [-703.049] * (-702.181) [-706.017] (-706.137) (-704.898) -- 0:00:44
      531000 -- (-715.772) (-702.431) (-704.146) [-712.427] * (-709.503) (-705.975) [-699.887] (-708.506) -- 0:00:44
      531500 -- (-706.706) (-704.679) (-709.304) [-704.080] * (-704.910) [-703.387] (-703.196) (-703.762) -- 0:00:44
      532000 -- (-713.302) (-700.780) (-712.789) [-705.540] * (-702.062) (-706.718) (-703.967) [-704.193] -- 0:00:43
      532500 -- (-710.626) (-702.616) [-701.339] (-706.760) * [-702.454] (-709.929) (-707.477) (-703.747) -- 0:00:43
      533000 -- (-703.073) (-699.507) [-701.376] (-707.996) * (-700.062) [-714.496] (-703.924) (-704.754) -- 0:00:43
      533500 -- [-704.366] (-710.147) (-702.051) (-704.711) * [-705.719] (-702.873) (-704.705) (-701.612) -- 0:00:43
      534000 -- (-703.926) (-716.466) (-705.787) [-703.189] * [-704.359] (-704.373) (-703.159) (-711.640) -- 0:00:43
      534500 -- (-705.368) (-706.389) [-702.235] (-703.275) * (-705.301) (-703.840) (-705.203) [-707.522] -- 0:00:44
      535000 -- [-701.834] (-704.527) (-706.659) (-704.935) * (-706.765) (-707.394) (-705.280) [-711.607] -- 0:00:44

      Average standard deviation of split frequencies: 0.024626

      535500 -- (-706.210) (-712.228) (-708.192) [-705.147] * (-704.334) (-704.121) (-707.409) [-708.661] -- 0:00:44
      536000 -- (-702.324) (-706.454) [-705.929] (-704.088) * (-702.859) (-703.065) (-704.836) [-709.830] -- 0:00:44
      536500 -- (-705.744) [-708.598] (-708.064) (-702.955) * (-705.464) [-703.293] (-706.476) (-707.411) -- 0:00:44
      537000 -- (-710.135) (-706.404) [-708.504] (-701.901) * (-703.412) (-704.383) (-706.682) [-700.768] -- 0:00:43
      537500 -- [-701.728] (-704.647) (-705.587) (-703.938) * (-703.692) (-715.198) [-702.014] (-706.486) -- 0:00:43
      538000 -- (-705.954) (-706.504) [-706.326] (-712.951) * (-709.274) (-711.696) [-703.184] (-703.388) -- 0:00:43
      538500 -- (-705.393) (-714.986) (-707.121) [-705.349] * (-704.963) (-707.883) (-702.618) [-706.166] -- 0:00:43
      539000 -- (-706.668) (-706.017) [-712.657] (-699.804) * (-716.959) (-710.743) (-702.160) [-704.521] -- 0:00:43
      539500 -- (-703.148) (-704.484) (-707.241) [-704.742] * [-710.196] (-703.360) (-703.260) (-706.097) -- 0:00:43
      540000 -- (-703.087) (-704.625) (-705.781) [-704.304] * [-708.805] (-710.002) (-708.558) (-703.475) -- 0:00:43

      Average standard deviation of split frequencies: 0.024994

      540500 -- (-706.697) (-703.792) (-702.040) [-703.190] * (-713.591) (-704.679) (-703.821) [-707.381] -- 0:00:43
      541000 -- [-700.902] (-704.113) (-707.263) (-700.534) * (-703.730) (-707.102) (-701.009) [-703.454] -- 0:00:43
      541500 -- (-701.626) (-705.083) [-704.431] (-703.781) * (-706.240) [-704.092] (-703.574) (-708.119) -- 0:00:43
      542000 -- (-706.976) (-703.449) [-704.405] (-704.624) * (-707.358) (-704.988) [-703.528] (-714.298) -- 0:00:43
      542500 -- (-702.276) [-705.021] (-705.928) (-708.618) * (-706.149) [-709.549] (-716.964) (-709.662) -- 0:00:43
      543000 -- (-713.792) (-712.079) (-705.989) [-704.338] * (-704.130) (-704.432) (-703.834) [-704.539] -- 0:00:42
      543500 -- (-707.030) [-706.761] (-703.277) (-709.128) * (-703.424) (-708.548) [-704.216] (-708.632) -- 0:00:42
      544000 -- [-708.856] (-706.197) (-700.922) (-714.161) * [-704.978] (-710.669) (-703.380) (-701.281) -- 0:00:42
      544500 -- (-715.921) (-711.348) [-707.819] (-701.570) * (-706.811) (-704.132) (-703.680) [-702.770] -- 0:00:42
      545000 -- (-708.784) (-707.019) (-710.327) [-704.534] * (-706.640) (-708.593) [-704.358] (-708.492) -- 0:00:42

      Average standard deviation of split frequencies: 0.024750

      545500 -- (-709.129) (-708.094) (-709.115) [-706.161] * [-712.458] (-707.200) (-702.810) (-712.869) -- 0:00:43
      546000 -- (-708.177) [-704.244] (-715.136) (-705.985) * [-707.608] (-704.999) (-704.210) (-704.681) -- 0:00:43
      546500 -- [-708.992] (-707.141) (-707.272) (-702.826) * (-702.891) [-702.219] (-709.408) (-706.770) -- 0:00:43
      547000 -- [-706.279] (-708.371) (-705.123) (-707.791) * (-703.933) (-702.464) (-702.583) [-713.050] -- 0:00:43
      547500 -- [-705.800] (-704.068) (-705.206) (-701.338) * (-711.555) (-715.605) [-700.305] (-702.597) -- 0:00:42
      548000 -- [-704.856] (-704.915) (-707.988) (-711.093) * [-703.921] (-709.403) (-703.453) (-702.450) -- 0:00:42
      548500 -- (-708.267) [-708.534] (-701.654) (-707.953) * [-701.203] (-712.305) (-707.208) (-705.157) -- 0:00:42
      549000 -- (-703.586) (-708.569) [-704.047] (-702.545) * [-700.770] (-709.922) (-706.478) (-705.845) -- 0:00:42
      549500 -- [-702.544] (-709.699) (-704.839) (-705.384) * (-706.773) [-706.100] (-708.526) (-712.375) -- 0:00:42
      550000 -- (-702.826) (-707.912) [-705.558] (-705.807) * [-704.866] (-703.416) (-707.085) (-707.146) -- 0:00:42

      Average standard deviation of split frequencies: 0.023970

      550500 -- [-705.481] (-708.814) (-711.656) (-710.549) * (-710.633) (-702.791) [-702.029] (-705.431) -- 0:00:42
      551000 -- [-705.117] (-704.387) (-706.262) (-710.615) * (-702.238) (-705.690) (-708.349) [-706.556] -- 0:00:42
      551500 -- (-708.530) [-706.247] (-705.895) (-707.225) * [-702.737] (-704.923) (-704.309) (-705.912) -- 0:00:42
      552000 -- (-718.072) (-703.154) (-708.827) [-703.907] * [-706.095] (-709.333) (-706.641) (-706.519) -- 0:00:42
      552500 -- (-714.598) (-703.166) [-704.881] (-704.641) * (-702.705) (-711.915) (-709.024) [-711.622] -- 0:00:42
      553000 -- (-713.537) (-710.561) [-703.559] (-703.379) * [-705.215] (-701.802) (-707.046) (-708.848) -- 0:00:42
      553500 -- (-711.705) [-702.617] (-709.101) (-704.022) * (-710.809) (-704.284) (-706.612) [-702.255] -- 0:00:41
      554000 -- (-708.395) [-707.876] (-705.469) (-707.901) * [-703.536] (-707.665) (-707.404) (-705.251) -- 0:00:41
      554500 -- [-702.210] (-703.063) (-708.311) (-701.966) * [-706.857] (-704.082) (-707.467) (-703.727) -- 0:00:41
      555000 -- [-701.809] (-706.013) (-704.935) (-712.237) * (-706.537) [-703.407] (-711.272) (-709.232) -- 0:00:42

      Average standard deviation of split frequencies: 0.024870

      555500 -- (-704.701) (-701.230) [-707.240] (-712.942) * (-706.455) [-704.066] (-706.439) (-709.762) -- 0:00:42
      556000 -- (-705.402) (-711.752) [-704.830] (-709.299) * (-703.001) (-702.638) (-707.519) [-707.453] -- 0:00:42
      556500 -- [-704.178] (-706.883) (-703.927) (-711.745) * [-712.167] (-706.142) (-709.393) (-705.519) -- 0:00:42
      557000 -- (-712.240) (-707.068) (-701.259) [-704.786] * (-705.763) [-707.695] (-709.310) (-703.753) -- 0:00:42
      557500 -- (-707.236) (-708.406) (-708.696) [-705.500] * (-708.068) (-706.291) [-703.934] (-709.127) -- 0:00:42
      558000 -- [-703.849] (-713.357) (-706.980) (-706.978) * [-711.252] (-713.700) (-705.006) (-708.023) -- 0:00:41
      558500 -- (-704.336) (-709.604) [-702.058] (-709.404) * [-709.982] (-706.920) (-709.498) (-707.587) -- 0:00:41
      559000 -- (-705.591) (-711.284) [-702.499] (-714.456) * [-703.269] (-711.193) (-702.484) (-703.970) -- 0:00:41
      559500 -- (-712.072) (-706.492) [-706.249] (-710.814) * (-705.964) [-708.386] (-707.829) (-705.077) -- 0:00:41
      560000 -- [-707.408] (-715.205) (-711.850) (-712.260) * (-707.410) [-704.237] (-708.518) (-704.089) -- 0:00:41

      Average standard deviation of split frequencies: 0.025784

      560500 -- (-704.299) [-710.672] (-713.991) (-718.902) * [-703.272] (-710.297) (-701.869) (-701.604) -- 0:00:41
      561000 -- (-705.440) (-714.121) [-706.279] (-718.498) * (-701.166) (-705.489) [-708.692] (-704.428) -- 0:00:41
      561500 -- (-704.618) (-708.625) [-703.715] (-706.917) * [-706.604] (-704.222) (-705.125) (-702.849) -- 0:00:41
      562000 -- [-702.266] (-713.498) (-703.197) (-705.549) * (-699.045) (-711.917) (-711.884) [-700.963] -- 0:00:41
      562500 -- (-711.644) [-709.023] (-711.566) (-708.815) * (-703.186) [-705.242] (-708.585) (-706.206) -- 0:00:41
      563000 -- (-706.518) (-705.119) (-702.301) [-714.515] * (-707.801) (-712.303) [-707.782] (-708.007) -- 0:00:41
      563500 -- (-710.698) (-711.495) (-713.314) [-703.465] * (-704.795) (-700.858) (-710.570) [-705.653] -- 0:00:41
      564000 -- (-711.101) (-706.071) (-704.776) [-705.092] * (-703.966) (-702.067) (-703.150) [-708.168] -- 0:00:40
      564500 -- (-705.543) (-711.079) [-703.972] (-705.249) * (-718.672) (-705.283) (-703.224) [-705.529] -- 0:00:40
      565000 -- (-705.296) [-706.692] (-702.733) (-712.477) * (-709.397) [-709.555] (-710.496) (-705.656) -- 0:00:40

      Average standard deviation of split frequencies: 0.025541

      565500 -- [-704.321] (-704.882) (-706.587) (-702.650) * (-713.538) [-705.949] (-714.617) (-706.645) -- 0:00:41
      566000 -- (-705.373) (-704.186) (-705.510) [-702.272] * [-704.042] (-705.821) (-709.380) (-709.733) -- 0:00:41
      566500 -- (-709.005) (-703.223) [-707.674] (-710.200) * [-704.808] (-705.237) (-705.762) (-710.432) -- 0:00:41
      567000 -- (-701.415) (-706.431) (-702.139) [-703.709] * (-703.246) [-703.307] (-704.907) (-711.196) -- 0:00:41
      567500 -- (-705.367) [-704.236] (-699.559) (-702.657) * [-708.461] (-702.752) (-703.035) (-707.475) -- 0:00:41
      568000 -- (-702.927) (-705.307) (-704.070) [-701.180] * [-705.178] (-701.296) (-704.972) (-708.883) -- 0:00:41
      568500 -- (-703.935) (-712.792) [-702.846] (-711.601) * (-703.880) [-701.190] (-708.212) (-712.181) -- 0:00:40
      569000 -- (-709.524) (-703.762) [-703.575] (-703.473) * (-706.561) (-703.504) [-702.400] (-712.596) -- 0:00:40
      569500 -- (-704.632) [-705.237] (-704.472) (-710.391) * (-699.854) (-704.561) (-704.093) [-707.626] -- 0:00:40
      570000 -- (-706.964) (-702.195) (-703.958) [-705.166] * [-703.611] (-714.184) (-706.873) (-705.270) -- 0:00:40

      Average standard deviation of split frequencies: 0.024782

      570500 -- (-707.506) (-705.137) [-707.169] (-704.937) * (-704.038) [-707.641] (-702.483) (-710.067) -- 0:00:40
      571000 -- (-702.646) (-701.641) [-705.815] (-704.686) * (-701.662) (-709.236) [-706.590] (-710.588) -- 0:00:40
      571500 -- (-704.108) (-707.518) [-705.062] (-701.059) * (-702.750) (-703.144) [-702.685] (-709.142) -- 0:00:40
      572000 -- [-706.054] (-711.463) (-705.492) (-705.901) * [-714.048] (-709.731) (-707.998) (-708.686) -- 0:00:40
      572500 -- [-701.158] (-709.694) (-708.310) (-706.263) * (-710.331) (-708.292) (-715.610) [-704.723] -- 0:00:40
      573000 -- [-704.507] (-705.214) (-710.632) (-708.802) * (-703.981) [-705.833] (-711.540) (-703.443) -- 0:00:40
      573500 -- (-706.925) (-712.302) (-704.757) [-702.389] * (-710.388) [-709.473] (-712.311) (-705.946) -- 0:00:40
      574000 -- (-703.795) (-713.558) (-714.144) [-704.306] * [-704.045] (-703.795) (-709.880) (-704.207) -- 0:00:40
      574500 -- (-707.086) (-715.105) (-708.676) [-703.340] * (-707.235) (-708.890) (-705.082) [-710.434] -- 0:00:39
      575000 -- (-707.051) (-702.674) [-706.148] (-702.824) * (-710.717) (-704.090) [-704.761] (-707.821) -- 0:00:39

      Average standard deviation of split frequencies: 0.024007

      575500 -- [-704.232] (-705.175) (-714.896) (-707.882) * (-704.039) (-705.258) [-711.307] (-709.845) -- 0:00:39
      576000 -- (-701.921) (-704.779) (-705.590) [-704.762] * (-711.201) [-704.787] (-705.940) (-706.560) -- 0:00:39
      576500 -- (-707.747) (-705.115) [-705.479] (-705.768) * (-709.151) (-709.712) [-707.305] (-699.772) -- 0:00:40
      577000 -- (-703.414) (-706.414) (-702.265) [-706.617] * [-707.779] (-710.282) (-705.328) (-701.474) -- 0:00:40
      577500 -- [-704.233] (-704.152) (-707.899) (-705.516) * (-704.941) (-706.220) (-704.479) [-707.633] -- 0:00:40
      578000 -- [-705.261] (-711.581) (-714.470) (-709.507) * [-704.089] (-707.321) (-704.255) (-702.319) -- 0:00:40
      578500 -- (-707.634) (-700.970) [-705.073] (-704.234) * (-706.594) (-705.453) [-702.945] (-706.366) -- 0:00:40
      579000 -- [-707.187] (-703.848) (-713.596) (-702.303) * [-709.298] (-708.862) (-705.754) (-709.838) -- 0:00:39
      579500 -- [-705.205] (-710.431) (-709.440) (-701.055) * (-707.351) [-707.830] (-704.700) (-710.583) -- 0:00:39
      580000 -- [-707.229] (-706.348) (-711.902) (-705.201) * (-701.289) (-709.766) (-709.817) [-709.635] -- 0:00:39

      Average standard deviation of split frequencies: 0.024896

      580500 -- (-712.029) [-706.341] (-711.523) (-708.269) * (-707.896) [-704.250] (-707.817) (-705.492) -- 0:00:39
      581000 -- (-705.899) (-709.144) (-711.703) [-707.243] * (-708.122) [-706.678] (-704.411) (-709.347) -- 0:00:39
      581500 -- (-704.560) (-711.712) (-709.866) [-707.070] * (-709.146) (-704.245) [-710.096] (-706.969) -- 0:00:39
      582000 -- (-710.612) (-708.135) [-701.033] (-701.003) * (-704.379) (-710.429) (-714.400) [-702.377] -- 0:00:39
      582500 -- [-709.312] (-711.346) (-712.035) (-704.970) * (-709.313) [-705.556] (-707.128) (-712.441) -- 0:00:39
      583000 -- (-706.344) (-711.713) [-703.638] (-708.845) * [-704.317] (-708.564) (-710.879) (-706.646) -- 0:00:39
      583500 -- (-702.396) (-702.139) [-708.534] (-708.650) * (-706.007) [-705.233] (-712.282) (-704.289) -- 0:00:39
      584000 -- (-706.862) [-704.348] (-704.294) (-701.059) * (-706.100) [-709.891] (-714.826) (-703.709) -- 0:00:39
      584500 -- [-706.922] (-708.968) (-703.179) (-700.311) * [-710.378] (-703.815) (-717.214) (-706.054) -- 0:00:39
      585000 -- (-703.052) (-705.994) [-700.782] (-707.948) * [-704.801] (-703.560) (-706.391) (-707.407) -- 0:00:39

      Average standard deviation of split frequencies: 0.024670

      585500 -- (-708.011) (-707.633) [-706.494] (-706.499) * (-703.925) (-708.022) (-708.775) [-704.820] -- 0:00:38
      586000 -- (-705.341) (-707.847) (-709.418) [-704.549] * (-710.945) (-709.651) [-704.724] (-708.302) -- 0:00:38
      586500 -- (-705.027) (-710.877) [-699.975] (-704.989) * (-700.861) [-700.950] (-703.499) (-705.774) -- 0:00:38
      587000 -- [-709.967] (-703.226) (-709.296) (-712.311) * [-702.560] (-709.973) (-706.930) (-707.276) -- 0:00:38
      587500 -- (-705.145) [-704.879] (-706.175) (-705.208) * [-705.986] (-708.727) (-700.861) (-707.539) -- 0:00:39
      588000 -- (-703.855) [-702.843] (-707.944) (-713.023) * (-709.633) (-709.994) [-700.634] (-707.325) -- 0:00:39
      588500 -- (-704.732) (-708.904) [-703.230] (-712.755) * (-704.046) (-709.591) (-700.730) [-706.820] -- 0:00:39
      589000 -- (-704.122) (-704.616) [-705.876] (-711.772) * (-705.627) (-704.029) [-707.923] (-707.390) -- 0:00:39
      589500 -- (-703.641) [-708.226] (-705.794) (-716.599) * [-708.638] (-704.105) (-704.285) (-709.609) -- 0:00:38
      590000 -- (-707.097) (-702.332) (-705.202) [-715.098] * (-699.706) (-706.274) [-705.439] (-710.133) -- 0:00:38

      Average standard deviation of split frequencies: 0.025007

      590500 -- (-708.610) (-705.831) (-708.122) [-716.730] * (-706.647) [-704.001] (-703.046) (-709.323) -- 0:00:38
      591000 -- (-704.657) (-704.263) (-702.696) [-704.535] * (-702.195) (-704.079) (-701.437) [-707.078] -- 0:00:38
      591500 -- (-709.539) (-704.071) [-704.961] (-707.768) * (-703.633) [-703.437] (-709.584) (-708.738) -- 0:00:38
      592000 -- (-707.864) (-704.723) (-708.113) [-706.471] * (-708.536) (-706.183) (-705.498) [-703.738] -- 0:00:38
      592500 -- [-702.730] (-712.018) (-712.095) (-707.106) * [-703.534] (-707.756) (-709.817) (-706.547) -- 0:00:38
      593000 -- [-703.622] (-712.831) (-705.144) (-707.864) * [-704.873] (-704.517) (-700.723) (-710.469) -- 0:00:38
      593500 -- [-704.192] (-706.177) (-710.470) (-709.626) * (-706.334) [-705.362] (-706.184) (-707.630) -- 0:00:38
      594000 -- [-712.120] (-703.946) (-701.797) (-702.980) * (-713.738) [-709.255] (-705.827) (-704.570) -- 0:00:38
      594500 -- [-709.881] (-706.573) (-705.642) (-702.657) * (-703.310) (-706.574) [-710.261] (-711.701) -- 0:00:38
      595000 -- (-710.786) (-708.123) [-706.322] (-705.866) * (-707.114) (-708.186) [-703.252] (-705.205) -- 0:00:38

      Average standard deviation of split frequencies: 0.023728

      595500 -- [-708.048] (-704.023) (-705.846) (-706.790) * (-710.146) [-703.471] (-706.096) (-711.030) -- 0:00:38
      596000 -- (-702.611) [-700.910] (-703.825) (-711.444) * (-702.959) (-705.198) [-701.992] (-708.633) -- 0:00:37
      596500 -- [-706.429] (-702.434) (-709.673) (-706.403) * (-705.724) (-708.387) [-701.679] (-711.561) -- 0:00:37
      597000 -- [-705.574] (-703.277) (-708.464) (-704.194) * (-707.049) [-702.958] (-706.087) (-709.279) -- 0:00:37
      597500 -- (-707.579) (-708.548) (-710.966) [-704.860] * (-706.966) (-706.164) (-713.081) [-709.566] -- 0:00:37
      598000 -- (-706.583) [-708.530] (-705.856) (-706.498) * (-703.778) [-705.843] (-705.388) (-705.386) -- 0:00:37
      598500 -- (-708.255) (-711.405) [-707.802] (-706.670) * (-700.565) (-704.260) (-705.945) [-702.989] -- 0:00:38
      599000 -- (-713.330) (-705.206) [-702.423] (-707.267) * (-710.851) (-706.702) (-708.092) [-700.171] -- 0:00:38
      599500 -- (-707.938) (-704.093) [-704.364] (-712.995) * [-702.428] (-705.441) (-701.721) (-704.419) -- 0:00:38
      600000 -- (-705.262) (-709.448) (-715.210) [-704.072] * (-706.945) (-704.751) [-703.386] (-704.731) -- 0:00:38

      Average standard deviation of split frequencies: 0.021451

      600500 -- [-700.454] (-702.448) (-705.753) (-702.978) * (-709.819) [-704.929] (-701.146) (-703.652) -- 0:00:37
      601000 -- (-699.978) (-703.557) [-709.054] (-708.863) * (-709.271) (-710.546) (-708.761) [-701.385] -- 0:00:37
      601500 -- [-703.856] (-709.303) (-705.682) (-701.466) * (-719.615) (-711.241) [-700.540] (-711.375) -- 0:00:37
      602000 -- (-707.429) (-706.172) [-708.187] (-709.317) * (-708.833) (-708.110) [-702.017] (-707.121) -- 0:00:37
      602500 -- [-704.468] (-706.269) (-710.178) (-699.681) * (-711.597) (-701.923) [-709.974] (-704.581) -- 0:00:37
      603000 -- [-704.932] (-708.335) (-706.722) (-703.650) * (-709.750) (-703.148) [-701.943] (-709.832) -- 0:00:37
      603500 -- [-710.395] (-706.620) (-715.684) (-706.445) * [-708.168] (-705.708) (-703.956) (-709.100) -- 0:00:37
      604000 -- (-701.644) (-700.530) (-709.240) [-701.812] * [-707.017] (-704.780) (-704.414) (-701.220) -- 0:00:37
      604500 -- (-701.251) (-703.534) (-704.062) [-704.939] * (-712.397) (-705.368) [-704.639] (-704.480) -- 0:00:37
      605000 -- [-704.989] (-703.902) (-705.185) (-703.382) * (-711.834) [-708.151] (-700.589) (-703.470) -- 0:00:37

      Average standard deviation of split frequencies: 0.020744

      605500 -- (-703.977) (-711.771) (-709.524) [-708.281] * (-705.731) [-704.096] (-704.111) (-709.269) -- 0:00:37
      606000 -- (-705.315) (-703.668) (-704.237) [-701.130] * (-705.741) [-706.378] (-703.791) (-712.910) -- 0:00:37
      606500 -- (-706.428) (-702.412) (-700.656) [-707.459] * (-711.188) (-703.685) (-704.760) [-705.253] -- 0:00:36
      607000 -- (-705.519) (-708.989) [-699.636] (-706.523) * [-705.280] (-711.226) (-712.618) (-708.254) -- 0:00:36
      607500 -- (-707.746) [-711.698] (-705.046) (-705.692) * [-707.751] (-712.086) (-703.836) (-706.624) -- 0:00:36
      608000 -- (-706.837) (-704.358) [-707.668] (-705.954) * (-704.735) (-710.462) [-700.240] (-710.147) -- 0:00:36
      608500 -- (-701.517) [-704.436] (-705.477) (-703.883) * (-711.411) (-702.775) (-704.936) [-708.304] -- 0:00:36
      609000 -- (-708.458) (-705.401) (-706.811) [-704.885] * [-706.563] (-703.127) (-703.388) (-708.850) -- 0:00:37
      609500 -- (-711.383) (-705.085) [-705.878] (-708.840) * [-710.401] (-707.427) (-709.829) (-712.950) -- 0:00:37
      610000 -- (-708.708) (-703.072) [-706.973] (-702.527) * [-704.021] (-713.096) (-702.910) (-710.482) -- 0:00:37

      Average standard deviation of split frequencies: 0.018527

      610500 -- [-707.360] (-703.946) (-703.383) (-699.899) * (-706.262) (-705.047) [-702.550] (-713.386) -- 0:00:37
      611000 -- (-707.294) (-702.036) (-708.528) [-703.103] * (-706.137) (-705.690) (-708.578) [-713.330] -- 0:00:36
      611500 -- (-708.033) (-706.186) [-703.290] (-707.402) * (-705.276) (-711.163) [-705.439] (-706.726) -- 0:00:36
      612000 -- (-705.014) (-704.945) (-703.789) [-706.289] * [-702.306] (-715.733) (-714.146) (-706.247) -- 0:00:36
      612500 -- (-707.976) (-705.731) (-707.400) [-704.669] * (-702.496) (-708.971) [-699.728] (-718.674) -- 0:00:36
      613000 -- [-704.722] (-711.418) (-704.712) (-705.274) * (-702.809) (-703.981) [-701.470] (-713.424) -- 0:00:36
      613500 -- [-707.203] (-707.113) (-712.180) (-705.983) * (-711.272) [-704.527] (-707.311) (-706.797) -- 0:00:36
      614000 -- [-705.680] (-702.691) (-703.526) (-708.762) * (-702.919) (-705.235) (-708.392) [-711.095] -- 0:00:36
      614500 -- (-707.924) (-703.620) (-714.222) [-707.271] * (-705.085) (-709.390) (-707.063) [-708.865] -- 0:00:36
      615000 -- (-709.512) [-708.205] (-706.361) (-708.703) * (-704.058) (-709.201) [-703.211] (-703.012) -- 0:00:36

      Average standard deviation of split frequencies: 0.017346

      615500 -- (-709.785) [-705.306] (-711.726) (-710.475) * (-706.109) (-705.939) [-708.219] (-708.952) -- 0:00:36
      616000 -- [-706.061] (-708.939) (-707.413) (-706.178) * [-704.848] (-706.214) (-701.183) (-705.583) -- 0:00:36
      616500 -- [-707.903] (-709.593) (-707.367) (-705.599) * (-704.299) (-706.728) (-701.428) [-701.462] -- 0:00:36
      617000 -- (-706.110) (-709.087) [-706.912] (-709.274) * [-704.950] (-705.606) (-703.788) (-706.950) -- 0:00:36
      617500 -- [-713.071] (-705.856) (-706.675) (-705.945) * [-699.778] (-705.780) (-703.356) (-708.248) -- 0:00:35
      618000 -- (-707.894) (-708.392) [-705.137] (-705.804) * (-705.336) (-705.259) (-709.702) [-705.083] -- 0:00:35
      618500 -- (-706.170) (-710.921) [-704.642] (-705.136) * [-699.784] (-704.880) (-703.724) (-706.910) -- 0:00:35
      619000 -- (-704.757) [-702.643] (-709.750) (-699.560) * [-704.491] (-709.790) (-706.298) (-705.662) -- 0:00:35
      619500 -- [-709.486] (-710.477) (-702.074) (-713.753) * (-700.927) (-707.316) (-702.967) [-705.278] -- 0:00:35
      620000 -- (-708.309) (-705.037) (-702.666) [-704.620] * (-704.301) [-710.175] (-703.072) (-705.946) -- 0:00:36

      Average standard deviation of split frequencies: 0.017216

      620500 -- [-703.239] (-711.857) (-703.296) (-706.549) * (-701.589) (-705.934) [-708.058] (-706.266) -- 0:00:36
      621000 -- (-704.948) [-706.487] (-707.161) (-706.565) * (-708.135) (-701.775) (-708.441) [-702.000] -- 0:00:36
      621500 -- [-706.006] (-710.334) (-708.764) (-707.189) * (-708.872) (-706.634) [-703.589] (-707.683) -- 0:00:35
      622000 -- (-706.482) (-712.633) (-708.039) [-701.586] * (-704.722) (-700.873) (-709.867) [-710.919] -- 0:00:35
      622500 -- (-705.387) (-701.586) (-712.190) [-704.853] * (-707.323) (-703.824) (-708.246) [-706.781] -- 0:00:35
      623000 -- [-703.574] (-707.431) (-710.543) (-703.685) * [-702.638] (-703.615) (-711.169) (-706.562) -- 0:00:35
      623500 -- (-704.626) (-706.476) [-706.987] (-708.189) * (-702.603) (-703.538) [-710.637] (-706.720) -- 0:00:35
      624000 -- (-705.997) [-701.867] (-706.400) (-704.871) * (-704.722) (-705.073) [-707.135] (-710.334) -- 0:00:35
      624500 -- (-710.229) [-708.038] (-710.763) (-715.259) * (-703.916) (-712.259) (-709.518) [-705.227] -- 0:00:35
      625000 -- (-706.108) (-707.770) [-707.639] (-703.474) * [-701.305] (-707.569) (-705.377) (-704.403) -- 0:00:35

      Average standard deviation of split frequencies: 0.018575

      625500 -- (-712.230) (-705.525) [-713.255] (-704.317) * (-705.967) [-704.461] (-703.778) (-704.115) -- 0:00:35
      626000 -- (-711.379) [-700.175] (-710.122) (-706.666) * [-705.572] (-709.335) (-706.064) (-709.046) -- 0:00:35
      626500 -- (-708.201) (-703.056) (-707.607) [-708.080] * (-703.550) [-704.940] (-703.740) (-712.156) -- 0:00:35
      627000 -- (-708.752) [-705.960] (-710.799) (-711.074) * (-711.311) (-704.733) [-707.315] (-716.321) -- 0:00:35
      627500 -- (-708.898) (-704.813) (-707.145) [-699.665] * [-704.957] (-717.239) (-709.417) (-707.230) -- 0:00:35
      628000 -- (-706.862) (-710.956) [-702.247] (-703.703) * (-712.926) (-701.148) [-706.573] (-710.855) -- 0:00:34
      628500 -- (-712.145) (-704.054) (-713.086) [-702.838] * [-706.698] (-707.016) (-710.900) (-702.401) -- 0:00:34
      629000 -- (-710.519) (-705.656) (-707.725) [-715.109] * (-709.486) [-707.898] (-709.223) (-704.651) -- 0:00:34
      629500 -- [-705.339] (-710.358) (-702.719) (-705.769) * (-704.027) [-704.410] (-709.002) (-713.214) -- 0:00:34
      630000 -- [-703.637] (-712.986) (-706.276) (-705.509) * (-706.774) [-699.373] (-710.383) (-710.186) -- 0:00:34

      Average standard deviation of split frequencies: 0.018438

      630500 -- (-707.243) (-711.087) [-702.642] (-701.555) * [-705.015] (-701.147) (-705.653) (-705.789) -- 0:00:34
      631000 -- (-711.822) [-704.264] (-702.698) (-703.825) * [-705.301] (-703.846) (-705.733) (-704.941) -- 0:00:35
      631500 -- (-704.257) [-705.604] (-709.308) (-708.519) * [-710.179] (-711.624) (-703.608) (-707.475) -- 0:00:35
      632000 -- (-705.056) (-707.329) (-706.654) [-706.655] * (-701.321) (-708.866) [-706.693] (-702.339) -- 0:00:34
      632500 -- (-703.605) (-709.879) [-704.862] (-703.198) * [-702.709] (-712.271) (-704.668) (-705.001) -- 0:00:34
      633000 -- (-708.239) [-711.841] (-702.424) (-701.655) * (-707.042) (-709.172) (-704.632) [-704.769] -- 0:00:34
      633500 -- [-709.339] (-702.220) (-705.064) (-703.476) * [-704.915] (-706.973) (-704.880) (-708.103) -- 0:00:34
      634000 -- (-710.336) (-707.969) (-705.368) [-702.835] * (-707.575) [-705.991] (-706.814) (-705.637) -- 0:00:34
      634500 -- (-707.938) (-709.374) (-711.092) [-708.801] * (-707.815) [-704.677] (-713.796) (-707.367) -- 0:00:34
      635000 -- (-707.009) (-708.602) (-712.297) [-705.342] * (-711.463) (-712.502) (-700.349) [-710.815] -- 0:00:34

      Average standard deviation of split frequencies: 0.019765

      635500 -- (-709.052) (-709.397) [-704.288] (-709.311) * [-708.553] (-703.857) (-702.557) (-710.718) -- 0:00:34
      636000 -- [-709.481] (-707.158) (-705.549) (-709.846) * [-702.176] (-703.988) (-705.327) (-705.494) -- 0:00:34
      636500 -- [-708.206] (-705.308) (-704.728) (-710.045) * (-702.282) (-702.485) [-704.247] (-700.532) -- 0:00:34
      637000 -- (-703.423) (-704.540) (-705.985) [-703.445] * (-707.553) [-701.379] (-703.668) (-701.887) -- 0:00:34
      637500 -- (-707.104) (-704.790) [-704.246] (-701.312) * (-705.085) (-708.512) [-701.169] (-703.316) -- 0:00:34
      638000 -- (-703.852) [-702.511] (-710.149) (-702.909) * (-707.017) (-704.889) (-704.653) [-713.365] -- 0:00:34
      638500 -- [-703.983] (-704.560) (-702.489) (-703.104) * (-704.057) (-707.743) [-708.551] (-708.752) -- 0:00:33
      639000 -- [-707.374] (-705.204) (-703.237) (-712.872) * (-711.976) [-702.381] (-707.108) (-705.892) -- 0:00:33
      639500 -- [-703.919] (-702.585) (-703.472) (-703.224) * (-708.067) (-710.653) (-706.574) [-707.406] -- 0:00:33
      640000 -- (-703.124) (-707.246) [-702.443] (-706.235) * (-703.741) (-704.557) (-704.798) [-703.593] -- 0:00:33

      Average standard deviation of split frequencies: 0.019131

      640500 -- (-709.632) (-706.519) [-705.518] (-710.869) * [-704.357] (-713.918) (-707.440) (-707.886) -- 0:00:33
      641000 -- (-702.653) (-705.457) (-707.136) [-707.581] * (-710.964) (-708.350) (-709.386) [-711.265] -- 0:00:33
      641500 -- [-704.995] (-702.823) (-704.000) (-712.681) * (-705.465) [-710.219] (-712.952) (-702.348) -- 0:00:34
      642000 -- (-706.940) (-706.467) [-706.007] (-709.215) * (-706.843) [-702.512] (-705.091) (-703.712) -- 0:00:34
      642500 -- (-706.158) (-709.749) [-703.728] (-708.070) * (-707.996) [-700.329] (-703.053) (-703.350) -- 0:00:33
      643000 -- (-708.345) (-709.451) [-705.952] (-712.452) * (-699.963) (-699.495) (-709.239) [-703.573] -- 0:00:33
      643500 -- [-703.888] (-710.025) (-705.430) (-709.568) * (-704.033) (-702.786) (-710.318) [-704.392] -- 0:00:33
      644000 -- [-706.378] (-709.216) (-710.422) (-710.549) * (-703.979) (-711.325) (-703.278) [-706.550] -- 0:00:33
      644500 -- (-708.094) (-704.477) (-707.390) [-712.921] * (-703.730) [-706.840] (-715.557) (-701.655) -- 0:00:33
      645000 -- [-703.823] (-704.951) (-707.216) (-701.249) * [-704.777] (-710.930) (-712.531) (-705.587) -- 0:00:33

      Average standard deviation of split frequencies: 0.019459

      645500 -- (-710.476) [-700.649] (-708.219) (-712.421) * (-708.420) (-706.538) (-706.531) [-705.637] -- 0:00:33
      646000 -- (-707.758) (-709.772) (-702.497) [-706.157] * (-711.532) (-709.560) (-712.864) [-708.011] -- 0:00:33
      646500 -- (-707.154) (-705.632) [-708.169] (-716.806) * (-707.430) (-710.761) [-703.522] (-701.811) -- 0:00:33
      647000 -- (-704.561) (-700.800) (-701.290) [-711.605] * (-704.516) (-705.452) [-702.618] (-703.973) -- 0:00:33
      647500 -- (-710.517) (-706.339) (-703.572) [-706.122] * [-701.423] (-700.161) (-709.725) (-709.898) -- 0:00:33
      648000 -- (-708.713) (-700.155) (-704.875) [-701.477] * [-703.642] (-704.478) (-705.096) (-705.922) -- 0:00:33
      648500 -- (-714.297) [-700.247] (-705.077) (-705.422) * [-702.377] (-702.515) (-707.011) (-705.859) -- 0:00:33
      649000 -- (-709.198) (-704.830) [-704.097] (-702.722) * (-700.356) (-712.967) [-704.081] (-710.808) -- 0:00:32
      649500 -- [-708.538] (-709.585) (-705.176) (-708.245) * (-701.764) [-710.230] (-703.922) (-704.081) -- 0:00:32
      650000 -- [-706.739] (-708.527) (-708.548) (-703.116) * (-708.831) (-706.390) [-704.852] (-703.400) -- 0:00:32

      Average standard deviation of split frequencies: 0.018837

      650500 -- [-711.454] (-707.959) (-706.242) (-709.902) * (-706.640) [-708.306] (-713.623) (-705.929) -- 0:00:32
      651000 -- [-710.828] (-709.641) (-706.585) (-706.575) * [-701.875] (-703.246) (-712.277) (-706.300) -- 0:00:32
      651500 -- [-705.614] (-705.180) (-706.310) (-707.822) * (-701.956) (-703.325) [-716.555] (-708.907) -- 0:00:32
      652000 -- (-712.574) (-708.892) (-707.300) [-702.333] * (-706.754) [-706.630] (-707.262) (-706.398) -- 0:00:32
      652500 -- (-703.432) (-710.617) [-702.599] (-707.588) * (-705.698) (-701.275) (-708.019) [-710.437] -- 0:00:33
      653000 -- (-704.756) (-702.797) [-702.072] (-704.571) * (-705.404) (-703.072) [-705.431] (-703.772) -- 0:00:32
      653500 -- (-705.807) (-708.576) [-702.980] (-704.653) * [-705.624] (-704.159) (-711.786) (-707.535) -- 0:00:32
      654000 -- (-703.584) [-710.112] (-709.332) (-710.354) * (-710.671) (-701.042) (-709.276) [-706.382] -- 0:00:32
      654500 -- (-704.652) [-712.390] (-703.667) (-707.893) * [-708.616] (-702.427) (-706.923) (-705.871) -- 0:00:32
      655000 -- [-707.380] (-703.451) (-703.023) (-704.900) * (-706.132) (-702.872) (-706.909) [-705.109] -- 0:00:32

      Average standard deviation of split frequencies: 0.020121

      655500 -- [-703.948] (-705.713) (-705.776) (-708.800) * (-703.734) [-708.371] (-707.454) (-708.520) -- 0:00:32
      656000 -- [-702.263] (-706.928) (-704.187) (-710.774) * (-703.525) (-708.872) [-701.886] (-705.897) -- 0:00:32
      656500 -- [-703.677] (-713.462) (-707.419) (-706.269) * [-705.340] (-702.693) (-702.075) (-705.223) -- 0:00:32
      657000 -- (-704.415) (-713.990) [-704.704] (-707.469) * (-707.166) (-707.743) [-700.947] (-705.556) -- 0:00:32
      657500 -- (-707.510) (-710.328) [-707.459] (-709.862) * (-712.107) (-702.374) [-704.892] (-703.184) -- 0:00:32
      658000 -- (-709.075) (-715.887) (-707.255) [-705.561] * (-701.382) (-709.305) [-705.679] (-704.650) -- 0:00:32
      658500 -- (-712.434) (-707.908) (-714.768) [-707.631] * (-705.364) [-704.361] (-710.135) (-704.599) -- 0:00:32
      659000 -- [-709.912] (-701.253) (-707.865) (-703.878) * (-705.542) [-702.131] (-707.566) (-708.026) -- 0:00:32
      659500 -- (-709.208) (-712.546) [-709.898] (-705.279) * (-705.385) (-705.258) [-701.666] (-705.702) -- 0:00:32
      660000 -- (-714.583) [-709.165] (-710.453) (-703.219) * (-708.941) [-704.304] (-699.822) (-703.550) -- 0:00:31

      Average standard deviation of split frequencies: 0.019979

      660500 -- (-709.803) (-706.531) (-711.287) [-704.795] * (-703.697) (-708.055) (-702.554) [-707.811] -- 0:00:31
      661000 -- (-709.785) [-707.059] (-701.612) (-705.035) * (-710.145) (-704.322) (-707.093) [-707.585] -- 0:00:31
      661500 -- [-700.576] (-706.082) (-706.475) (-703.137) * (-717.079) (-710.851) [-702.946] (-705.039) -- 0:00:31
      662000 -- [-701.270] (-704.032) (-708.181) (-702.566) * (-713.396) (-703.736) (-705.837) [-705.726] -- 0:00:31
      662500 -- (-704.711) (-711.255) [-702.955] (-712.783) * [-707.561] (-713.057) (-701.565) (-702.316) -- 0:00:32
      663000 -- (-708.158) (-712.203) [-705.709] (-703.331) * (-717.690) (-717.272) (-703.939) [-705.474] -- 0:00:32
      663500 -- [-707.779] (-704.603) (-706.881) (-708.936) * (-705.340) [-709.183] (-708.144) (-706.067) -- 0:00:31
      664000 -- (-703.309) (-710.046) [-705.913] (-701.897) * [-708.858] (-704.821) (-706.777) (-704.645) -- 0:00:31
      664500 -- (-704.103) (-703.816) [-704.161] (-705.647) * (-702.721) (-710.978) (-702.673) [-705.972] -- 0:00:31
      665000 -- [-705.493] (-704.268) (-705.274) (-711.174) * (-708.088) (-702.785) (-705.945) [-700.657] -- 0:00:31

      Average standard deviation of split frequencies: 0.019347

      665500 -- (-701.029) [-706.807] (-711.711) (-710.446) * (-706.151) (-702.277) [-707.310] (-709.726) -- 0:00:31
      666000 -- [-701.343] (-708.680) (-702.727) (-711.125) * (-707.111) [-702.083] (-704.575) (-705.663) -- 0:00:31
      666500 -- (-702.692) (-707.916) (-705.232) [-704.316] * (-710.903) (-711.225) (-703.848) [-704.031] -- 0:00:31
      667000 -- (-704.878) (-707.505) [-705.432] (-703.652) * (-711.079) (-706.426) (-707.783) [-704.322] -- 0:00:31
      667500 -- [-701.848] (-704.635) (-707.067) (-704.291) * (-709.688) (-705.917) (-707.061) [-708.745] -- 0:00:31
      668000 -- [-703.472] (-705.883) (-709.432) (-713.656) * (-710.258) (-701.092) [-701.776] (-713.377) -- 0:00:31
      668500 -- (-704.583) (-704.815) [-706.016] (-708.052) * [-704.226] (-703.241) (-709.405) (-709.244) -- 0:00:31
      669000 -- (-707.828) (-701.090) [-706.478] (-706.766) * [-706.027] (-708.131) (-702.860) (-704.118) -- 0:00:31
      669500 -- (-705.106) [-708.476] (-707.027) (-709.503) * (-708.185) [-708.006] (-704.941) (-709.062) -- 0:00:31
      670000 -- (-708.727) [-705.732] (-704.908) (-706.539) * (-706.692) (-711.534) (-711.527) [-705.361] -- 0:00:31

      Average standard deviation of split frequencies: 0.019212

      670500 -- (-706.378) (-713.592) [-707.499] (-701.531) * (-706.439) (-706.490) [-710.628] (-704.310) -- 0:00:30
      671000 -- [-707.170] (-705.065) (-703.674) (-701.033) * (-703.987) (-706.083) [-707.312] (-702.941) -- 0:00:30
      671500 -- (-701.071) (-706.183) [-703.597] (-706.770) * (-703.992) [-710.749] (-708.855) (-705.082) -- 0:00:30
      672000 -- (-707.487) [-702.737] (-707.695) (-705.522) * (-705.009) [-704.333] (-708.500) (-706.694) -- 0:00:30
      672500 -- (-704.017) (-702.972) [-709.189] (-704.127) * [-701.120] (-701.561) (-708.439) (-709.704) -- 0:00:30
      673000 -- (-703.003) (-703.654) (-703.243) [-706.608] * (-703.063) [-702.625] (-710.017) (-702.327) -- 0:00:30
      673500 -- (-704.749) (-708.143) (-703.826) [-702.220] * (-706.707) [-704.081] (-708.364) (-706.947) -- 0:00:31
      674000 -- [-703.911] (-709.184) (-706.745) (-704.317) * (-702.923) (-704.619) (-705.895) [-703.118] -- 0:00:30
      674500 -- (-705.081) (-702.934) [-707.562] (-709.854) * (-705.213) [-706.277] (-705.935) (-710.076) -- 0:00:30
      675000 -- (-709.356) (-708.424) [-704.979] (-700.770) * [-708.793] (-710.805) (-708.833) (-704.353) -- 0:00:30

      Average standard deviation of split frequencies: 0.018596

      675500 -- (-708.197) (-703.771) (-702.014) [-707.415] * (-704.415) (-707.461) [-702.748] (-708.792) -- 0:00:30
      676000 -- (-702.752) (-711.539) (-704.698) [-708.953] * (-706.731) (-711.868) (-707.614) [-702.882] -- 0:00:30
      676500 -- (-704.234) [-704.055] (-708.423) (-704.621) * [-707.551] (-705.521) (-711.061) (-705.678) -- 0:00:30
      677000 -- [-701.197] (-709.881) (-706.164) (-706.042) * (-702.890) [-710.976] (-710.492) (-705.277) -- 0:00:30
      677500 -- (-705.224) (-719.904) [-708.541] (-706.029) * [-705.038] (-702.815) (-707.906) (-708.057) -- 0:00:30
      678000 -- (-709.376) (-707.803) (-710.629) [-713.475] * (-705.303) (-709.273) [-706.181] (-706.946) -- 0:00:30
      678500 -- (-704.203) (-710.961) (-704.678) [-709.281] * (-705.470) (-708.403) (-708.039) [-704.069] -- 0:00:30
      679000 -- (-704.039) [-703.721] (-710.885) (-710.565) * (-710.429) (-704.843) [-705.186] (-706.927) -- 0:00:30
      679500 -- (-704.617) [-703.370] (-707.584) (-705.087) * (-708.855) (-705.830) [-700.681] (-704.724) -- 0:00:30
      680000 -- [-705.651] (-704.215) (-709.729) (-713.858) * (-705.751) (-711.182) (-702.760) [-706.955] -- 0:00:30

      Average standard deviation of split frequencies: 0.018468

      680500 -- (-705.127) [-705.193] (-713.113) (-708.891) * [-705.992] (-705.064) (-707.878) (-707.479) -- 0:00:30
      681000 -- (-703.086) (-699.221) [-708.476] (-707.347) * (-703.620) [-708.525] (-706.145) (-702.803) -- 0:00:29
      681500 -- (-705.826) [-701.711] (-709.233) (-706.937) * (-705.668) [-699.771] (-711.267) (-703.990) -- 0:00:29
      682000 -- [-706.048] (-703.727) (-715.486) (-711.091) * (-706.977) (-706.969) [-702.152] (-708.284) -- 0:00:29
      682500 -- (-705.380) (-703.078) [-713.356] (-706.581) * (-708.039) (-707.981) (-706.031) [-702.289] -- 0:00:29
      683000 -- (-703.396) [-711.348] (-705.897) (-703.741) * [-706.511] (-699.744) (-704.355) (-710.625) -- 0:00:29
      683500 -- [-705.590] (-717.507) (-709.788) (-711.255) * (-708.179) (-702.486) [-701.074] (-707.270) -- 0:00:29
      684000 -- [-708.567] (-713.888) (-711.069) (-703.494) * (-710.905) (-713.040) (-702.535) [-707.737] -- 0:00:29
      684500 -- (-705.180) (-713.804) (-703.510) [-706.085] * (-711.185) (-709.259) (-711.532) [-709.369] -- 0:00:29
      685000 -- [-704.103] (-709.304) (-701.566) (-706.178) * (-707.632) [-704.284] (-701.505) (-711.410) -- 0:00:29

      Average standard deviation of split frequencies: 0.018783

      685500 -- [-705.970] (-704.696) (-700.714) (-702.550) * (-707.012) (-710.120) (-704.534) [-712.714] -- 0:00:29
      686000 -- (-716.013) (-711.979) (-701.886) [-708.410] * (-708.161) (-709.087) [-704.581] (-701.946) -- 0:00:29
      686500 -- (-706.177) (-709.624) (-707.317) [-708.549] * (-705.479) (-706.515) [-701.164] (-704.547) -- 0:00:29
      687000 -- (-706.405) (-704.611) [-706.319] (-705.507) * (-709.193) (-710.802) (-704.048) [-711.290] -- 0:00:29
      687500 -- [-703.870] (-705.239) (-702.985) (-708.008) * [-704.996] (-702.728) (-705.647) (-704.451) -- 0:00:29
      688000 -- (-703.257) (-708.243) (-704.551) [-707.923] * (-703.661) [-702.536] (-707.309) (-703.141) -- 0:00:29
      688500 -- (-704.799) [-704.416] (-702.513) (-707.878) * [-705.482] (-701.596) (-704.759) (-707.199) -- 0:00:29
      689000 -- (-708.764) (-704.207) (-706.668) [-702.582] * (-716.172) [-705.117] (-707.744) (-705.420) -- 0:00:29
      689500 -- (-707.465) [-701.989] (-707.618) (-705.163) * (-704.355) [-707.480] (-704.391) (-703.084) -- 0:00:29
      690000 -- (-705.249) [-707.221] (-713.221) (-705.997) * [-702.256] (-710.757) (-703.608) (-709.252) -- 0:00:29

      Average standard deviation of split frequencies: 0.020931

      690500 -- [-703.989] (-707.900) (-705.044) (-706.012) * [-708.578] (-704.711) (-706.713) (-701.978) -- 0:00:29
      691000 -- [-706.522] (-711.490) (-703.967) (-703.076) * (-702.319) (-705.372) [-703.842] (-705.504) -- 0:00:29
      691500 -- (-704.817) (-706.930) [-702.143] (-708.048) * [-703.293] (-708.981) (-705.249) (-705.125) -- 0:00:28
      692000 -- (-704.004) (-708.699) [-703.675] (-701.581) * (-703.561) (-707.061) [-706.418] (-703.812) -- 0:00:28
      692500 -- [-704.735] (-707.416) (-705.376) (-702.251) * (-708.121) (-712.675) (-702.461) [-710.203] -- 0:00:28
      693000 -- [-707.361] (-705.014) (-707.682) (-705.609) * (-708.818) (-709.230) [-706.679] (-703.112) -- 0:00:28
      693500 -- (-703.268) [-701.798] (-707.055) (-702.502) * (-705.305) (-707.916) (-707.958) [-709.984] -- 0:00:28
      694000 -- [-704.249] (-700.975) (-703.612) (-708.812) * (-707.385) [-709.952] (-706.852) (-706.863) -- 0:00:28
      694500 -- (-706.486) (-709.757) [-714.301] (-706.082) * (-707.401) (-709.878) (-708.012) [-705.268] -- 0:00:28
      695000 -- (-709.004) (-705.529) (-706.060) [-707.453] * (-701.193) (-704.313) [-714.649] (-709.155) -- 0:00:28

      Average standard deviation of split frequencies: 0.021674

      695500 -- (-708.675) (-706.210) (-706.692) [-707.106] * (-710.111) (-707.641) (-712.702) [-706.624] -- 0:00:28
      696000 -- (-706.879) (-709.221) (-703.539) [-703.606] * [-701.560] (-712.040) (-709.821) (-709.115) -- 0:00:28
      696500 -- (-707.246) (-702.796) [-700.796] (-707.503) * [-699.410] (-701.814) (-708.894) (-710.416) -- 0:00:28
      697000 -- (-704.097) [-703.056] (-704.886) (-714.911) * (-710.399) [-703.433] (-708.550) (-715.974) -- 0:00:28
      697500 -- (-709.517) [-703.830] (-709.971) (-705.461) * [-702.230] (-707.100) (-708.901) (-709.437) -- 0:00:28
      698000 -- (-707.252) (-703.361) [-707.608] (-705.651) * (-712.368) (-705.167) [-702.748] (-709.218) -- 0:00:28
      698500 -- (-705.884) [-706.615] (-710.268) (-703.917) * (-701.633) [-705.719] (-704.159) (-706.041) -- 0:00:28
      699000 -- (-704.007) [-711.387] (-710.882) (-706.817) * (-710.031) [-706.763] (-706.415) (-700.896) -- 0:00:28
      699500 -- (-703.604) [-705.265] (-706.318) (-704.748) * (-705.633) [-705.005] (-709.246) (-711.741) -- 0:00:28
      700000 -- (-701.966) (-706.202) [-709.615] (-703.512) * [-713.182] (-705.234) (-701.419) (-708.865) -- 0:00:28

      Average standard deviation of split frequencies: 0.020632

      700500 -- (-709.047) [-703.493] (-706.366) (-714.693) * (-705.705) (-704.667) [-702.624] (-702.948) -- 0:00:28
      701000 -- [-702.276] (-705.350) (-706.696) (-704.338) * (-704.570) (-706.168) (-709.701) [-707.500] -- 0:00:28
      701500 -- [-716.544] (-709.532) (-706.344) (-705.398) * (-710.017) (-707.549) [-703.793] (-703.151) -- 0:00:28
      702000 -- [-710.636] (-704.660) (-702.731) (-705.193) * (-704.048) (-705.922) [-708.983] (-704.361) -- 0:00:28
      702500 -- [-710.973] (-701.768) (-703.366) (-702.130) * (-703.870) (-702.894) (-712.044) [-700.205] -- 0:00:27
      703000 -- [-707.329] (-712.600) (-706.805) (-705.650) * (-704.787) (-701.186) (-708.150) [-705.230] -- 0:00:27
      703500 -- [-706.200] (-713.700) (-703.782) (-706.133) * [-704.855] (-701.207) (-702.747) (-705.107) -- 0:00:27
      704000 -- (-708.885) (-712.489) [-705.861] (-703.250) * [-703.429] (-704.682) (-713.363) (-708.528) -- 0:00:27
      704500 -- (-710.068) (-713.885) [-710.411] (-704.299) * (-699.499) (-713.190) [-702.329] (-713.561) -- 0:00:27
      705000 -- (-706.220) (-705.674) [-703.258] (-700.849) * (-702.423) [-704.946] (-706.723) (-716.974) -- 0:00:27

      Average standard deviation of split frequencies: 0.020031

      705500 -- (-704.425) (-712.029) [-711.363] (-701.960) * (-700.522) (-704.197) (-707.599) [-715.806] -- 0:00:27
      706000 -- (-704.451) (-703.601) (-716.258) [-700.852] * (-711.378) (-710.081) [-704.734] (-712.692) -- 0:00:27
      706500 -- (-704.533) [-711.676] (-703.003) (-703.480) * (-706.588) [-706.067] (-709.079) (-707.317) -- 0:00:27
      707000 -- (-709.201) [-702.635] (-703.751) (-702.787) * [-702.863] (-710.260) (-711.312) (-709.375) -- 0:00:27
      707500 -- (-703.129) (-709.439) [-703.442] (-701.681) * (-707.445) [-707.613] (-706.410) (-704.543) -- 0:00:27
      708000 -- (-703.553) (-704.947) (-702.848) [-702.512] * (-701.550) [-707.243] (-713.017) (-706.738) -- 0:00:27
      708500 -- (-703.985) (-705.460) (-709.862) [-704.083] * [-704.680] (-705.232) (-706.645) (-702.842) -- 0:00:27
      709000 -- (-707.160) (-708.492) [-702.705] (-709.371) * (-707.428) (-703.957) (-709.968) [-704.878] -- 0:00:27
      709500 -- (-706.560) (-706.495) [-704.270] (-705.579) * (-706.153) (-704.274) (-706.739) [-706.298] -- 0:00:27
      710000 -- (-705.487) (-710.456) (-707.183) [-707.190] * [-707.308] (-706.107) (-711.208) (-703.479) -- 0:00:27

      Average standard deviation of split frequencies: 0.021669

      710500 -- [-702.016] (-709.051) (-704.791) (-702.774) * (-706.421) [-704.936] (-705.292) (-702.829) -- 0:00:27
      711000 -- [-700.496] (-713.628) (-706.472) (-707.387) * (-704.705) (-705.138) [-708.755] (-704.291) -- 0:00:27
      711500 -- (-702.227) (-708.400) (-708.593) [-703.325] * (-705.198) (-701.653) (-708.967) [-706.719] -- 0:00:27
      712000 -- (-703.311) (-704.155) (-705.931) [-703.314] * (-706.270) (-706.708) (-709.827) [-703.965] -- 0:00:27
      712500 -- (-704.029) [-705.802] (-713.172) (-705.062) * (-703.957) (-706.739) [-709.104] (-703.371) -- 0:00:27
      713000 -- (-704.772) (-708.902) (-707.266) [-704.795] * [-700.268] (-702.668) (-704.489) (-703.106) -- 0:00:26
      713500 -- [-708.590] (-716.577) (-706.348) (-709.634) * (-701.269) (-708.677) [-709.065] (-707.596) -- 0:00:26
      714000 -- (-716.530) (-719.913) (-703.294) [-706.592] * [-706.068] (-701.932) (-706.990) (-706.393) -- 0:00:26
      714500 -- (-706.044) (-706.469) (-706.067) [-707.126] * (-713.513) (-707.115) (-712.532) [-708.097] -- 0:00:26
      715000 -- (-703.781) (-709.937) (-708.213) [-702.648] * (-708.608) (-705.629) (-706.324) [-707.331] -- 0:00:26

      Average standard deviation of split frequencies: 0.023263

      715500 -- [-703.430] (-707.156) (-708.483) (-704.519) * (-708.178) (-705.006) [-704.317] (-705.995) -- 0:00:26
      716000 -- (-711.350) (-708.225) [-705.875] (-703.668) * (-704.662) [-707.021] (-702.947) (-702.704) -- 0:00:26
      716500 -- (-708.752) [-707.642] (-707.192) (-706.003) * [-700.898] (-712.031) (-709.304) (-711.216) -- 0:00:26
      717000 -- (-705.973) (-709.251) [-703.110] (-702.168) * (-705.345) [-702.915] (-704.443) (-702.304) -- 0:00:26
      717500 -- (-708.136) (-707.088) [-704.667] (-706.049) * (-707.705) (-707.005) (-707.188) [-705.158] -- 0:00:26
      718000 -- (-708.950) (-704.557) [-702.449] (-704.892) * (-706.057) [-704.776] (-705.497) (-704.339) -- 0:00:26
      718500 -- [-706.229] (-703.517) (-712.852) (-703.588) * (-709.892) (-700.473) (-703.496) [-705.896] -- 0:00:26
      719000 -- [-703.936] (-706.937) (-710.891) (-709.522) * [-705.432] (-704.677) (-705.942) (-707.957) -- 0:00:26
      719500 -- (-702.198) (-705.011) [-704.268] (-701.297) * (-706.591) (-700.308) [-702.218] (-709.145) -- 0:00:26
      720000 -- [-703.561] (-705.083) (-711.106) (-701.574) * (-704.425) (-706.334) [-700.581] (-703.746) -- 0:00:26

      Average standard deviation of split frequencies: 0.023985

      720500 -- [-705.412] (-703.958) (-702.077) (-701.645) * [-700.395] (-711.612) (-701.130) (-707.080) -- 0:00:26
      721000 -- (-702.580) [-708.285] (-702.481) (-707.852) * (-708.535) (-707.783) [-708.561] (-710.311) -- 0:00:26
      721500 -- (-705.990) (-703.378) (-703.565) [-704.934] * (-704.094) [-704.422] (-704.943) (-707.365) -- 0:00:26
      722000 -- (-705.832) [-702.144] (-704.644) (-704.613) * [-702.078] (-704.325) (-703.752) (-703.946) -- 0:00:26
      722500 -- (-703.943) [-705.806] (-706.544) (-704.976) * (-705.387) (-709.106) [-707.789] (-702.397) -- 0:00:26
      723000 -- (-713.082) (-705.341) (-709.153) [-700.265] * (-705.319) [-702.758] (-707.092) (-702.437) -- 0:00:26
      723500 -- (-703.143) [-702.292] (-715.471) (-705.311) * (-702.664) [-702.762] (-708.022) (-704.008) -- 0:00:25
      724000 -- (-707.590) [-702.249] (-701.808) (-701.884) * (-704.200) (-705.819) (-705.766) [-705.363] -- 0:00:25
      724500 -- (-711.523) [-703.259] (-705.000) (-709.729) * [-700.953] (-703.406) (-707.768) (-700.322) -- 0:00:25
      725000 -- (-705.625) (-703.809) (-703.438) [-702.813] * [-700.432] (-701.484) (-709.802) (-707.223) -- 0:00:25

      Average standard deviation of split frequencies: 0.022943

      725500 -- (-709.121) [-703.617] (-703.172) (-704.316) * [-703.932] (-706.447) (-708.059) (-708.251) -- 0:00:25
      726000 -- (-702.194) (-700.896) [-706.232] (-705.148) * (-703.451) (-704.751) (-705.102) [-705.827] -- 0:00:25
      726500 -- (-713.713) [-707.297] (-706.759) (-705.142) * (-705.834) [-708.992] (-705.408) (-709.128) -- 0:00:25
      727000 -- (-706.680) [-708.818] (-705.408) (-713.375) * (-705.800) [-705.773] (-701.987) (-709.572) -- 0:00:25
      727500 -- [-710.636] (-706.844) (-711.824) (-716.219) * (-707.275) [-705.722] (-702.984) (-712.842) -- 0:00:25
      728000 -- (-707.885) (-706.761) [-703.965] (-713.450) * (-702.366) [-704.128] (-700.620) (-708.044) -- 0:00:25
      728500 -- (-707.481) [-705.192] (-708.228) (-714.106) * (-706.137) (-703.698) [-704.495] (-710.594) -- 0:00:25
      729000 -- (-709.972) (-702.874) (-706.857) [-704.474] * [-699.592] (-706.657) (-706.802) (-707.505) -- 0:00:25
      729500 -- (-702.643) (-701.638) [-707.987] (-702.959) * (-704.265) (-704.211) [-701.683] (-702.718) -- 0:00:25
      730000 -- (-705.403) (-708.015) (-710.097) [-702.471] * (-703.757) [-707.646] (-709.140) (-705.509) -- 0:00:25

      Average standard deviation of split frequencies: 0.022366

      730500 -- [-707.820] (-714.087) (-703.836) (-704.540) * (-702.839) (-708.918) (-704.046) [-704.004] -- 0:00:25
      731000 -- [-711.106] (-711.531) (-703.124) (-704.995) * (-706.748) (-707.400) (-703.604) [-704.339] -- 0:00:25
      731500 -- [-704.187] (-707.761) (-708.730) (-710.952) * (-715.220) [-709.437] (-708.310) (-709.181) -- 0:00:25
      732000 -- (-706.464) (-707.463) (-704.983) [-702.581] * (-707.115) (-710.216) (-703.204) [-702.336] -- 0:00:25
      732500 -- (-705.336) (-704.566) [-706.588] (-704.072) * (-705.658) (-707.016) [-703.088] (-701.528) -- 0:00:25
      733000 -- [-703.436] (-706.928) (-704.166) (-707.805) * (-704.063) [-703.405] (-700.850) (-716.499) -- 0:00:25
      733500 -- (-701.836) (-702.893) (-703.711) [-705.591] * (-712.169) (-706.696) [-706.050] (-709.257) -- 0:00:25
      734000 -- (-702.788) [-705.612] (-712.186) (-708.345) * (-711.974) (-718.262) (-705.438) [-711.609] -- 0:00:25
      734500 -- [-701.018] (-712.438) (-712.330) (-703.796) * (-708.145) (-713.287) [-710.989] (-711.025) -- 0:00:24
      735000 -- (-704.980) [-706.737] (-703.724) (-709.902) * (-707.689) (-706.026) (-705.694) [-706.962] -- 0:00:24

      Average standard deviation of split frequencies: 0.019642

      735500 -- (-704.582) (-700.358) [-702.329] (-702.978) * [-709.171] (-712.124) (-705.853) (-703.527) -- 0:00:24
      736000 -- (-707.576) [-703.523] (-703.882) (-706.782) * (-707.959) (-702.960) (-704.506) [-704.579] -- 0:00:24
      736500 -- (-704.071) (-709.125) (-710.753) [-708.824] * (-704.823) (-704.492) [-703.324] (-707.594) -- 0:00:24
      737000 -- (-698.624) (-708.874) (-704.622) [-706.523] * (-708.675) (-708.267) (-702.299) [-706.089] -- 0:00:24
      737500 -- (-703.407) [-704.762] (-705.506) (-704.599) * (-706.181) (-705.806) (-703.396) [-711.738] -- 0:00:24
      738000 -- [-708.062] (-707.248) (-702.657) (-706.907) * (-709.537) (-703.363) [-702.699] (-701.823) -- 0:00:24
      738500 -- (-709.601) (-701.340) (-713.009) [-707.004] * (-707.488) [-702.801] (-704.213) (-700.791) -- 0:00:24
      739000 -- [-700.349] (-701.340) (-713.083) (-710.241) * [-705.839] (-702.001) (-706.496) (-713.092) -- 0:00:24
      739500 -- (-701.269) [-708.913] (-707.527) (-704.150) * [-699.915] (-709.297) (-706.324) (-709.477) -- 0:00:24
      740000 -- (-707.173) (-703.702) (-704.903) [-707.916] * [-700.317] (-702.485) (-705.140) (-703.452) -- 0:00:24

      Average standard deviation of split frequencies: 0.019518

      740500 -- [-702.507] (-706.114) (-710.156) (-704.030) * (-705.999) [-700.867] (-703.707) (-706.259) -- 0:00:24
      741000 -- (-703.633) (-705.580) [-705.193] (-704.433) * [-703.349] (-709.092) (-707.688) (-711.678) -- 0:00:24
      741500 -- (-700.437) [-701.265] (-704.401) (-703.768) * (-703.845) (-703.684) [-706.806] (-717.492) -- 0:00:24
      742000 -- (-708.676) (-706.233) [-703.000] (-702.078) * (-707.525) (-708.850) (-705.438) [-708.159] -- 0:00:24
      742500 -- [-704.148] (-714.832) (-708.275) (-706.397) * (-711.564) [-703.066] (-706.487) (-705.494) -- 0:00:24
      743000 -- (-705.322) [-705.894] (-709.290) (-705.780) * (-706.770) (-714.130) [-705.900] (-705.887) -- 0:00:24
      743500 -- (-707.758) [-706.464] (-711.541) (-707.598) * (-703.031) (-705.195) [-703.911] (-706.034) -- 0:00:24
      744000 -- (-705.854) [-707.250] (-706.647) (-701.699) * (-706.561) (-704.703) (-708.661) [-706.940] -- 0:00:24
      744500 -- (-706.890) (-706.751) [-703.070] (-705.113) * (-703.372) (-706.614) [-704.936] (-709.383) -- 0:00:24
      745000 -- (-704.351) [-707.318] (-699.886) (-708.197) * (-703.196) (-713.368) (-705.476) [-709.586] -- 0:00:23

      Average standard deviation of split frequencies: 0.019800

      745500 -- (-702.784) [-704.000] (-706.221) (-705.742) * (-711.817) (-703.364) [-702.785] (-702.242) -- 0:00:23
      746000 -- (-704.297) (-703.057) (-707.690) [-704.129] * (-709.345) (-708.193) [-710.069] (-701.854) -- 0:00:23
      746500 -- (-707.763) (-703.491) (-707.499) [-702.233] * (-710.036) [-704.609] (-707.325) (-703.172) -- 0:00:23
      747000 -- (-704.898) (-706.880) (-707.659) [-703.157] * (-711.465) [-702.493] (-706.830) (-706.165) -- 0:00:23
      747500 -- (-707.270) (-705.717) (-709.626) [-700.424] * [-705.932] (-708.192) (-708.244) (-704.652) -- 0:00:23
      748000 -- (-709.961) (-712.123) (-708.846) [-709.025] * (-703.362) (-706.053) [-704.879] (-709.235) -- 0:00:23
      748500 -- (-707.276) (-715.098) [-705.235] (-707.470) * (-709.888) (-708.201) (-704.578) [-704.025] -- 0:00:23
      749000 -- (-709.176) [-705.402] (-705.958) (-701.263) * [-706.321] (-703.275) (-709.678) (-709.491) -- 0:00:23
      749500 -- (-706.887) [-703.182] (-712.122) (-705.181) * (-711.811) [-704.179] (-705.501) (-707.133) -- 0:00:23
      750000 -- (-704.333) (-702.393) [-705.719] (-706.393) * (-704.364) (-711.891) (-707.467) [-702.764] -- 0:00:23

      Average standard deviation of split frequencies: 0.019677

      750500 -- (-705.821) (-705.451) [-707.389] (-701.697) * (-705.527) [-703.199] (-706.110) (-707.031) -- 0:00:23
      751000 -- (-710.867) (-708.261) (-707.467) [-707.580] * [-706.095] (-710.018) (-708.113) (-704.761) -- 0:00:23
      751500 -- (-709.192) (-701.863) (-705.329) [-704.658] * [-700.668] (-705.066) (-704.050) (-704.980) -- 0:00:23
      752000 -- (-708.740) (-716.705) [-704.803] (-700.922) * [-705.027] (-703.827) (-705.398) (-714.226) -- 0:00:23
      752500 -- (-709.745) (-705.383) (-703.267) [-700.456] * (-712.141) [-705.664] (-704.182) (-713.299) -- 0:00:23
      753000 -- (-711.488) (-705.286) [-705.111] (-707.645) * (-706.891) (-706.937) [-704.287] (-708.476) -- 0:00:23
      753500 -- (-706.717) [-703.018] (-702.932) (-702.173) * (-710.584) (-707.455) [-705.946] (-710.699) -- 0:00:23
      754000 -- (-708.176) (-702.968) [-708.923] (-710.745) * (-709.466) [-707.766] (-708.790) (-708.581) -- 0:00:23
      754500 -- [-704.778] (-704.957) (-710.193) (-709.540) * (-709.785) [-711.520] (-704.346) (-710.673) -- 0:00:23
      755000 -- (-705.418) [-704.631] (-708.299) (-703.353) * (-708.040) (-716.708) [-708.142] (-709.942) -- 0:00:23

      Average standard deviation of split frequencies: 0.018291

      755500 -- (-704.857) [-705.550] (-709.345) (-709.577) * (-705.815) [-704.231] (-705.207) (-704.582) -- 0:00:22
      756000 -- (-710.991) (-703.347) [-709.357] (-705.237) * [-706.271] (-703.558) (-708.861) (-704.123) -- 0:00:22
      756500 -- (-705.447) (-706.980) [-708.481] (-717.543) * (-709.782) (-710.522) (-707.079) [-702.293] -- 0:00:22
      757000 -- (-708.481) [-705.114] (-709.341) (-710.566) * (-712.094) (-708.695) (-709.939) [-707.553] -- 0:00:22
      757500 -- (-707.995) (-704.278) (-705.630) [-702.871] * (-705.845) (-704.693) (-702.699) [-705.053] -- 0:00:22
      758000 -- (-704.971) [-701.765] (-712.078) (-710.222) * (-708.775) [-703.367] (-702.376) (-704.639) -- 0:00:22
      758500 -- (-708.798) (-701.147) [-704.554] (-706.046) * (-708.557) (-700.544) (-708.858) [-711.960] -- 0:00:22
      759000 -- [-703.749] (-705.602) (-706.817) (-710.106) * (-706.209) [-700.631] (-711.062) (-708.197) -- 0:00:22
      759500 -- [-713.171] (-705.961) (-709.937) (-705.725) * [-707.666] (-710.769) (-710.173) (-708.991) -- 0:00:22
      760000 -- (-705.964) (-701.187) [-707.312] (-703.355) * (-706.284) (-705.940) (-704.475) [-705.203] -- 0:00:22

      Average standard deviation of split frequencies: 0.017765

      760500 -- (-711.103) [-702.117] (-707.284) (-707.320) * (-704.090) (-703.405) (-708.719) [-701.919] -- 0:00:22
      761000 -- (-706.270) [-706.604] (-715.339) (-704.366) * (-712.299) (-703.340) (-719.472) [-704.967] -- 0:00:22
      761500 -- (-711.724) [-704.039] (-710.565) (-707.380) * (-706.005) [-702.523] (-712.990) (-704.095) -- 0:00:22
      762000 -- (-707.162) (-708.582) [-706.088] (-708.056) * [-703.529] (-706.137) (-705.221) (-708.525) -- 0:00:22
      762500 -- (-706.829) (-714.186) (-717.034) [-706.147] * (-705.952) [-711.214] (-708.640) (-705.530) -- 0:00:22
      763000 -- (-710.366) [-704.654] (-701.264) (-717.783) * [-701.341] (-701.912) (-708.517) (-709.537) -- 0:00:22
      763500 -- (-707.636) [-707.871] (-704.851) (-714.793) * (-703.894) (-705.680) [-707.190] (-708.802) -- 0:00:22
      764000 -- [-713.140] (-706.850) (-710.260) (-712.676) * (-706.411) [-705.284] (-704.914) (-705.905) -- 0:00:22
      764500 -- (-708.707) (-714.934) [-704.886] (-702.693) * [-707.215] (-708.005) (-706.317) (-707.837) -- 0:00:22
      765000 -- (-708.178) [-709.847] (-706.680) (-702.701) * [-700.050] (-703.186) (-705.233) (-701.933) -- 0:00:22

      Average standard deviation of split frequencies: 0.016821

      765500 -- (-706.982) (-716.945) [-705.313] (-705.765) * (-707.345) (-705.319) (-701.282) [-700.732] -- 0:00:22
      766000 -- [-708.787] (-707.649) (-710.560) (-708.054) * [-701.523] (-709.337) (-699.128) (-704.081) -- 0:00:21
      766500 -- (-708.517) (-705.958) (-703.298) [-709.765] * (-701.954) [-707.856] (-705.710) (-704.548) -- 0:00:21
      767000 -- (-705.365) (-707.311) (-705.070) [-705.824] * [-704.527] (-704.413) (-708.066) (-707.524) -- 0:00:21
      767500 -- [-703.582] (-711.405) (-706.307) (-707.218) * (-707.243) [-707.265] (-708.720) (-706.460) -- 0:00:21
      768000 -- [-704.895] (-703.821) (-701.990) (-710.221) * (-700.733) [-701.372] (-704.204) (-703.394) -- 0:00:21
      768500 -- (-702.980) (-702.896) (-703.624) [-701.184] * (-699.399) (-705.645) [-702.839] (-707.638) -- 0:00:21
      769000 -- (-707.168) (-705.553) [-703.610] (-705.705) * (-708.028) (-704.967) [-703.056] (-702.375) -- 0:00:21
      769500 -- [-703.634] (-706.158) (-709.847) (-708.901) * [-705.241] (-713.040) (-705.215) (-707.502) -- 0:00:21
      770000 -- [-707.967] (-702.777) (-700.426) (-717.577) * [-702.493] (-711.665) (-713.980) (-710.996) -- 0:00:21

      Average standard deviation of split frequencies: 0.017127

      770500 -- (-706.271) (-705.237) (-701.101) [-706.784] * (-703.299) (-706.663) (-704.922) [-715.479] -- 0:00:21
      771000 -- (-708.887) [-706.623] (-704.241) (-704.825) * (-705.639) (-708.441) [-704.085] (-704.575) -- 0:00:21
      771500 -- (-707.482) [-702.078] (-704.292) (-707.155) * (-703.030) (-705.184) (-704.003) [-708.197] -- 0:00:21
      772000 -- (-704.723) [-704.530] (-705.139) (-705.899) * (-700.791) (-704.521) (-710.699) [-705.292] -- 0:00:21
      772500 -- (-703.147) (-701.284) (-704.390) [-703.801] * (-707.267) [-705.861] (-710.206) (-706.705) -- 0:00:21
      773000 -- (-704.217) (-707.165) (-705.292) [-704.551] * (-702.576) (-706.704) [-703.729] (-715.214) -- 0:00:21
      773500 -- (-705.791) [-703.529] (-703.237) (-707.697) * (-708.314) (-709.985) [-703.523] (-706.187) -- 0:00:21
      774000 -- (-704.992) [-703.009] (-710.059) (-706.235) * [-703.962] (-709.275) (-711.801) (-711.928) -- 0:00:21
      774500 -- (-704.440) [-708.374] (-702.154) (-705.967) * (-704.411) (-711.355) [-711.461] (-705.512) -- 0:00:21
      775000 -- (-706.395) [-703.995] (-710.742) (-704.106) * [-704.917] (-703.308) (-704.133) (-712.567) -- 0:00:21

      Average standard deviation of split frequencies: 0.017819

      775500 -- [-709.373] (-704.791) (-705.117) (-705.233) * (-701.000) (-705.842) (-707.225) [-711.865] -- 0:00:21
      776000 -- (-709.857) (-703.253) (-708.858) [-700.592] * (-706.946) [-710.101] (-703.489) (-707.216) -- 0:00:21
      776500 -- (-706.613) (-706.084) (-707.361) [-705.978] * (-708.417) (-702.716) [-707.902] (-707.157) -- 0:00:21
      777000 -- (-710.065) [-706.990] (-705.841) (-709.324) * (-705.272) [-704.493] (-704.635) (-706.707) -- 0:00:20
      777500 -- (-709.415) (-705.051) [-705.057] (-706.253) * [-703.972] (-703.312) (-702.130) (-709.639) -- 0:00:20
      778000 -- (-709.071) (-705.626) (-716.515) [-706.756] * (-704.302) [-703.647] (-707.307) (-711.021) -- 0:00:20
      778500 -- (-706.987) [-708.349] (-707.936) (-704.827) * (-701.855) [-707.735] (-714.170) (-705.319) -- 0:00:20
      779000 -- (-711.563) (-703.310) (-703.909) [-703.691] * (-711.716) (-706.740) [-702.797] (-703.253) -- 0:00:20
      779500 -- (-715.128) (-707.981) (-701.347) [-704.690] * (-707.198) (-707.917) (-711.230) [-707.815] -- 0:00:20
      780000 -- (-711.586) (-709.242) [-706.029] (-708.016) * (-704.795) [-706.421] (-708.346) (-706.246) -- 0:00:20

      Average standard deviation of split frequencies: 0.018921

      780500 -- (-715.133) (-711.206) [-707.454] (-700.481) * (-705.233) (-701.188) [-705.146] (-705.820) -- 0:00:20
      781000 -- (-710.069) (-714.955) [-704.074] (-706.045) * (-705.798) (-707.627) [-701.405] (-710.749) -- 0:00:20
      781500 -- (-721.006) [-704.284] (-709.777) (-703.117) * (-705.664) (-706.149) [-704.672] (-703.855) -- 0:00:20
      782000 -- (-709.856) (-708.195) (-708.354) [-705.833] * (-704.216) (-700.997) (-706.223) [-707.592] -- 0:00:20
      782500 -- [-708.734] (-705.695) (-706.209) (-703.596) * (-704.806) (-704.006) (-713.563) [-708.851] -- 0:00:20
      783000 -- (-705.818) [-704.482] (-702.570) (-708.792) * [-700.424] (-707.349) (-705.369) (-714.997) -- 0:00:20
      783500 -- (-705.184) (-709.431) (-706.431) [-705.407] * [-705.338] (-704.489) (-705.188) (-709.009) -- 0:00:20
      784000 -- (-703.503) [-704.415] (-707.446) (-703.932) * (-706.369) (-707.281) (-706.318) [-703.274] -- 0:00:20
      784500 -- (-707.059) (-706.718) (-711.932) [-701.047] * (-710.890) (-704.889) [-709.420] (-701.693) -- 0:00:20
      785000 -- (-701.477) [-707.219] (-708.029) (-712.468) * [-714.998] (-707.080) (-704.587) (-701.476) -- 0:00:20

      Average standard deviation of split frequencies: 0.018792

      785500 -- (-708.381) (-703.590) [-707.578] (-703.244) * [-705.009] (-706.827) (-707.609) (-707.490) -- 0:00:20
      786000 -- (-712.280) (-705.089) [-703.664] (-708.038) * (-703.875) (-711.524) [-706.684] (-708.483) -- 0:00:20
      786500 -- [-701.790] (-707.056) (-703.301) (-700.807) * [-703.209] (-704.577) (-704.822) (-704.866) -- 0:00:20
      787000 -- (-709.337) (-715.676) [-703.954] (-707.034) * (-706.194) [-705.276] (-704.009) (-707.070) -- 0:00:20
      787500 -- (-700.735) (-711.462) [-704.507] (-705.869) * [-710.004] (-709.513) (-702.342) (-708.695) -- 0:00:19
      788000 -- (-705.167) (-708.454) [-707.171] (-704.799) * (-711.173) [-711.202] (-705.081) (-702.698) -- 0:00:19
      788500 -- (-710.235) [-708.810] (-704.240) (-709.145) * (-709.481) [-706.625] (-708.489) (-707.420) -- 0:00:19
      789000 -- (-706.271) (-712.299) [-709.337] (-702.330) * (-703.322) (-706.032) [-703.911] (-710.145) -- 0:00:19
      789500 -- (-705.711) (-701.570) (-709.757) [-710.887] * (-707.719) (-706.373) (-704.544) [-701.695] -- 0:00:19
      790000 -- (-702.968) [-701.664] (-702.060) (-706.058) * (-703.389) (-711.506) (-704.511) [-708.683] -- 0:00:19

      Average standard deviation of split frequencies: 0.018284

      790500 -- (-708.795) [-703.740] (-709.283) (-708.036) * (-705.395) (-708.605) (-704.742) [-702.409] -- 0:00:19
      791000 -- (-714.061) (-704.266) (-710.022) [-708.458] * [-705.765] (-703.691) (-704.967) (-707.569) -- 0:00:19
      791500 -- [-705.828] (-707.485) (-713.290) (-710.750) * (-706.144) [-700.629] (-707.107) (-704.464) -- 0:00:19
      792000 -- (-703.963) [-706.061] (-719.787) (-709.551) * (-702.449) (-702.943) [-706.007] (-703.744) -- 0:00:19
      792500 -- (-704.265) (-706.524) (-708.192) [-704.007] * [-705.432] (-703.412) (-716.883) (-701.933) -- 0:00:19
      793000 -- (-702.825) (-706.426) [-710.390] (-707.620) * (-707.947) (-708.240) [-705.302] (-704.124) -- 0:00:19
      793500 -- [-703.576] (-706.192) (-707.973) (-711.545) * (-712.105) (-704.639) [-705.356] (-709.135) -- 0:00:19
      794000 -- [-703.459] (-705.852) (-705.448) (-709.336) * (-711.001) [-705.431] (-712.746) (-699.472) -- 0:00:19
      794500 -- (-703.611) (-707.246) (-705.767) [-707.517] * [-706.426] (-702.079) (-710.348) (-702.175) -- 0:00:19
      795000 -- (-707.979) [-703.724] (-708.919) (-708.819) * [-705.719] (-704.089) (-706.135) (-712.194) -- 0:00:19

      Average standard deviation of split frequencies: 0.018951

      795500 -- (-715.472) [-699.753] (-714.490) (-707.003) * (-701.555) (-707.011) [-707.705] (-712.353) -- 0:00:19
      796000 -- [-708.060] (-702.540) (-705.142) (-704.529) * (-702.883) (-711.080) [-702.386] (-710.047) -- 0:00:19
      796500 -- (-707.572) (-705.710) (-709.744) [-709.012] * (-703.449) (-702.143) [-702.123] (-707.589) -- 0:00:19
      797000 -- (-701.177) (-704.108) [-704.730] (-708.941) * [-703.187] (-703.702) (-704.567) (-705.432) -- 0:00:19
      797500 -- (-705.039) (-705.017) [-704.084] (-702.824) * (-706.173) (-708.260) (-703.799) [-708.381] -- 0:00:19
      798000 -- (-703.708) (-702.863) [-715.776] (-705.136) * (-705.838) [-701.831] (-703.344) (-708.945) -- 0:00:18
      798500 -- (-712.806) (-703.657) (-703.123) [-704.070] * (-708.287) (-702.270) [-706.885] (-707.266) -- 0:00:18
      799000 -- (-704.649) (-706.327) (-710.461) [-708.111] * (-705.775) [-704.603] (-703.645) (-704.600) -- 0:00:18
      799500 -- (-711.414) (-705.870) (-713.849) [-703.126] * (-706.410) (-705.889) [-700.436] (-703.957) -- 0:00:18
      800000 -- (-706.581) (-707.540) (-712.513) [-703.707] * (-706.146) [-712.344] (-705.102) (-705.309) -- 0:00:18

      Average standard deviation of split frequencies: 0.017270

      800500 -- (-707.116) [-704.729] (-712.319) (-708.651) * (-705.470) (-703.926) [-704.628] (-705.316) -- 0:00:18
      801000 -- (-701.848) (-708.023) (-710.801) [-704.194] * (-715.550) (-713.016) [-702.940] (-712.075) -- 0:00:18
      801500 -- (-706.234) [-707.109] (-706.022) (-714.057) * (-706.339) (-707.416) [-706.704] (-712.459) -- 0:00:18
      802000 -- (-715.052) [-701.861] (-707.985) (-720.521) * (-705.049) (-706.440) (-704.624) [-702.630] -- 0:00:18
      802500 -- (-707.714) (-703.924) (-706.522) [-704.151] * (-713.619) [-705.083] (-707.618) (-700.957) -- 0:00:18
      803000 -- (-706.903) [-700.901] (-707.368) (-716.289) * (-709.432) (-710.332) (-704.596) [-705.198] -- 0:00:18
      803500 -- (-705.249) [-699.794] (-706.918) (-704.543) * (-709.149) (-710.470) (-709.453) [-705.936] -- 0:00:18
      804000 -- (-709.504) (-709.151) [-704.767] (-703.270) * (-714.055) [-708.122] (-706.872) (-707.883) -- 0:00:18
      804500 -- (-705.700) (-705.798) (-700.036) [-704.323] * (-705.324) (-707.561) (-703.690) [-712.278] -- 0:00:18
      805000 -- (-707.233) (-709.539) [-706.724] (-705.078) * (-710.954) (-705.350) (-702.113) [-707.112] -- 0:00:18

      Average standard deviation of split frequencies: 0.018326

      805500 -- (-709.411) (-704.003) (-708.172) [-703.736] * (-709.761) [-702.488] (-701.163) (-702.188) -- 0:00:18
      806000 -- (-709.251) (-705.940) [-706.708] (-707.109) * (-707.473) (-705.200) [-708.263] (-707.334) -- 0:00:18
      806500 -- (-707.720) (-709.881) (-708.256) [-704.034] * (-707.477) (-706.675) (-705.456) [-710.104] -- 0:00:18
      807000 -- [-709.508] (-705.824) (-705.399) (-709.927) * (-711.796) [-704.282] (-703.750) (-703.037) -- 0:00:18
      807500 -- (-706.687) [-703.875] (-703.357) (-705.498) * (-711.692) (-709.550) (-701.825) [-706.838] -- 0:00:18
      808000 -- [-703.558] (-705.767) (-705.666) (-711.918) * (-713.244) (-707.308) [-699.394] (-709.880) -- 0:00:18
      808500 -- (-710.407) (-710.555) (-705.450) [-706.127] * (-713.234) (-711.524) [-706.064] (-704.628) -- 0:00:18
      809000 -- [-705.591] (-705.537) (-706.627) (-705.488) * (-703.091) (-713.938) (-706.068) [-701.631] -- 0:00:17
      809500 -- (-706.611) (-704.049) [-708.343] (-702.167) * (-704.736) (-708.920) (-708.971) [-703.359] -- 0:00:17
      810000 -- (-704.685) [-699.980] (-710.363) (-702.132) * (-712.422) (-704.608) [-708.257] (-705.795) -- 0:00:17

      Average standard deviation of split frequencies: 0.018608

      810500 -- (-707.731) [-703.779] (-708.383) (-705.161) * [-713.303] (-704.184) (-700.991) (-705.844) -- 0:00:17
      811000 -- (-701.089) (-707.388) (-712.492) [-703.647] * [-709.192] (-709.626) (-702.131) (-706.287) -- 0:00:17
      811500 -- [-705.096] (-699.846) (-711.404) (-703.576) * (-717.806) (-707.120) (-705.188) [-703.867] -- 0:00:17
      812000 -- (-703.987) (-703.200) [-707.134] (-699.890) * (-705.930) (-704.092) (-710.043) [-704.995] -- 0:00:17
      812500 -- (-703.416) (-702.103) (-709.466) [-702.708] * (-706.597) [-702.200] (-711.007) (-707.385) -- 0:00:17
      813000 -- (-711.370) (-704.226) (-707.440) [-700.986] * (-707.740) (-707.871) [-706.468] (-704.084) -- 0:00:17
      813500 -- [-703.950] (-706.311) (-708.520) (-704.178) * (-706.383) (-704.204) [-707.953] (-703.722) -- 0:00:17
      814000 -- (-702.985) (-704.247) [-706.931] (-703.832) * [-705.751] (-707.057) (-704.286) (-703.096) -- 0:00:17
      814500 -- (-705.517) (-703.419) [-703.255] (-711.607) * (-707.008) (-709.240) [-706.580] (-706.770) -- 0:00:17
      815000 -- (-704.160) [-707.259] (-707.386) (-703.884) * (-702.510) [-700.490] (-704.648) (-701.105) -- 0:00:17

      Average standard deviation of split frequencies: 0.018872

      815500 -- [-706.165] (-705.504) (-703.773) (-701.779) * [-709.673] (-704.180) (-707.067) (-705.846) -- 0:00:17
      816000 -- [-700.669] (-704.706) (-707.475) (-705.095) * [-709.614] (-708.095) (-704.252) (-704.073) -- 0:00:17
      816500 -- (-709.343) (-701.503) [-705.828] (-704.681) * (-705.020) [-706.270] (-715.886) (-701.378) -- 0:00:17
      817000 -- (-705.154) (-706.675) [-703.931] (-702.869) * [-704.287] (-704.119) (-717.351) (-704.007) -- 0:00:17
      817500 -- (-709.471) (-701.769) (-704.136) [-700.309] * [-702.347] (-707.081) (-710.184) (-705.767) -- 0:00:17
      818000 -- (-710.964) (-704.303) (-702.378) [-703.983] * (-707.410) [-708.417] (-707.443) (-708.356) -- 0:00:17
      818500 -- [-711.401] (-703.133) (-713.052) (-704.186) * (-704.601) (-707.048) (-704.919) [-705.399] -- 0:00:17
      819000 -- [-703.397] (-702.453) (-709.374) (-703.220) * (-705.325) (-709.133) (-710.308) [-702.182] -- 0:00:17
      819500 -- [-706.311] (-705.302) (-708.358) (-703.378) * [-705.597] (-708.168) (-710.277) (-704.747) -- 0:00:16
      820000 -- (-713.649) (-705.008) [-706.594] (-708.610) * (-704.906) (-704.976) [-702.339] (-701.070) -- 0:00:16

      Average standard deviation of split frequencies: 0.018764

      820500 -- (-698.874) (-703.953) (-704.145) [-706.537] * (-710.876) (-703.001) (-705.221) [-703.241] -- 0:00:16
      821000 -- (-702.637) [-701.772] (-706.184) (-708.166) * (-701.967) (-708.708) [-709.686] (-701.890) -- 0:00:16
      821500 -- (-708.339) (-705.014) (-708.196) [-705.229] * (-706.091) (-713.288) [-706.391] (-699.888) -- 0:00:16
      822000 -- (-706.439) [-703.875] (-702.334) (-709.947) * [-706.765] (-709.806) (-708.632) (-700.681) -- 0:00:16
      822500 -- (-708.876) [-711.563] (-711.174) (-702.640) * [-705.685] (-704.835) (-714.296) (-701.710) -- 0:00:16
      823000 -- (-715.757) [-706.363] (-708.171) (-700.991) * (-712.706) (-712.754) [-707.872] (-699.603) -- 0:00:16
      823500 -- (-703.466) (-713.807) (-706.165) [-704.113] * (-704.046) (-713.675) (-705.079) [-701.497] -- 0:00:16
      824000 -- [-707.015] (-703.911) (-709.008) (-705.854) * (-707.525) [-710.492] (-704.031) (-705.335) -- 0:00:16
      824500 -- (-710.294) [-708.098] (-706.275) (-705.807) * (-703.438) (-710.916) [-704.420] (-706.222) -- 0:00:16
      825000 -- (-702.053) (-704.172) [-708.137] (-702.906) * [-707.539] (-710.342) (-705.874) (-708.194) -- 0:00:16

      Average standard deviation of split frequencies: 0.017882

      825500 -- (-704.615) [-705.701] (-706.450) (-708.110) * (-710.971) (-708.251) (-711.473) [-703.388] -- 0:00:16
      826000 -- (-713.458) (-701.737) [-710.166] (-710.103) * (-704.576) [-711.854] (-714.623) (-703.967) -- 0:00:16
      826500 -- (-700.132) (-708.465) [-706.161] (-706.435) * (-710.170) (-704.235) (-707.796) [-704.338] -- 0:00:16
      827000 -- (-701.383) [-702.646] (-710.479) (-714.868) * (-706.371) (-706.572) [-704.990] (-710.222) -- 0:00:16
      827500 -- (-707.721) (-707.103) (-708.173) [-711.340] * (-705.965) (-706.230) (-705.823) [-709.426] -- 0:00:16
      828000 -- (-715.888) [-706.184] (-701.066) (-706.112) * [-703.874] (-707.008) (-706.111) (-707.927) -- 0:00:16
      828500 -- (-708.165) [-706.077] (-706.064) (-705.859) * (-705.369) [-703.662] (-705.743) (-706.182) -- 0:00:16
      829000 -- (-707.766) [-705.304] (-703.858) (-703.833) * [-703.421] (-712.095) (-711.807) (-705.676) -- 0:00:16
      829500 -- (-705.175) (-707.169) (-707.619) [-708.524] * [-705.171] (-707.410) (-714.592) (-706.282) -- 0:00:16
      830000 -- (-706.418) (-706.630) (-703.040) [-709.168] * (-708.116) (-707.144) [-700.439] (-707.064) -- 0:00:15

      Average standard deviation of split frequencies: 0.015512

      830500 -- [-700.048] (-702.413) (-710.075) (-708.288) * (-704.648) (-704.793) [-706.137] (-708.590) -- 0:00:15
      831000 -- (-706.892) (-708.053) (-704.796) [-705.306] * (-704.365) (-710.438) [-708.728] (-706.102) -- 0:00:15
      831500 -- [-704.167] (-704.526) (-712.882) (-707.306) * (-705.324) (-705.327) [-703.046] (-707.957) -- 0:00:15
      832000 -- (-710.646) (-703.276) [-706.615] (-708.928) * (-714.990) [-703.620] (-699.896) (-708.936) -- 0:00:15
      832500 -- (-706.160) (-702.649) (-703.845) [-705.394] * (-711.720) [-704.311] (-709.571) (-707.887) -- 0:00:15
      833000 -- (-710.639) [-702.535] (-710.136) (-704.222) * (-702.972) (-707.902) [-701.173] (-703.913) -- 0:00:15
      833500 -- (-710.107) (-705.689) (-703.685) [-707.327] * [-703.245] (-706.250) (-705.550) (-705.638) -- 0:00:15
      834000 -- (-710.408) (-707.094) (-705.491) [-706.798] * [-707.014] (-705.654) (-706.506) (-704.013) -- 0:00:15
      834500 -- (-716.621) (-702.340) [-701.639] (-702.339) * (-709.917) (-706.633) [-706.192] (-710.119) -- 0:00:15
      835000 -- [-711.511] (-702.598) (-702.795) (-705.042) * (-711.601) [-711.695] (-709.409) (-713.373) -- 0:00:15

      Average standard deviation of split frequencies: 0.015037

      835500 -- (-710.201) (-705.691) (-712.473) [-706.675] * (-709.256) [-704.609] (-703.996) (-702.686) -- 0:00:15
      836000 -- (-704.827) (-712.424) [-704.619] (-709.381) * (-709.599) [-703.304] (-708.504) (-712.703) -- 0:00:15
      836500 -- (-708.771) (-707.135) (-705.740) [-706.948] * (-710.945) (-701.970) (-711.403) [-706.645] -- 0:00:15
      837000 -- [-704.482] (-709.939) (-709.314) (-709.291) * (-710.462) [-705.177] (-704.978) (-707.211) -- 0:00:15
      837500 -- [-702.336] (-710.468) (-710.526) (-706.028) * (-710.630) [-708.655] (-701.002) (-708.075) -- 0:00:15
      838000 -- (-707.597) (-704.166) [-706.148] (-705.382) * [-712.800] (-706.720) (-710.871) (-703.088) -- 0:00:15
      838500 -- [-704.641] (-705.029) (-702.350) (-703.565) * (-707.399) (-704.903) (-713.115) [-700.242] -- 0:00:15
      839000 -- (-705.555) (-707.672) (-709.150) [-703.727] * (-702.653) (-706.752) [-702.969] (-705.461) -- 0:00:15
      839500 -- (-711.531) (-703.589) [-713.810] (-703.260) * (-711.686) [-703.689] (-705.632) (-707.791) -- 0:00:15
      840000 -- (-704.564) (-701.814) (-707.041) [-704.197] * (-706.187) (-700.678) (-703.819) [-709.379] -- 0:00:15

      Average standard deviation of split frequencies: 0.016449

      840500 -- [-706.636] (-702.216) (-712.374) (-715.814) * [-704.312] (-707.743) (-705.872) (-710.483) -- 0:00:14
      841000 -- (-706.904) (-702.078) (-708.906) [-701.780] * [-707.778] (-709.496) (-703.408) (-702.537) -- 0:00:14
      841500 -- (-709.978) (-701.450) [-700.926] (-707.328) * (-707.859) (-705.320) (-703.976) [-704.679] -- 0:00:14
      842000 -- (-713.364) [-708.339] (-705.067) (-704.284) * (-705.447) (-722.782) [-702.714] (-706.025) -- 0:00:14
      842500 -- (-709.090) (-705.946) (-703.082) [-707.585] * (-708.581) [-703.409] (-702.992) (-709.896) -- 0:00:14
      843000 -- (-708.243) (-707.745) (-703.466) [-702.368] * (-708.075) [-706.819] (-701.466) (-702.824) -- 0:00:14
      843500 -- (-705.202) (-702.881) [-705.457] (-707.402) * (-712.310) [-707.836] (-705.879) (-703.351) -- 0:00:14
      844000 -- (-706.745) [-702.556] (-705.664) (-708.528) * (-706.649) (-711.555) [-702.738] (-703.865) -- 0:00:14
      844500 -- (-703.751) (-702.944) [-712.586] (-710.319) * [-708.895] (-705.063) (-710.651) (-711.508) -- 0:00:14
      845000 -- (-702.060) (-707.127) (-716.588) [-707.779] * [-704.519] (-705.329) (-714.294) (-712.501) -- 0:00:14

      Average standard deviation of split frequencies: 0.015974

      845500 -- (-706.035) (-705.155) (-703.022) [-702.970] * [-705.298] (-710.654) (-704.981) (-705.741) -- 0:00:14
      846000 -- (-707.131) (-706.678) [-705.824] (-700.248) * (-705.332) (-706.598) (-701.300) [-704.775] -- 0:00:14
      846500 -- (-711.883) (-716.524) [-702.403] (-701.527) * (-708.935) (-706.180) (-704.021) [-705.844] -- 0:00:14
      847000 -- (-706.670) (-704.961) [-705.763] (-705.494) * [-711.790] (-703.469) (-701.889) (-706.055) -- 0:00:14
      847500 -- [-705.342] (-704.530) (-704.168) (-708.923) * (-702.643) (-702.283) [-702.282] (-706.324) -- 0:00:14
      848000 -- [-702.185] (-712.189) (-707.820) (-710.375) * (-706.741) [-706.091] (-707.583) (-704.094) -- 0:00:14
      848500 -- (-705.458) [-708.664] (-703.467) (-707.853) * (-701.614) (-705.653) [-707.569] (-707.530) -- 0:00:14
      849000 -- [-704.677] (-704.486) (-701.298) (-704.849) * [-704.759] (-711.891) (-704.291) (-710.911) -- 0:00:14
      849500 -- (-711.090) (-705.942) [-709.740] (-706.478) * [-705.422] (-706.291) (-708.166) (-705.260) -- 0:00:14
      850000 -- [-703.902] (-707.918) (-705.405) (-712.467) * (-711.284) (-705.622) (-706.533) [-711.845] -- 0:00:14

      Average standard deviation of split frequencies: 0.016994

      850500 -- (-709.474) (-709.696) [-711.070] (-709.769) * (-706.809) (-707.176) [-703.453] (-701.773) -- 0:00:14
      851000 -- (-704.382) (-710.254) (-705.805) [-703.158] * (-707.457) [-702.991] (-703.982) (-706.494) -- 0:00:14
      851500 -- (-717.352) (-703.656) (-704.501) [-701.866] * [-704.243] (-705.021) (-704.917) (-707.936) -- 0:00:13
      852000 -- (-706.538) (-710.312) [-703.393] (-702.985) * [-700.147] (-699.015) (-706.041) (-707.892) -- 0:00:13
      852500 -- (-710.553) [-706.494] (-704.509) (-712.760) * (-703.350) (-699.939) (-707.938) [-706.626] -- 0:00:13
      853000 -- (-707.171) (-705.381) [-701.173] (-711.023) * [-703.502] (-703.553) (-704.591) (-708.526) -- 0:00:13
      853500 -- (-706.597) (-705.907) (-706.206) [-704.969] * [-704.566] (-699.964) (-702.938) (-707.768) -- 0:00:13
      854000 -- (-713.105) (-705.878) [-714.187] (-706.896) * (-703.230) [-701.710] (-708.554) (-708.063) -- 0:00:13
      854500 -- [-703.195] (-709.712) (-706.974) (-705.219) * (-703.423) (-708.019) (-713.847) [-704.731] -- 0:00:13
      855000 -- (-707.875) (-700.134) (-707.067) [-709.299] * (-705.384) (-703.233) [-704.898] (-704.050) -- 0:00:13

      Average standard deviation of split frequencies: 0.016154

      855500 -- (-716.967) (-705.816) [-710.548] (-714.875) * (-706.353) (-707.056) [-700.395] (-702.391) -- 0:00:13
      856000 -- (-708.764) [-702.825] (-702.581) (-702.128) * [-707.505] (-704.328) (-704.718) (-699.004) -- 0:00:13
      856500 -- (-705.904) [-707.941] (-703.643) (-702.090) * (-702.652) (-707.724) (-708.364) [-706.676] -- 0:00:13
      857000 -- (-710.692) (-707.358) [-706.928] (-704.966) * (-712.679) (-710.460) [-707.422] (-708.115) -- 0:00:13
      857500 -- [-708.667] (-712.419) (-709.021) (-702.180) * (-707.222) (-707.240) (-710.201) [-710.256] -- 0:00:13
      858000 -- (-703.104) (-704.275) (-710.140) [-701.981] * (-716.783) (-715.024) (-704.222) [-708.892] -- 0:00:13
      858500 -- (-704.582) (-707.082) (-707.326) [-701.972] * (-701.998) [-706.779] (-705.214) (-712.375) -- 0:00:13
      859000 -- (-708.269) (-707.338) [-703.368] (-713.573) * [-703.397] (-705.446) (-710.625) (-708.075) -- 0:00:13
      859500 -- [-705.671] (-707.232) (-704.058) (-706.049) * (-706.627) (-711.484) (-707.055) [-705.363] -- 0:00:13
      860000 -- (-706.103) [-700.866] (-706.657) (-704.594) * (-708.715) (-707.655) [-704.864] (-703.018) -- 0:00:13

      Average standard deviation of split frequencies: 0.017892

      860500 -- (-700.583) (-702.837) (-707.141) [-706.027] * (-706.111) [-708.634] (-706.923) (-704.402) -- 0:00:13
      861000 -- [-703.697] (-703.286) (-714.092) (-704.686) * (-707.447) (-713.388) [-702.368] (-707.744) -- 0:00:13
      861500 -- (-711.443) [-707.451] (-712.715) (-703.289) * (-712.412) (-705.518) [-709.018] (-707.281) -- 0:00:13
      862000 -- (-713.064) (-708.241) [-708.675] (-706.091) * (-706.445) (-706.066) [-704.387] (-708.080) -- 0:00:12
      862500 -- (-711.819) [-707.761] (-708.573) (-706.429) * (-703.571) (-707.463) [-703.440] (-706.453) -- 0:00:12
      863000 -- [-704.434] (-708.304) (-710.061) (-705.686) * (-715.427) [-707.660] (-700.969) (-702.720) -- 0:00:12
      863500 -- (-708.943) (-704.214) (-708.950) [-706.808] * [-703.109] (-704.228) (-706.208) (-704.995) -- 0:00:12
      864000 -- (-705.611) (-705.834) (-710.428) [-708.791] * (-708.925) (-705.116) [-705.964] (-710.532) -- 0:00:12
      864500 -- (-702.719) [-705.458] (-703.402) (-704.697) * (-714.336) (-719.278) [-703.643] (-709.950) -- 0:00:12
      865000 -- [-704.490] (-704.633) (-704.204) (-703.653) * (-707.495) (-713.088) [-705.042] (-708.624) -- 0:00:12

      Average standard deviation of split frequencies: 0.017056

      865500 -- (-703.901) (-709.309) [-707.805] (-708.528) * (-705.726) [-711.127] (-703.020) (-703.525) -- 0:00:12
      866000 -- (-705.336) (-704.845) (-703.294) [-704.844] * (-703.627) [-706.611] (-710.156) (-709.798) -- 0:00:12
      866500 -- (-704.897) [-708.650] (-709.751) (-706.921) * [-704.542] (-705.946) (-707.391) (-707.737) -- 0:00:12
      867000 -- (-709.062) (-711.758) [-703.649] (-707.209) * (-709.353) [-703.243] (-706.831) (-702.808) -- 0:00:12
      867500 -- (-709.127) (-707.550) [-701.147] (-706.132) * [-702.490] (-709.221) (-709.466) (-705.021) -- 0:00:12
      868000 -- (-708.979) [-700.459] (-711.791) (-706.865) * (-707.264) (-702.904) [-703.266] (-710.167) -- 0:00:12
      868500 -- (-702.602) [-702.986] (-709.094) (-703.081) * (-708.444) (-703.479) (-701.964) [-704.034] -- 0:00:12
      869000 -- (-703.854) (-707.283) [-705.136] (-701.623) * (-708.209) (-703.890) [-706.188] (-705.803) -- 0:00:12
      869500 -- [-703.797] (-702.757) (-713.882) (-707.518) * (-699.830) (-710.062) (-709.436) [-706.647] -- 0:00:12
      870000 -- (-707.480) [-703.843] (-703.584) (-706.655) * (-703.134) [-708.831] (-706.841) (-706.563) -- 0:00:12

      Average standard deviation of split frequencies: 0.016604

      870500 -- (-704.553) (-705.905) [-704.426] (-710.113) * [-707.150] (-711.292) (-710.101) (-703.034) -- 0:00:12
      871000 -- [-700.216] (-702.845) (-704.059) (-706.722) * (-706.156) (-705.432) (-703.140) [-704.818] -- 0:00:12
      871500 -- (-708.022) (-704.643) (-709.532) [-702.464] * (-705.911) (-702.519) (-702.373) [-701.959] -- 0:00:12
      872000 -- (-706.536) [-702.410] (-705.505) (-710.374) * [-706.267] (-705.412) (-703.609) (-703.371) -- 0:00:12
      872500 -- (-704.854) (-708.041) [-705.049] (-712.857) * (-704.435) [-709.373] (-707.176) (-702.094) -- 0:00:11
      873000 -- (-705.243) [-703.637] (-705.387) (-705.937) * (-707.923) (-706.970) [-703.364] (-703.176) -- 0:00:11
      873500 -- [-702.815] (-704.589) (-708.460) (-704.452) * (-704.708) (-712.409) (-706.881) [-705.056] -- 0:00:11
      874000 -- (-704.656) (-708.557) (-707.159) [-706.658] * [-707.710] (-707.134) (-711.479) (-708.195) -- 0:00:11
      874500 -- [-704.721] (-705.291) (-703.743) (-702.235) * (-704.280) (-708.980) [-703.753] (-707.871) -- 0:00:11
      875000 -- (-717.894) [-702.139] (-704.780) (-713.310) * [-705.497] (-704.641) (-706.420) (-704.845) -- 0:00:11

      Average standard deviation of split frequencies: 0.016503

      875500 -- (-704.219) (-705.391) [-700.254] (-706.822) * (-702.978) (-703.752) (-704.615) [-712.261] -- 0:00:11
      876000 -- (-705.367) (-705.002) [-701.863] (-706.050) * [-704.458] (-703.757) (-704.499) (-703.966) -- 0:00:11
      876500 -- (-710.568) (-710.805) (-713.094) [-701.342] * (-701.907) (-707.003) (-706.297) [-701.675] -- 0:00:11
      877000 -- (-713.092) [-704.207] (-705.666) (-706.054) * [-705.817] (-707.071) (-705.941) (-704.150) -- 0:00:11
      877500 -- (-712.779) [-705.549] (-704.939) (-702.564) * [-705.629] (-699.643) (-711.098) (-706.045) -- 0:00:11
      878000 -- (-713.664) [-703.408] (-698.429) (-703.330) * (-701.320) (-704.429) (-708.901) [-702.763] -- 0:00:11
      878500 -- (-703.396) (-709.277) (-710.651) [-706.706] * (-704.551) [-701.597] (-704.295) (-702.074) -- 0:00:11
      879000 -- (-709.456) (-703.545) (-707.500) [-707.413] * [-702.067] (-704.176) (-705.946) (-710.036) -- 0:00:11
      879500 -- (-704.035) (-714.528) [-709.873] (-701.508) * [-700.953] (-713.984) (-709.621) (-704.241) -- 0:00:11
      880000 -- (-702.386) [-705.868] (-710.468) (-705.497) * (-703.553) (-704.924) (-704.044) [-708.045] -- 0:00:11

      Average standard deviation of split frequencies: 0.016058

      880500 -- [-700.558] (-709.584) (-712.209) (-705.683) * (-707.625) [-703.443] (-708.300) (-705.126) -- 0:00:11
      881000 -- (-712.618) [-705.922] (-705.861) (-702.711) * (-709.499) (-702.156) [-710.265] (-703.952) -- 0:00:11
      881500 -- (-702.086) [-705.517] (-703.206) (-713.870) * (-710.512) (-706.112) [-705.622] (-707.302) -- 0:00:11
      882000 -- (-704.257) (-707.799) (-707.212) [-700.810] * [-709.402] (-710.162) (-701.162) (-706.275) -- 0:00:11
      882500 -- (-704.657) (-706.918) [-707.301] (-702.932) * (-709.469) (-711.773) (-707.212) [-700.721] -- 0:00:11
      883000 -- (-702.675) [-701.495] (-704.369) (-709.313) * (-711.129) [-704.797] (-702.011) (-703.804) -- 0:00:10
      883500 -- [-703.776] (-711.109) (-708.685) (-710.296) * (-709.288) (-701.147) (-708.020) [-709.020] -- 0:00:10
      884000 -- (-705.546) (-703.542) [-708.425] (-703.667) * (-707.755) [-704.866] (-707.264) (-704.144) -- 0:00:10
      884500 -- (-710.690) [-704.881] (-704.036) (-706.850) * (-702.310) [-705.337] (-706.171) (-701.941) -- 0:00:10
      885000 -- (-704.324) (-705.353) [-706.843] (-709.565) * [-707.750] (-708.097) (-700.256) (-706.030) -- 0:00:10

      Average standard deviation of split frequencies: 0.015962

      885500 -- (-700.140) (-709.788) (-704.990) [-705.682] * (-705.755) [-707.524] (-704.647) (-708.346) -- 0:00:10
      886000 -- (-701.377) (-706.309) [-704.674] (-703.803) * (-704.147) [-709.114] (-703.655) (-708.054) -- 0:00:10
      886500 -- (-700.734) [-702.722] (-705.174) (-703.272) * (-704.066) [-705.991] (-709.195) (-700.691) -- 0:00:10
      887000 -- (-704.305) (-705.867) [-706.543] (-706.311) * (-704.995) [-707.942] (-702.359) (-704.415) -- 0:00:10
      887500 -- (-701.718) (-705.919) [-705.878] (-708.480) * (-704.848) (-701.113) [-703.039] (-711.685) -- 0:00:10
      888000 -- [-701.306] (-705.482) (-707.044) (-708.269) * (-706.723) [-704.508] (-708.010) (-705.890) -- 0:00:10
      888500 -- (-701.292) (-702.097) [-705.642] (-706.039) * [-703.656] (-705.443) (-707.695) (-706.609) -- 0:00:10
      889000 -- (-703.585) (-704.845) (-709.656) [-704.357] * (-707.758) (-705.528) (-704.729) [-708.155] -- 0:00:10
      889500 -- (-705.387) [-702.997] (-712.962) (-708.178) * (-710.286) [-704.482] (-705.376) (-707.868) -- 0:00:10
      890000 -- [-703.108] (-711.806) (-705.748) (-705.306) * (-703.280) [-703.950] (-708.232) (-704.360) -- 0:00:10

      Average standard deviation of split frequencies: 0.016937

      890500 -- (-702.797) (-702.685) (-708.361) [-701.447] * (-706.822) [-701.973] (-702.975) (-709.495) -- 0:00:10
      891000 -- (-705.038) (-706.149) (-712.392) [-707.917] * [-707.279] (-701.369) (-705.362) (-701.125) -- 0:00:10
      891500 -- [-703.826] (-701.460) (-699.887) (-705.116) * [-704.102] (-705.273) (-709.317) (-705.984) -- 0:00:10
      892000 -- (-704.552) (-706.883) [-701.000] (-704.162) * (-703.820) [-701.280] (-704.077) (-702.937) -- 0:00:10
      892500 -- (-707.902) (-713.524) [-700.708] (-705.498) * (-706.417) (-705.333) (-703.453) [-702.035] -- 0:00:10
      893000 -- (-707.271) (-703.463) (-702.721) [-705.534] * (-708.559) (-704.190) [-701.437] (-708.201) -- 0:00:10
      893500 -- (-706.140) (-701.740) (-708.527) [-705.325] * (-706.211) (-707.223) [-701.194] (-703.112) -- 0:00:10
      894000 -- (-712.200) (-706.573) [-702.544] (-720.134) * (-705.787) (-709.568) (-705.230) [-707.720] -- 0:00:09
      894500 -- (-703.302) [-704.044] (-702.843) (-712.023) * (-711.198) (-703.372) (-701.697) [-707.614] -- 0:00:09
      895000 -- [-706.866] (-708.426) (-709.452) (-709.754) * (-704.991) (-706.865) [-701.120] (-704.213) -- 0:00:09

      Average standard deviation of split frequencies: 0.016485

      895500 -- (-701.953) (-708.447) (-703.202) [-707.392] * (-711.539) (-705.744) [-705.152] (-707.463) -- 0:00:09
      896000 -- [-705.909] (-709.204) (-704.944) (-709.991) * [-707.780] (-702.085) (-703.631) (-713.180) -- 0:00:09
      896500 -- (-704.349) [-703.940] (-707.356) (-714.622) * (-712.882) (-705.881) [-702.930] (-708.050) -- 0:00:09
      897000 -- (-703.154) (-702.142) [-702.279] (-711.838) * (-702.871) (-703.282) [-701.543] (-708.245) -- 0:00:09
      897500 -- (-711.607) [-706.040] (-710.908) (-704.060) * (-711.157) (-708.242) [-710.011] (-708.313) -- 0:00:09
      898000 -- (-704.394) [-703.166] (-712.078) (-706.479) * (-708.263) (-704.059) (-704.332) [-702.831] -- 0:00:09
      898500 -- (-713.649) (-704.260) [-710.114] (-701.817) * (-702.844) (-706.801) (-708.792) [-708.293] -- 0:00:09
      899000 -- [-708.875] (-703.845) (-701.896) (-703.653) * (-710.735) [-707.806] (-706.689) (-708.711) -- 0:00:09
      899500 -- (-701.591) [-708.115] (-704.990) (-706.346) * (-709.535) (-707.092) [-704.786] (-708.568) -- 0:00:09
      900000 -- [-709.980] (-711.788) (-703.302) (-706.275) * (-709.133) [-706.942] (-702.210) (-712.282) -- 0:00:09

      Average standard deviation of split frequencies: 0.016749

      900500 -- (-711.175) (-707.493) [-699.864] (-705.938) * [-702.221] (-706.330) (-705.680) (-704.650) -- 0:00:09
      901000 -- (-704.579) (-704.804) (-707.650) [-704.723] * (-707.319) [-706.324] (-712.692) (-710.157) -- 0:00:09
      901500 -- (-701.728) [-709.963] (-705.728) (-704.787) * [-706.557] (-705.398) (-706.475) (-713.299) -- 0:00:09
      902000 -- (-709.893) (-702.681) [-705.629] (-706.581) * (-707.979) (-708.972) [-703.164] (-707.273) -- 0:00:09
      902500 -- [-704.707] (-704.242) (-708.920) (-704.695) * [-703.264] (-703.581) (-705.434) (-701.669) -- 0:00:09
      903000 -- (-716.474) (-702.173) (-706.639) [-703.854] * [-705.387] (-714.792) (-704.475) (-703.347) -- 0:00:09
      903500 -- (-710.793) [-702.572] (-706.871) (-701.674) * [-708.409] (-702.111) (-701.705) (-706.434) -- 0:00:09
      904000 -- (-710.263) (-703.527) [-706.772] (-704.340) * (-709.683) (-705.279) [-707.018] (-706.279) -- 0:00:09
      904500 -- (-705.825) (-709.113) (-718.896) [-702.947] * (-706.073) (-705.912) (-709.156) [-708.936] -- 0:00:08
      905000 -- (-713.228) [-706.695] (-709.195) (-708.033) * [-707.711] (-707.356) (-706.263) (-707.439) -- 0:00:08

      Average standard deviation of split frequencies: 0.017344

      905500 -- (-705.523) [-708.117] (-706.544) (-703.580) * (-713.672) (-710.077) [-702.941] (-711.297) -- 0:00:08
      906000 -- (-704.850) (-709.839) (-717.906) [-710.317] * [-704.527] (-710.385) (-703.557) (-705.530) -- 0:00:08
      906500 -- (-707.923) [-702.788] (-705.205) (-705.057) * (-705.821) (-708.801) (-707.828) [-704.436] -- 0:00:08
      907000 -- (-701.364) [-704.702] (-712.170) (-703.649) * [-704.776] (-707.605) (-709.398) (-704.021) -- 0:00:08
      907500 -- [-705.476] (-715.248) (-704.950) (-705.173) * (-709.832) [-703.627] (-705.508) (-704.877) -- 0:00:08
      908000 -- (-704.029) (-713.245) (-706.427) [-705.663] * (-703.915) (-705.002) [-705.351] (-707.365) -- 0:00:08
      908500 -- (-710.693) (-713.173) (-705.484) [-704.591] * (-707.422) [-702.619] (-707.638) (-712.904) -- 0:00:08
      909000 -- [-708.904] (-706.881) (-705.162) (-705.871) * (-702.492) (-704.892) [-709.985] (-708.014) -- 0:00:08
      909500 -- (-712.117) [-704.434] (-709.040) (-709.242) * (-704.458) (-708.818) [-704.611] (-706.719) -- 0:00:08
      910000 -- (-716.241) (-706.741) (-710.817) [-707.235] * (-706.766) (-706.513) (-705.059) [-704.713] -- 0:00:08

      Average standard deviation of split frequencies: 0.017600

      910500 -- (-708.881) [-704.634] (-708.210) (-701.201) * [-707.048] (-708.484) (-710.946) (-705.499) -- 0:00:08
      911000 -- (-704.809) [-707.706] (-707.595) (-703.782) * (-703.197) [-708.549] (-706.085) (-705.607) -- 0:00:08
      911500 -- (-711.673) (-717.881) [-715.315] (-704.390) * (-709.317) [-705.168] (-711.711) (-710.112) -- 0:00:08
      912000 -- (-707.680) [-707.248] (-711.976) (-713.480) * (-707.483) (-705.281) (-712.611) [-706.991] -- 0:00:08
      912500 -- (-703.462) [-707.728] (-709.897) (-707.858) * (-708.139) (-710.694) [-704.719] (-703.838) -- 0:00:08
      913000 -- (-703.894) (-707.492) [-709.508] (-705.005) * (-708.469) (-704.474) (-706.604) [-703.079] -- 0:00:08
      913500 -- (-710.703) (-708.403) (-704.915) [-710.927] * (-707.819) [-703.437] (-702.733) (-700.189) -- 0:00:08
      914000 -- (-704.469) [-706.248] (-707.183) (-713.225) * (-712.285) (-715.298) (-703.830) [-707.749] -- 0:00:08
      914500 -- (-701.812) (-702.613) (-707.700) [-703.680] * [-716.935] (-705.676) (-710.943) (-707.347) -- 0:00:08
      915000 -- [-705.112] (-707.878) (-704.389) (-708.008) * (-708.209) [-704.061] (-700.389) (-711.249) -- 0:00:07

      Average standard deviation of split frequencies: 0.016811

      915500 -- (-715.119) [-702.825] (-709.272) (-707.121) * (-709.698) [-705.354] (-703.639) (-704.871) -- 0:00:07
      916000 -- (-710.582) (-706.437) (-709.284) [-706.335] * (-712.257) (-706.529) [-704.574] (-710.818) -- 0:00:07
      916500 -- [-700.749] (-713.298) (-711.100) (-706.913) * (-704.414) (-703.554) [-703.051] (-708.194) -- 0:00:07
      917000 -- [-704.510] (-704.665) (-704.557) (-703.212) * (-701.105) (-716.500) (-710.398) [-699.900] -- 0:00:07
      917500 -- (-710.658) [-704.814] (-708.682) (-701.352) * (-705.036) [-709.397] (-709.738) (-708.573) -- 0:00:07
      918000 -- (-707.620) [-706.876] (-708.260) (-706.668) * (-707.152) (-714.003) [-704.715] (-705.568) -- 0:00:07
      918500 -- (-700.640) [-709.908] (-708.287) (-705.018) * (-708.284) (-701.618) [-705.724] (-706.139) -- 0:00:07
      919000 -- [-704.525] (-698.137) (-705.857) (-703.258) * (-712.745) [-708.745] (-713.233) (-709.323) -- 0:00:07
      919500 -- (-702.127) [-699.620] (-709.723) (-707.152) * (-705.587) [-705.096] (-708.742) (-707.296) -- 0:00:07
      920000 -- (-711.479) (-705.744) [-703.738] (-711.325) * [-702.896] (-707.648) (-704.390) (-702.913) -- 0:00:07

      Average standard deviation of split frequencies: 0.017409

      920500 -- (-708.832) (-706.245) [-706.421] (-711.491) * (-712.591) (-708.178) (-706.193) [-708.875] -- 0:00:07
      921000 -- [-710.387] (-701.742) (-701.759) (-709.277) * (-702.781) (-706.584) (-706.494) [-705.248] -- 0:00:07
      921500 -- (-707.718) (-716.072) [-701.817] (-703.004) * (-707.420) (-704.699) [-705.379] (-702.447) -- 0:00:07
      922000 -- (-707.179) (-704.254) [-701.368] (-703.461) * (-704.507) (-710.338) (-710.467) [-703.677] -- 0:00:07
      922500 -- [-701.894] (-703.882) (-712.537) (-704.471) * (-704.887) [-706.977] (-700.821) (-703.129) -- 0:00:07
      923000 -- (-704.178) [-700.983] (-713.277) (-708.006) * [-701.799] (-706.686) (-701.706) (-703.730) -- 0:00:07
      923500 -- [-703.456] (-707.661) (-711.338) (-707.987) * (-708.744) [-702.766] (-703.523) (-700.126) -- 0:00:07
      924000 -- (-704.979) [-704.862] (-707.583) (-708.952) * [-701.257] (-705.042) (-703.403) (-713.399) -- 0:00:07
      924500 -- (-702.868) [-703.588] (-708.441) (-707.022) * (-705.330) [-703.873] (-701.774) (-708.582) -- 0:00:07
      925000 -- (-706.816) (-708.176) (-712.422) [-703.705] * [-712.352] (-701.311) (-700.479) (-702.593) -- 0:00:07

      Average standard deviation of split frequencies: 0.016969

      925500 -- (-713.755) (-706.738) (-711.752) [-705.954] * (-707.507) (-705.831) [-702.783] (-709.282) -- 0:00:07
      926000 -- (-712.669) [-706.546] (-710.894) (-704.118) * (-707.662) [-707.428] (-700.771) (-704.746) -- 0:00:06
      926500 -- (-710.640) (-703.764) (-710.477) [-710.679] * (-708.013) [-702.837] (-707.031) (-704.963) -- 0:00:06
      927000 -- (-705.694) (-702.361) (-715.062) [-711.039] * (-705.763) [-705.721] (-707.771) (-706.752) -- 0:00:06
      927500 -- (-705.246) [-705.436] (-710.816) (-707.850) * [-705.026] (-704.804) (-709.138) (-702.560) -- 0:00:06
      928000 -- (-702.628) [-701.694] (-710.349) (-712.100) * (-704.249) [-704.727] (-708.489) (-708.336) -- 0:00:06
      928500 -- (-706.027) (-705.517) (-712.958) [-703.796] * [-707.569] (-707.075) (-706.145) (-700.638) -- 0:00:06
      929000 -- (-702.243) (-706.144) [-705.946] (-707.830) * [-708.895] (-709.850) (-711.556) (-705.994) -- 0:00:06
      929500 -- (-704.703) [-704.081] (-709.895) (-703.974) * (-704.896) [-705.189] (-711.743) (-704.237) -- 0:00:06
      930000 -- (-702.277) [-705.331] (-708.955) (-703.740) * (-703.545) [-706.309] (-709.014) (-704.629) -- 0:00:06

      Average standard deviation of split frequencies: 0.018573

      930500 -- (-709.412) (-706.595) [-708.330] (-705.491) * (-705.542) (-702.581) (-708.494) [-704.549] -- 0:00:06
      931000 -- (-706.636) [-703.415] (-702.477) (-702.991) * (-705.487) (-711.474) (-704.234) [-704.705] -- 0:00:06
      931500 -- (-704.843) [-701.840] (-704.239) (-708.326) * (-707.101) (-707.096) (-712.224) [-705.474] -- 0:00:06
      932000 -- (-710.922) (-706.305) (-702.596) [-704.823] * (-706.179) (-705.367) (-709.580) [-702.490] -- 0:00:06
      932500 -- (-703.813) (-707.069) (-706.408) [-709.469] * (-704.664) [-703.713] (-706.982) (-702.176) -- 0:00:06
      933000 -- [-703.498] (-708.479) (-710.153) (-708.604) * (-701.738) [-703.980] (-712.159) (-707.949) -- 0:00:06
      933500 -- (-705.774) (-702.634) (-707.964) [-703.954] * (-706.056) (-705.897) [-704.226] (-704.659) -- 0:00:06
      934000 -- (-702.379) (-700.451) [-701.486] (-708.699) * [-703.258] (-704.467) (-708.824) (-704.220) -- 0:00:06
      934500 -- (-711.375) (-701.458) [-704.133] (-713.274) * (-705.536) (-711.086) (-706.485) [-706.136] -- 0:00:06
      935000 -- (-716.932) [-704.339] (-702.986) (-707.207) * (-702.139) [-706.114] (-710.835) (-710.151) -- 0:00:06

      Average standard deviation of split frequencies: 0.018467

      935500 -- (-714.805) [-708.938] (-708.806) (-704.522) * (-703.072) (-710.033) [-702.352] (-711.596) -- 0:00:06
      936000 -- (-715.390) [-706.561] (-706.601) (-702.644) * [-703.796] (-705.266) (-700.908) (-709.022) -- 0:00:06
      936500 -- (-712.441) (-705.314) (-703.633) [-706.911] * (-707.273) (-706.560) (-704.653) [-708.757] -- 0:00:05
      937000 -- (-709.272) (-706.316) (-710.275) [-704.724] * (-709.128) (-703.454) [-704.484] (-709.583) -- 0:00:05
      937500 -- (-706.400) (-703.095) (-709.791) [-706.303] * (-707.944) (-714.599) [-708.681] (-706.661) -- 0:00:05
      938000 -- (-711.189) (-708.234) [-706.751] (-704.332) * (-705.876) (-705.966) (-705.567) [-704.965] -- 0:00:05
      938500 -- (-705.446) (-702.906) [-707.031] (-703.643) * [-704.203] (-705.207) (-703.795) (-709.583) -- 0:00:05
      939000 -- (-704.329) (-699.190) (-706.512) [-705.549] * (-702.277) (-706.211) (-718.548) [-706.785] -- 0:00:05
      939500 -- (-703.802) (-707.754) (-712.718) [-701.364] * (-703.460) (-705.872) (-707.956) [-712.935] -- 0:00:05
      940000 -- (-708.158) [-702.272] (-703.527) (-710.585) * (-702.648) (-706.529) (-706.046) [-703.967] -- 0:00:05

      Average standard deviation of split frequencies: 0.016705

      940500 -- (-707.898) (-704.735) [-703.599] (-710.221) * (-708.351) (-709.286) (-707.583) [-706.315] -- 0:00:05
      941000 -- [-702.354] (-704.906) (-706.840) (-705.010) * (-710.207) (-707.435) (-703.795) [-703.424] -- 0:00:05
      941500 -- (-704.429) (-702.827) (-701.289) [-705.824] * (-702.060) (-713.334) (-708.933) [-705.814] -- 0:00:05
      942000 -- [-700.047] (-706.870) (-699.356) (-709.139) * (-710.914) (-711.327) (-706.535) [-702.954] -- 0:00:05
      942500 -- [-704.789] (-708.778) (-704.277) (-702.059) * (-709.019) (-706.005) (-709.477) [-703.244] -- 0:00:05
      943000 -- [-707.947] (-710.370) (-704.878) (-708.275) * (-712.462) [-704.542] (-705.247) (-706.756) -- 0:00:05
      943500 -- (-706.721) (-704.718) [-708.096] (-719.128) * (-711.547) [-704.610] (-705.989) (-703.173) -- 0:00:05
      944000 -- [-703.790] (-707.858) (-708.018) (-704.785) * (-712.115) (-708.108) (-702.335) [-706.411] -- 0:00:05
      944500 -- (-712.803) (-709.585) [-704.781] (-704.665) * (-705.485) (-708.111) (-700.092) [-709.135] -- 0:00:05
      945000 -- (-702.194) [-702.267] (-704.809) (-705.672) * (-702.434) [-702.010] (-707.627) (-707.153) -- 0:00:05

      Average standard deviation of split frequencies: 0.017939

      945500 -- (-711.149) [-702.853] (-712.833) (-708.583) * (-711.705) (-706.670) (-708.791) [-700.892] -- 0:00:05
      946000 -- (-707.099) [-704.284] (-704.315) (-705.925) * (-706.993) (-702.595) (-706.484) [-709.731] -- 0:00:05
      946500 -- (-710.938) [-704.335] (-704.334) (-707.539) * (-705.887) [-698.890] (-708.477) (-714.924) -- 0:00:05
      947000 -- (-701.872) [-704.819] (-706.178) (-713.676) * (-706.475) (-704.865) (-710.977) [-704.675] -- 0:00:04
      947500 -- (-709.916) (-708.435) [-708.071] (-707.189) * (-711.132) [-700.374] (-708.038) (-707.235) -- 0:00:04
      948000 -- [-702.883] (-704.596) (-706.506) (-708.674) * [-706.125] (-700.741) (-712.703) (-704.878) -- 0:00:04
      948500 -- (-709.191) [-705.141] (-702.868) (-706.726) * (-703.240) [-708.757] (-715.696) (-712.569) -- 0:00:04
      949000 -- (-708.832) (-701.787) (-703.366) [-710.654] * (-703.467) [-702.217] (-703.524) (-709.561) -- 0:00:04
      949500 -- [-708.366] (-712.887) (-706.508) (-704.798) * (-704.498) (-705.140) (-714.367) [-704.798] -- 0:00:04
      950000 -- (-705.284) [-702.812] (-707.079) (-702.622) * (-701.809) (-706.973) [-706.172] (-702.551) -- 0:00:04

      Average standard deviation of split frequencies: 0.017851

      950500 -- (-705.810) [-701.003] (-707.247) (-706.406) * [-702.711] (-709.339) (-706.732) (-709.915) -- 0:00:04
      951000 -- (-711.064) (-702.483) (-707.809) [-707.604] * [-702.070] (-700.946) (-704.256) (-711.020) -- 0:00:04
      951500 -- [-709.537] (-704.955) (-707.100) (-701.850) * [-709.641] (-703.189) (-709.482) (-707.528) -- 0:00:04
      952000 -- [-709.005] (-703.121) (-703.205) (-706.831) * (-702.404) [-704.355] (-706.655) (-704.551) -- 0:00:04
      952500 -- (-703.775) (-703.528) (-709.696) [-699.099] * [-710.852] (-710.863) (-705.487) (-700.470) -- 0:00:04
      953000 -- (-705.658) [-703.391] (-710.941) (-706.091) * (-707.765) [-704.321] (-709.308) (-703.177) -- 0:00:04
      953500 -- (-707.560) [-702.653] (-708.612) (-704.586) * (-708.802) (-700.854) (-707.237) [-707.023] -- 0:00:04
      954000 -- [-705.454] (-710.543) (-710.306) (-704.524) * (-719.077) [-707.045] (-703.282) (-702.626) -- 0:00:04
      954500 -- (-705.574) (-709.968) [-702.866] (-706.157) * (-709.346) [-703.497] (-705.723) (-706.616) -- 0:00:04
      955000 -- (-711.178) (-709.373) (-707.764) [-706.313] * (-710.589) (-707.129) [-704.582] (-706.148) -- 0:00:04

      Average standard deviation of split frequencies: 0.017423

      955500 -- (-709.367) (-704.907) (-713.324) [-705.227] * (-710.064) [-703.087] (-703.567) (-711.786) -- 0:00:04
      956000 -- (-707.482) [-707.009] (-702.924) (-704.616) * (-706.224) (-705.998) (-705.478) [-705.445] -- 0:00:04
      956500 -- (-708.713) [-707.505] (-703.321) (-707.459) * [-703.191] (-705.606) (-706.969) (-703.962) -- 0:00:04
      957000 -- (-705.993) (-706.077) (-710.706) [-709.852] * (-704.717) (-703.491) (-707.209) [-706.929] -- 0:00:04
      957500 -- [-703.460] (-705.498) (-703.163) (-701.611) * [-705.932] (-703.317) (-703.816) (-715.292) -- 0:00:03
      958000 -- (-705.961) (-706.752) (-703.385) [-701.697] * [-703.865] (-711.220) (-702.904) (-711.401) -- 0:00:03
      958500 -- (-709.671) (-710.616) (-702.222) [-701.207] * (-709.692) (-703.307) (-705.392) [-705.213] -- 0:00:03
      959000 -- (-706.537) [-705.157] (-707.061) (-706.346) * (-710.699) [-705.374] (-710.155) (-711.285) -- 0:00:03
      959500 -- (-710.325) [-709.486] (-706.731) (-710.486) * (-704.757) (-708.796) [-701.018] (-712.098) -- 0:00:03
      960000 -- (-704.195) (-708.051) (-713.493) [-710.295] * (-705.876) [-705.591] (-703.166) (-709.486) -- 0:00:03

      Average standard deviation of split frequencies: 0.015703

      960500 -- (-703.297) (-708.781) [-703.818] (-702.236) * (-711.706) [-707.275] (-709.820) (-708.827) -- 0:00:03
      961000 -- (-706.497) [-700.097] (-710.975) (-707.431) * [-710.534] (-704.822) (-714.855) (-707.361) -- 0:00:03
      961500 -- (-706.309) [-703.267] (-708.420) (-704.985) * (-710.512) (-709.898) (-707.528) [-703.212] -- 0:00:03
      962000 -- (-718.032) (-708.183) (-704.063) [-707.847] * (-703.097) (-704.058) (-717.440) [-706.679] -- 0:00:03
      962500 -- (-707.137) (-705.748) (-706.906) [-702.243] * (-706.934) (-704.537) [-706.723] (-708.216) -- 0:00:03
      963000 -- (-704.680) (-709.259) [-712.059] (-708.932) * [-711.259] (-705.564) (-707.374) (-705.704) -- 0:00:03
      963500 -- (-707.195) (-705.386) [-704.073] (-706.896) * (-709.623) (-702.814) (-705.801) [-707.699] -- 0:00:03
      964000 -- (-704.230) (-709.050) [-710.597] (-704.319) * (-705.447) (-709.736) (-704.229) [-709.815] -- 0:00:03
      964500 -- (-706.733) [-715.656] (-709.250) (-705.325) * (-703.883) (-707.224) [-703.920] (-712.782) -- 0:00:03
      965000 -- (-709.957) [-699.935] (-714.332) (-704.211) * [-707.686] (-709.468) (-707.032) (-710.774) -- 0:00:03

      Average standard deviation of split frequencies: 0.015941

      965500 -- (-701.405) (-703.938) (-711.822) [-700.614] * (-710.774) (-705.143) (-707.864) [-708.369] -- 0:00:03
      966000 -- [-704.020] (-708.484) (-706.139) (-701.775) * [-709.158] (-708.339) (-704.188) (-708.986) -- 0:00:03
      966500 -- (-707.708) [-705.764] (-701.954) (-708.352) * [-709.679] (-705.226) (-704.198) (-712.596) -- 0:00:03
      967000 -- [-705.726] (-708.778) (-702.752) (-704.121) * [-703.988] (-708.920) (-704.993) (-705.937) -- 0:00:03
      967500 -- (-709.863) (-705.844) [-703.725] (-708.382) * (-705.949) (-706.560) [-702.900] (-708.797) -- 0:00:03
      968000 -- (-707.977) (-704.239) (-704.658) [-704.327] * (-709.454) (-703.327) (-707.871) [-707.704] -- 0:00:03
      968500 -- (-707.337) (-707.775) [-703.549] (-703.465) * (-708.078) (-707.395) [-705.724] (-703.199) -- 0:00:02
      969000 -- (-705.729) [-707.915] (-704.921) (-705.054) * (-705.305) (-712.364) (-718.256) [-705.055] -- 0:00:02
      969500 -- (-709.712) [-704.136] (-707.442) (-706.924) * (-707.466) (-708.819) (-707.884) [-708.700] -- 0:00:02
      970000 -- (-713.533) (-704.672) [-704.802] (-707.290) * [-699.416] (-717.859) (-710.552) (-708.088) -- 0:00:02

      Average standard deviation of split frequencies: 0.015217

      970500 -- (-708.623) [-705.330] (-707.886) (-709.224) * (-709.434) [-711.383] (-703.852) (-709.415) -- 0:00:02
      971000 -- (-710.701) (-705.363) [-704.638] (-710.539) * (-708.184) (-703.907) [-705.402] (-707.522) -- 0:00:02
      971500 -- (-708.773) [-705.309] (-700.880) (-713.356) * (-712.076) [-705.657] (-707.979) (-705.513) -- 0:00:02
      972000 -- (-707.727) [-704.883] (-706.136) (-707.869) * [-706.291] (-702.612) (-704.310) (-712.663) -- 0:00:02
      972500 -- (-705.076) [-706.431] (-703.831) (-705.103) * [-704.575] (-706.811) (-700.632) (-704.653) -- 0:00:02
      973000 -- (-704.781) (-705.951) [-703.057] (-709.108) * (-703.447) (-705.627) (-708.746) [-705.888] -- 0:00:02
      973500 -- [-704.374] (-711.254) (-707.244) (-709.671) * [-705.087] (-706.974) (-707.746) (-708.554) -- 0:00:02
      974000 -- [-713.573] (-702.640) (-707.089) (-702.906) * [-705.409] (-705.512) (-705.426) (-706.136) -- 0:00:02
      974500 -- (-708.416) [-707.261] (-703.465) (-703.936) * [-702.454] (-701.372) (-713.250) (-699.510) -- 0:00:02
      975000 -- (-710.193) (-706.414) (-710.111) [-705.419] * (-708.480) [-702.018] (-705.892) (-706.245) -- 0:00:02

      Average standard deviation of split frequencies: 0.014812

      975500 -- [-706.659] (-707.791) (-711.054) (-705.397) * (-717.840) (-708.299) [-704.253] (-707.508) -- 0:00:02
      976000 -- (-711.319) (-703.654) (-704.820) [-702.480] * (-715.341) (-708.033) [-707.610] (-708.286) -- 0:00:02
      976500 -- (-705.756) (-704.516) (-701.697) [-704.840] * (-701.757) (-708.824) [-705.253] (-712.224) -- 0:00:02
      977000 -- (-706.504) (-711.518) (-703.159) [-705.587] * (-704.346) [-710.101] (-708.567) (-703.151) -- 0:00:02
      977500 -- (-710.494) [-706.877] (-703.581) (-711.068) * [-701.738] (-711.978) (-710.559) (-705.529) -- 0:00:02
      978000 -- (-702.629) (-702.355) [-707.603] (-707.806) * (-703.378) (-707.919) [-709.617] (-715.463) -- 0:00:02
      978500 -- (-702.848) (-710.549) [-703.773] (-712.137) * (-704.157) [-706.578] (-703.649) (-714.322) -- 0:00:02
      979000 -- (-705.585) (-712.276) [-705.686] (-701.849) * (-706.989) (-710.157) (-702.240) [-702.051] -- 0:00:01
      979500 -- (-701.780) (-711.482) (-706.055) [-708.103] * (-706.513) (-707.559) [-705.242] (-707.932) -- 0:00:01
      980000 -- (-703.340) [-710.240] (-704.989) (-704.991) * (-706.259) [-704.621] (-709.650) (-710.378) -- 0:00:01

      Average standard deviation of split frequencies: 0.016344

      980500 -- (-712.759) (-704.493) [-704.703] (-709.924) * [-705.565] (-708.590) (-709.071) (-709.510) -- 0:00:01
      981000 -- (-701.879) (-706.865) [-706.924] (-702.946) * (-709.803) (-704.880) [-704.688] (-711.877) -- 0:00:01
      981500 -- (-705.081) [-702.869] (-711.990) (-704.754) * [-707.974] (-705.678) (-718.202) (-704.312) -- 0:00:01
      982000 -- (-703.926) (-706.733) [-702.475] (-718.279) * (-704.372) [-701.003] (-705.690) (-708.468) -- 0:00:01
      982500 -- (-706.575) (-705.386) (-704.642) [-708.601] * (-704.806) (-703.728) (-710.624) [-702.243] -- 0:00:01
      983000 -- (-710.377) (-707.443) (-702.433) [-705.895] * (-711.159) [-700.602] (-715.014) (-710.089) -- 0:00:01
      983500 -- (-710.789) (-705.469) [-705.341] (-707.260) * (-702.503) (-701.617) (-707.640) [-708.549] -- 0:00:01
      984000 -- (-709.613) (-705.862) (-713.402) [-708.992] * (-705.009) (-704.479) (-704.121) [-699.153] -- 0:00:01
      984500 -- (-714.309) [-701.282] (-702.772) (-711.760) * (-705.544) (-706.127) (-703.794) [-701.510] -- 0:00:01
      985000 -- (-709.480) (-702.105) (-703.421) [-711.690] * (-708.912) (-706.997) [-703.282] (-703.317) -- 0:00:01

      Average standard deviation of split frequencies: 0.015937

      985500 -- (-704.993) [-707.328] (-705.287) (-713.265) * [-703.304] (-707.077) (-706.601) (-704.745) -- 0:00:01
      986000 -- (-706.282) (-703.397) [-705.128] (-706.619) * (-707.996) [-706.072] (-703.831) (-702.896) -- 0:00:01
      986500 -- [-704.067] (-704.448) (-707.285) (-706.798) * [-700.014] (-702.413) (-703.862) (-707.141) -- 0:00:01
      987000 -- (-702.845) (-705.763) (-707.594) [-701.190] * [-703.495] (-702.971) (-711.540) (-704.700) -- 0:00:01
      987500 -- (-702.695) (-707.226) [-703.237] (-705.248) * (-706.635) (-706.525) [-702.798] (-709.344) -- 0:00:01
      988000 -- (-703.542) (-708.062) [-703.094] (-708.631) * (-706.053) [-704.271] (-703.226) (-703.340) -- 0:00:01
      988500 -- (-708.591) (-706.779) [-699.785] (-706.653) * (-704.889) (-701.584) [-705.089] (-707.304) -- 0:00:01
      989000 -- (-711.008) [-706.848] (-703.346) (-702.732) * [-707.506] (-704.391) (-705.441) (-720.868) -- 0:00:01
      989500 -- [-702.717] (-701.553) (-713.056) (-709.781) * (-703.949) [-707.860] (-709.208) (-708.755) -- 0:00:00
      990000 -- (-702.930) [-707.264] (-706.754) (-717.085) * (-704.403) (-705.715) (-705.574) [-705.765] -- 0:00:00

      Average standard deviation of split frequencies: 0.016179

      990500 -- [-706.431] (-705.430) (-704.536) (-719.717) * (-710.697) [-708.620] (-703.053) (-710.341) -- 0:00:00
      991000 -- (-703.321) [-709.651] (-706.966) (-714.132) * (-713.658) (-713.195) (-702.837) [-706.256] -- 0:00:00
      991500 -- [-706.381] (-704.578) (-711.970) (-707.974) * (-709.555) (-713.289) (-712.908) [-707.341] -- 0:00:00
      992000 -- (-708.272) (-709.119) (-704.750) [-708.165] * (-708.746) (-717.272) [-703.823] (-705.198) -- 0:00:00
      992500 -- (-704.992) [-706.985] (-703.155) (-709.632) * [-703.715] (-707.291) (-706.985) (-709.290) -- 0:00:00
      993000 -- (-708.631) (-705.907) (-702.231) [-709.939] * (-704.154) [-708.507] (-707.698) (-709.281) -- 0:00:00
      993500 -- (-709.234) [-703.491] (-707.853) (-700.141) * [-704.534] (-707.691) (-713.075) (-707.797) -- 0:00:00
      994000 -- (-701.575) (-706.757) [-710.610] (-704.744) * [-706.013] (-701.799) (-707.157) (-707.045) -- 0:00:00
      994500 -- (-718.212) [-703.489] (-703.304) (-708.956) * (-708.279) [-703.023] (-709.502) (-707.694) -- 0:00:00
      995000 -- (-712.926) (-704.604) (-702.875) [-709.193] * [-708.395] (-704.096) (-702.306) (-707.914) -- 0:00:00

      Average standard deviation of split frequencies: 0.015146

      995500 -- (-704.951) (-706.242) (-700.808) [-707.136] * (-707.296) [-704.018] (-707.511) (-705.512) -- 0:00:00
      996000 -- (-710.828) [-704.826] (-702.619) (-706.952) * (-711.365) (-705.944) (-708.396) [-705.749] -- 0:00:00
      996500 -- [-704.424] (-701.298) (-704.280) (-713.125) * [-710.324] (-713.345) (-709.367) (-707.227) -- 0:00:00
      997000 -- (-706.221) (-709.244) [-708.437] (-706.380) * (-704.488) (-709.452) [-702.715] (-706.053) -- 0:00:00
      997500 -- [-707.419] (-706.434) (-710.283) (-713.447) * (-707.958) (-706.964) (-708.164) [-703.129] -- 0:00:00
      998000 -- [-705.875] (-711.930) (-705.225) (-706.517) * [-706.998] (-708.919) (-713.807) (-708.958) -- 0:00:00
      998500 -- [-701.972] (-715.740) (-706.133) (-703.266) * (-706.736) (-706.372) (-707.319) [-711.212] -- 0:00:00
      999000 -- [-705.979] (-717.929) (-705.788) (-710.769) * (-708.576) (-706.939) (-711.977) [-705.015] -- 0:00:00
      999500 -- [-705.756] (-717.121) (-705.356) (-709.501) * [-707.695] (-711.414) (-702.136) (-703.124) -- 0:00:00
      1000000 -- (-708.445) [-711.388] (-708.017) (-709.305) * (-703.352) [-703.918] (-704.263) (-701.353) -- 0:00:00

      Average standard deviation of split frequencies: 0.016017
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -708.445495 -- 12.898220
         Chain 1 -- -708.445495 -- 12.898220
         Chain 2 -- -711.387538 -- 13.662006
         Chain 2 -- -711.387536 -- 13.662006
         Chain 3 -- -708.016904 -- 13.048941
         Chain 3 -- -708.016903 -- 13.048941
         Chain 4 -- -709.305477 -- 11.122683
         Chain 4 -- -709.305477 -- 11.122683
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -703.351557 -- 11.701639
         Chain 1 -- -703.351557 -- 11.701639
         Chain 2 -- -703.917515 -- 12.312830
         Chain 2 -- -703.917515 -- 12.312830
         Chain 3 -- -704.262675 -- 7.381429
         Chain 3 -- -704.262675 -- 7.381429
         Chain 4 -- -701.352663 -- 6.300438
         Chain 4 -- -701.352663 -- 6.300438

      Analysis completed in 1 mins 34 seconds
      Analysis used 93.65 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -697.21
      Likelihood of best state for "cold" chain of run 2 was -697.25

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            65.7 %     ( 57 %)     Dirichlet(Revmat{all})
            82.7 %     ( 71 %)     Slider(Revmat{all})
            32.6 %     ( 19 %)     Dirichlet(Pi{all})
            33.0 %     ( 27 %)     Slider(Pi{all})
            60.2 %     ( 32 %)     Multiplier(Alpha{1,2})
            47.2 %     ( 21 %)     Multiplier(Alpha{3})
            56.3 %     ( 26 %)     Slider(Pinvar{all})
            58.4 %     ( 44 %)     NNI(Tau{all},V{all})
            45.8 %     ( 29 %)     ParsSPR(Tau{all},V{all})
            26.6 %     ( 25 %)     Multiplier(V{all})
            44.4 %     ( 42 %)     Nodeslider(V{all})
            27.2 %     ( 23 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            66.0 %     ( 59 %)     Dirichlet(Revmat{all})
            83.6 %     ( 67 %)     Slider(Revmat{all})
            32.8 %     ( 26 %)     Dirichlet(Pi{all})
            33.4 %     ( 31 %)     Slider(Pi{all})
            60.3 %     ( 18 %)     Multiplier(Alpha{1,2})
            47.3 %     ( 15 %)     Multiplier(Alpha{3})
            55.7 %     ( 31 %)     Slider(Pinvar{all})
            58.3 %     ( 71 %)     NNI(Tau{all},V{all})
            45.6 %     ( 41 %)     ParsSPR(Tau{all},V{all})
            26.6 %     ( 23 %)     Multiplier(V{all})
            44.5 %     ( 45 %)     Nodeslider(V{all})
            27.2 %     ( 31 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.70    0.58 
         2 |  167017            0.85    0.73 
         3 |  165814  167288            0.86 
         4 |  167006  166371  166504         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.70    0.58 
         2 |  167236            0.85    0.73 
         3 |  166843  167073            0.87 
         4 |  165988  166496  166364         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -703.72
      |        2            2                                      |
      |               1                                            |
      |        1                                                 2 |
      |  2 1         1                      2      1    112        |
      |2    1   2                           1 1           1        |
      | 1    2    2        1   11 2           2             1 11   |
      |   1 2           * *2 12     22         2212 1       2 2    |
      |      1  1 1 1  1 2  1 1    *  * 1 1  2       2 22    * 2   |
      |  1    1  2 22            1      222  1 1    2 11 2 2       |
      | 2          1  2      2 2    1  2   1    1     2         11 |
      |1  2                          1 1   2     2   1            2|
      |       2                 22                12       1      1|
      |    2     1                1                             2  |
      |                2                                           |
      |              2   1               1                         |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -707.03
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -702.58          -711.18
        2       -702.61          -713.04
      --------------------------------------
      TOTAL     -702.59          -712.49
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.353545    0.011869    0.173850    0.567344    0.337267   1231.73   1314.19    1.000
      r(A<->C){all}   0.134583    0.004993    0.017026    0.274149    0.124185    670.55    718.75    1.001
      r(A<->G){all}   0.232416    0.008162    0.062889    0.400781    0.222796    564.92    604.17    1.003
      r(A<->T){all}   0.077586    0.002577    0.000307    0.176311    0.066528    459.26    575.83    1.001
      r(C<->G){all}   0.073809    0.003194    0.000047    0.183551    0.060621    626.64    656.34    1.000
      r(C<->T){all}   0.436022    0.010450    0.247585    0.643137    0.432490    590.03    630.17    1.001
      r(G<->T){all}   0.045584    0.001442    0.000028    0.118370    0.035980    655.93    790.78    1.000
      pi(A){all}      0.255807    0.000489    0.213427    0.300346    0.255303   1251.73   1326.22    1.000
      pi(C){all}      0.228101    0.000440    0.186222    0.266959    0.227672   1400.61   1450.81    1.000
      pi(G){all}      0.242306    0.000475    0.199529    0.282988    0.242173    723.41   1112.20    1.000
      pi(T){all}      0.273785    0.000535    0.225896    0.316271    0.273308   1337.89   1385.41    1.000
      alpha{1,2}      0.056572    0.001991    0.000136    0.135732    0.048303   1397.36   1449.18    1.000
      alpha{3}        1.548881    0.498851    0.445427    2.952872    1.443142   1486.27   1493.64    1.000
      pinvar{all}     0.574638    0.010121    0.378423    0.751864    0.587031   1299.45   1346.50    1.001
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4

   Key to taxon bipartitions (saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ----------
    1 -- .***
    2 -- .*..
    3 -- ..*.
    4 -- ...*
    5 -- .*.*
    6 -- .**.
    7 -- ..**
   ----------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    5  1469    0.489340    0.024026    0.472352    0.506329    2
    6  1022    0.340440    0.009422    0.333777    0.347102    2
    7   511    0.170220    0.014604    0.159893    0.180546    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                               95% HPD Interval
                                             --------------------
   Parameter          Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   ------------------------------------------------------------------------------------------
   length{all}[1]    0.039925    0.000346    0.007696    0.077182    0.036778    1.001    2
   length{all}[2]    0.009002    0.000060    0.000007    0.024356    0.006978    1.001    2
   length{all}[3]    0.017319    0.000102    0.000615    0.036563    0.015263    1.000    2
   length{all}[4]    0.276421    0.010172    0.115546    0.477227    0.259147    1.000    2
   length{all}[5]    0.009653    0.000060    0.000015    0.024448    0.007865    1.003    2
   length{all}[6]    0.014108    0.000180    0.000026    0.039459    0.009990    0.999    2
   length{all}[7]    0.007940    0.000062    0.000003    0.023488    0.005118    0.998    2
   ------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.016017
       Maximum standard deviation of split frequencies = 0.024026
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.003


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   +                                                                               
   |------------------------------------------------------------------------ C3 (3)
   |                                                                               
   \------------------------------------------------------------------------ C4 (4)
                                                                                   

   Phylogram (based on average branch lengths):

   /---------- C1 (1)
   |                                                                               
   |-- C2 (2)
   +                                                                               
   |---- C3 (3)
   |                                                                               
   \------------------------------------------------------------------------ C4 (4)
                                                                                   
   |------------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets