--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 06:22:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp53C14a-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.58 -711.18
2 -702.61 -713.04
--------------------------------------
TOTAL -702.59 -712.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.353545 0.011869 0.173850 0.567344 0.337267 1231.73 1314.19 1.000
r(A<->C){all} 0.134583 0.004993 0.017026 0.274149 0.124185 670.55 718.75 1.001
r(A<->G){all} 0.232416 0.008162 0.062889 0.400781 0.222796 564.92 604.17 1.003
r(A<->T){all} 0.077586 0.002577 0.000307 0.176311 0.066528 459.26 575.83 1.001
r(C<->G){all} 0.073809 0.003194 0.000047 0.183551 0.060621 626.64 656.34 1.000
r(C<->T){all} 0.436022 0.010450 0.247585 0.643137 0.432490 590.03 630.17 1.001
r(G<->T){all} 0.045584 0.001442 0.000028 0.118370 0.035980 655.93 790.78 1.000
pi(A){all} 0.255807 0.000489 0.213427 0.300346 0.255303 1251.73 1326.22 1.000
pi(C){all} 0.228101 0.000440 0.186222 0.266959 0.227672 1400.61 1450.81 1.000
pi(G){all} 0.242306 0.000475 0.199529 0.282988 0.242173 723.41 1112.20 1.000
pi(T){all} 0.273785 0.000535 0.225896 0.316271 0.273308 1337.89 1385.41 1.000
alpha{1,2} 0.056572 0.001991 0.000136 0.135732 0.048303 1397.36 1449.18 1.000
alpha{3} 1.548881 0.498851 0.445427 2.952872 1.443142 1486.27 1493.64 1.000
pinvar{all} 0.574638 0.010121 0.378423 0.751864 0.587031 1299.45 1346.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -684.335203
Model 2: PositiveSelection -684.335203
Model 0: one-ratio -684.504011
Model 3: discrete -684.272861
Model 7: beta -684.285912
Model 8: beta&w>1 -684.28592
Model 0 vs 1 0.33761600000002545
Model 2 vs 1 0.0
Model 8 vs 7 1.5999999959603883E-5
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=121
C1 MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
C2 MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
C3 MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
C4 MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
******::******:.::********************************
C1 ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
C2 ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
C3 ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
C4 VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
:*** ***:*******:****************.****************
C1 TGVGLIRPIIAKFDSLRCFDE
C2 TGVGLIRPIIAKFDSLRCFDE
C3 TGVGLIRPIIAKFDSLRCFDE
C4 TGVGLIRPIIAKFDSLRCFEE
*******************:*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1452]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [1452]--->[1452]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.203 Mb, Max= 30.385 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE
FORMAT of file /tmp/tmp6425574672323053685aln Not Supported[FATAL:T-COFFEE]
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:121 S:100 BS:121
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 98.35 C1 C2 98.35
TOP 1 0 98.35 C2 C1 98.35
BOT 0 2 99.17 C1 C3 99.17
TOP 2 0 99.17 C3 C1 99.17
BOT 0 3 91.74 C1 C4 91.74
TOP 3 0 91.74 C4 C1 91.74
BOT 1 2 99.17 C2 C3 99.17
TOP 2 1 99.17 C3 C2 99.17
BOT 1 3 90.08 C2 C4 90.08
TOP 3 1 90.08 C4 C2 90.08
BOT 2 3 90.91 C3 C4 90.91
TOP 3 2 90.91 C4 C3 90.91
AVG 0 C1 * 96.42
AVG 1 C2 * 95.87
AVG 2 C3 * 96.42
AVG 3 C4 * 90.91
TOT TOT * 94.90
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTATGCCA
C2 ATGCATTTGATTAAGATCACCTTGTTACTGAGCTTTTTGGCTTTATGCCA
C3 ATGCATTTGATTAAGATCGCCTTGTTACTGAGCTTTTTGGCTTTATGCCA
C4 ATGCATTTGATTAAGATTGCCTTTTTACTGAGCTTTTTGGCTGTAAGCCA
***************** .**** *****.************ **:****
C1 AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
C2 AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
C3 AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
C4 TAGGTCGCAAGTTCAAGCCGCAATAAGTTCGGAACTCGACCACTATCTGC
:*.******************.***************** **********
C1 GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGAACTCT
C2 GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
C3 GTTGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
C4 GGTGTTTGGAAGTGGTGACTGATGCCGGCGCCCTGATGATCGAAAACTCC
* ************************** *****.********.** **
C1 ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCGAAAAT
C2 ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGACTTTCAGCCGAAACT
C3 ATAACGGCCATAAGCCTTCTATCCGATTGCGTTGACTTTCAGCCGAAACT
C4 GTAACGGCCATAAGGCTCCTATCGGAATGCGTTGACTTTCAGCCCAAAAT
.************* ** ***** **:******** ******** ***.*
C1 CAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
C2 CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
C3 CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
C4 CAAACTAACTGGCAGTATTCTAAGATTTATCAGGGTGGCCCATCAATTCG
************ ** *****.******** **************.** *
C1 GCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCTTTACC
C2 GCAAGAAGGCGATATACGATCGACCGGAATGCCTCGTCCAAACCTTTACC
C3 GCAAGAAGGCGATATACGATCGGCCGGAATGCCTCGTACAAACCTTTACC
C4 CCAAGAAGGCGATATACGATCGACCGGAATGCCTTGTCCAAACCTTTACC
*********************.******** ** **.************
C1 ACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGCTTGAG
C2 ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
C3 ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
C4 ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGACAGCCTGAG
***************** *********************** *** ****
C1 GTGCTTTGATGAG
C2 GTGCTTTGATGAG
C3 GTGCTTTGATGAG
C4 GTGCTTTGAGGAG
********* ***
>C1
ATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTATGCCA
AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGAACTCT
ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCGAAAAT
CAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
GCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCTTTACC
ACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGCTTGAG
GTGCTTTGATGAG
>C2
ATGCATTTGATTAAGATCACCTTGTTACTGAGCTTTTTGGCTTTATGCCA
AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGACTTTCAGCCGAAACT
CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
GCAAGAAGGCGATATACGATCGACCGGAATGCCTCGTCCAAACCTTTACC
ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
GTGCTTTGATGAG
>C3
ATGCATTTGATTAAGATCGCCTTGTTACTGAGCTTTTTGGCTTTATGCCA
AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC
GTTGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT
ATAACGGCCATAAGCCTTCTATCCGATTGCGTTGACTTTCAGCCGAAACT
CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG
GCAAGAAGGCGATATACGATCGGCCGGAATGCCTCGTACAAACCTTTACC
ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG
GTGCTTTGATGAG
>C4
ATGCATTTGATTAAGATTGCCTTTTTACTGAGCTTTTTGGCTGTAAGCCA
TAGGTCGCAAGTTCAAGCCGCAATAAGTTCGGAACTCGACCACTATCTGC
GGTGTTTGGAAGTGGTGACTGATGCCGGCGCCCTGATGATCGAAAACTCC
GTAACGGCCATAAGGCTCCTATCGGAATGCGTTGACTTTCAGCCCAAAAT
CAAACTAACTGGCAGTATTCTAAGATTTATCAGGGTGGCCCATCAATTCG
CCAAGAAGGCGATATACGATCGACCGGAATGCCTTGTCCAAACCTTTACC
ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGACAGCCTGAG
GTGCTTTGAGGAG
>C1
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C2
MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C3
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE
>C4
MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFEE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479795634
Setting output file names to "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 211279184
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4687896055
Seed = 794385527
Swapseed = 1479795634
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 10 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 22 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -817.479139 -- -26.620141
Chain 2 -- -819.182820 -- -26.620141
Chain 3 -- -814.824114 -- -26.620141
Chain 4 -- -819.182820 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -817.479139 -- -26.620141
Chain 2 -- -817.479139 -- -26.620141
Chain 3 -- -819.182820 -- -26.620141
Chain 4 -- -819.182820 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-817.479] (-819.183) (-814.824) (-819.183) * [-817.479] (-817.479) (-819.183) (-819.183)
500 -- (-717.274) [-722.267] (-720.049) (-719.757) * (-726.034) [-716.515] (-719.090) (-717.953) -- 0:00:00
1000 -- (-719.099) (-722.031) [-715.097] (-716.330) * (-717.264) [-713.902] (-720.432) (-717.692) -- 0:00:00
1500 -- (-715.599) (-724.763) [-712.549] (-719.199) * (-716.846) (-710.912) (-715.129) [-715.878] -- 0:11:05
2000 -- (-710.084) (-721.931) [-712.913] (-718.087) * (-721.614) [-714.481] (-718.351) (-717.817) -- 0:08:19
2500 -- (-710.873) (-712.845) (-711.965) [-716.402] * (-721.097) (-709.402) [-710.351] (-713.766) -- 0:06:39
3000 -- (-709.703) (-714.019) [-707.876] (-719.421) * (-718.783) (-712.210) [-708.391] (-717.040) -- 0:05:32
3500 -- (-711.513) (-712.859) [-707.765] (-717.294) * (-716.882) (-711.293) [-707.685] (-707.859) -- 0:04:44
4000 -- (-709.439) (-710.617) (-709.547) [-717.123] * (-715.423) (-704.163) [-704.167] (-709.676) -- 0:04:09
4500 -- [-707.770] (-711.274) (-711.973) (-715.650) * (-719.204) (-702.073) [-703.253] (-708.658) -- 0:03:41
5000 -- (-705.240) (-707.665) (-710.879) [-713.377] * (-717.361) [-710.954] (-702.069) (-702.733) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
5500 -- [-702.772] (-704.726) (-715.388) (-712.545) * [-714.273] (-709.762) (-702.061) (-704.007) -- 0:03:00
6000 -- (-709.333) (-704.116) [-709.123] (-712.975) * (-712.919) [-703.344] (-702.532) (-702.805) -- 0:02:45
6500 -- [-709.686] (-704.459) (-715.579) (-705.202) * (-719.773) (-703.011) [-708.037] (-703.078) -- 0:02:32
7000 -- (-710.059) [-702.837] (-713.300) (-708.830) * (-713.820) [-703.452] (-703.831) (-703.976) -- 0:02:21
7500 -- (-708.779) (-702.991) (-716.124) [-707.348] * (-708.005) (-702.403) (-709.273) [-702.742] -- 0:02:12
8000 -- (-705.666) [-704.775] (-709.428) (-709.754) * (-709.406) (-700.963) (-705.476) [-700.689] -- 0:02:04
8500 -- (-708.612) (-703.073) [-707.004] (-707.963) * (-707.175) (-705.547) [-705.558] (-710.220) -- 0:01:56
9000 -- (-714.512) (-701.811) (-708.119) [-707.251] * (-705.735) (-703.981) [-706.597] (-705.159) -- 0:01:50
9500 -- (-714.835) (-703.137) (-708.500) [-707.482] * (-708.121) [-702.825] (-704.276) (-704.314) -- 0:01:44
10000 -- (-709.413) [-706.586] (-713.999) (-707.284) * (-711.395) (-703.156) (-705.714) [-709.748] -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- [-709.868] (-704.823) (-706.444) (-708.493) * (-706.763) (-703.930) [-704.236] (-702.081) -- 0:01:34
11000 -- (-712.070) [-705.146] (-713.345) (-706.895) * (-703.795) (-708.225) [-705.430] (-706.243) -- 0:01:29
11500 -- [-710.208] (-708.780) (-709.865) (-708.330) * (-705.112) (-708.188) [-702.160] (-708.612) -- 0:02:51
12000 -- (-712.381) [-700.334] (-705.220) (-705.070) * (-711.192) (-703.186) (-703.786) [-704.754] -- 0:02:44
12500 -- [-706.087] (-699.927) (-709.720) (-708.466) * (-706.425) [-705.677] (-706.163) (-704.267) -- 0:02:38
13000 -- (-706.870) [-703.402] (-703.830) (-717.949) * (-709.438) (-706.517) (-711.403) [-706.717] -- 0:02:31
13500 -- [-706.365] (-704.269) (-709.616) (-712.100) * (-705.711) (-705.090) [-706.305] (-710.757) -- 0:02:26
14000 -- (-708.489) [-706.545] (-699.284) (-708.541) * [-703.594] (-707.941) (-709.721) (-706.371) -- 0:02:20
14500 -- (-707.086) (-708.910) [-705.933] (-705.654) * (-702.656) [-703.721] (-710.340) (-707.233) -- 0:02:15
15000 -- (-706.293) (-709.380) [-715.068] (-711.923) * (-706.318) (-705.514) [-703.326] (-708.557) -- 0:02:11
Average standard deviation of split frequencies: 0.078567
15500 -- (-711.261) (-704.756) [-705.769] (-712.409) * (-702.881) [-703.286] (-705.545) (-711.425) -- 0:02:07
16000 -- (-708.861) (-702.093) (-709.862) [-708.317] * [-708.046] (-707.706) (-703.904) (-705.022) -- 0:02:03
16500 -- (-701.888) (-707.704) [-702.608] (-707.083) * (-705.013) (-711.164) (-705.542) [-713.855] -- 0:01:59
17000 -- (-709.020) (-713.239) (-704.723) [-710.021] * (-702.122) (-705.135) (-707.573) [-704.292] -- 0:01:55
17500 -- (-711.499) (-708.145) [-703.358] (-707.139) * (-706.295) [-705.733] (-716.923) (-706.304) -- 0:01:52
18000 -- [-706.993] (-704.595) (-703.019) (-704.721) * [-704.007] (-703.209) (-710.046) (-710.238) -- 0:01:49
18500 -- (-709.945) (-701.830) (-703.397) [-704.433] * (-701.523) [-706.208] (-709.569) (-710.682) -- 0:01:46
19000 -- (-710.345) (-705.366) (-704.686) [-707.595] * (-712.113) (-710.185) (-708.202) [-707.848] -- 0:01:43
19500 -- (-711.895) (-702.834) (-704.198) [-707.122] * [-707.124] (-707.987) (-711.592) (-707.049) -- 0:01:40
20000 -- (-709.060) (-699.612) [-709.173] (-712.981) * [-700.875] (-702.625) (-711.186) (-702.231) -- 0:01:38
Average standard deviation of split frequencies: 0.060826
20500 -- (-708.626) [-701.698] (-704.640) (-707.792) * [-700.816] (-702.885) (-713.140) (-707.872) -- 0:01:35
21000 -- (-718.139) (-704.418) [-708.658] (-709.236) * (-706.924) (-712.972) (-708.060) [-703.312] -- 0:01:33
21500 -- (-710.715) [-704.875] (-704.004) (-714.013) * (-704.653) (-710.929) (-716.599) [-704.563] -- 0:01:31
22000 -- [-706.709] (-709.434) (-707.493) (-712.975) * (-705.243) (-709.526) [-705.065] (-703.081) -- 0:02:13
22500 -- (-712.846) (-703.050) [-704.207] (-713.118) * (-702.100) (-704.821) [-704.340] (-707.018) -- 0:02:10
23000 -- [-706.102] (-703.512) (-704.070) (-713.388) * (-708.683) (-705.622) [-705.928] (-706.233) -- 0:02:07
23500 -- (-707.082) [-704.875] (-703.007) (-713.924) * (-705.387) (-701.542) (-705.424) [-704.994] -- 0:02:04
24000 -- (-706.672) (-704.947) [-704.529] (-710.951) * [-708.814] (-702.344) (-705.050) (-711.164) -- 0:02:02
24500 -- [-706.805] (-706.215) (-707.361) (-710.184) * (-705.221) (-708.606) (-701.791) [-708.005] -- 0:01:59
25000 -- (-703.402) [-704.077] (-703.687) (-709.294) * (-711.368) (-703.743) [-706.271] (-709.695) -- 0:01:57
Average standard deviation of split frequencies: 0.036262
25500 -- [-704.242] (-703.170) (-705.166) (-711.028) * [-706.709] (-702.732) (-704.378) (-703.897) -- 0:01:54
26000 -- [-700.409] (-702.474) (-715.085) (-707.479) * (-710.924) [-709.713] (-708.580) (-704.683) -- 0:01:52
26500 -- (-700.127) (-702.354) [-701.890] (-706.603) * [-715.987] (-701.039) (-708.651) (-708.169) -- 0:01:50
27000 -- (-706.080) [-710.617] (-705.089) (-705.803) * (-710.466) [-709.562] (-703.993) (-703.031) -- 0:01:48
27500 -- (-707.738) (-706.364) (-708.807) [-706.043] * (-707.576) (-703.690) (-706.529) [-702.834] -- 0:01:46
28000 -- [-705.673] (-705.080) (-704.812) (-705.821) * (-707.779) [-703.440] (-703.442) (-701.956) -- 0:01:44
28500 -- (-703.320) (-702.387) [-703.685] (-706.300) * (-714.392) (-708.064) (-703.035) [-705.785] -- 0:01:42
29000 -- (-703.974) [-703.577] (-701.808) (-706.327) * (-714.221) (-701.891) (-702.005) [-705.583] -- 0:01:40
29500 -- (-707.303) [-708.051] (-702.378) (-703.688) * (-706.681) (-703.014) [-702.678] (-708.254) -- 0:01:38
30000 -- (-705.693) [-705.123] (-713.466) (-702.698) * [-708.259] (-705.225) (-704.617) (-706.971) -- 0:01:37
Average standard deviation of split frequencies: 0.010248
30500 -- (-705.057) (-706.407) [-706.664] (-705.658) * (-706.884) (-707.579) (-712.096) [-708.427] -- 0:01:35
31000 -- (-704.714) [-707.082] (-709.601) (-700.365) * (-708.751) (-706.623) (-704.088) [-708.568] -- 0:01:33
31500 -- (-705.394) (-703.375) (-711.502) [-700.501] * (-711.126) (-704.034) [-699.716] (-706.343) -- 0:01:32
32000 -- (-704.923) [-707.427] (-711.905) (-705.683) * (-709.774) [-705.729] (-708.612) (-706.103) -- 0:01:30
32500 -- (-699.293) (-708.004) (-706.379) [-707.323] * (-706.216) (-705.150) (-706.410) [-705.477] -- 0:01:29
33000 -- [-704.197] (-704.039) (-703.138) (-709.081) * (-711.551) [-705.473] (-707.858) (-704.909) -- 0:01:57
33500 -- (-707.924) (-706.966) (-704.479) [-700.789] * (-709.026) (-705.351) [-704.114] (-706.985) -- 0:01:55
34000 -- (-712.582) (-705.056) (-704.871) [-701.232] * (-711.725) [-711.912] (-707.069) (-701.773) -- 0:01:53
34500 -- [-707.720] (-707.998) (-703.357) (-706.792) * (-707.869) (-707.861) (-705.986) [-702.902] -- 0:01:51
35000 -- (-706.715) (-702.584) (-703.906) [-706.817] * (-711.567) (-714.699) [-705.994] (-702.357) -- 0:01:50
Average standard deviation of split frequencies: 0.026189
35500 -- (-709.771) [-704.238] (-706.079) (-699.633) * [-709.433] (-706.620) (-706.901) (-706.581) -- 0:01:48
36000 -- (-708.442) (-701.359) [-705.067] (-701.717) * (-709.684) [-705.728] (-704.565) (-699.759) -- 0:01:47
36500 -- (-709.863) (-701.634) [-708.708] (-702.912) * (-709.265) (-702.424) [-702.726] (-714.837) -- 0:01:45
37000 -- (-713.702) (-701.386) (-710.324) [-702.540] * (-707.404) (-709.198) [-711.532] (-707.003) -- 0:01:44
37500 -- (-706.706) [-705.428] (-705.674) (-709.148) * (-707.837) (-706.050) (-708.348) [-702.683] -- 0:01:42
38000 -- (-705.965) [-706.272] (-706.364) (-708.520) * (-710.814) [-702.425] (-704.147) (-707.220) -- 0:01:41
38500 -- (-709.479) (-702.067) (-702.252) [-704.995] * (-711.435) (-706.780) [-701.883] (-706.759) -- 0:01:39
39000 -- (-710.786) (-703.812) [-708.002] (-705.135) * [-707.794] (-704.083) (-709.445) (-701.939) -- 0:01:38
39500 -- (-707.843) (-706.551) (-705.287) [-702.992] * (-711.474) (-703.061) [-702.276] (-702.692) -- 0:01:37
40000 -- (-705.240) (-707.723) [-702.485] (-704.214) * (-717.850) [-703.621] (-710.833) (-704.033) -- 0:01:36
Average standard deviation of split frequencies: 0.023184
40500 -- (-705.057) [-711.474] (-703.396) (-706.103) * (-711.824) (-703.038) [-703.740] (-701.272) -- 0:01:34
41000 -- (-707.611) (-703.734) (-703.760) [-704.133] * (-711.891) (-705.408) [-711.496] (-706.632) -- 0:01:33
41500 -- (-704.935) (-706.301) (-706.104) [-702.713] * (-712.977) [-705.851] (-703.445) (-707.469) -- 0:01:32
42000 -- (-701.074) (-703.941) (-702.098) [-704.245] * (-712.211) (-708.489) [-704.804] (-708.834) -- 0:01:31
42500 -- (-705.762) (-708.561) [-705.836] (-703.605) * (-709.481) [-703.678] (-705.445) (-706.794) -- 0:01:30
43000 -- (-703.358) (-708.384) (-707.175) [-704.450] * (-708.492) (-707.130) [-704.736] (-705.959) -- 0:01:29
43500 -- [-711.763] (-704.487) (-707.219) (-710.291) * (-707.092) (-703.771) (-704.453) [-707.568] -- 0:01:27
44000 -- (-706.692) (-705.816) [-710.779] (-700.965) * (-707.881) (-702.088) (-706.381) [-707.567] -- 0:01:26
44500 -- (-709.663) (-713.151) (-707.665) [-704.933] * (-706.178) [-703.172] (-708.063) (-707.889) -- 0:01:47
45000 -- [-705.281] (-705.898) (-711.616) (-704.456) * (-705.196) [-703.784] (-705.491) (-705.057) -- 0:01:46
Average standard deviation of split frequencies: 0.034160
45500 -- (-705.907) [-703.324] (-712.102) (-706.827) * (-708.297) [-702.303] (-703.784) (-709.044) -- 0:01:44
46000 -- (-704.444) (-705.192) [-711.147] (-704.144) * [-706.606] (-705.816) (-707.590) (-704.727) -- 0:01:43
46500 -- (-702.483) [-706.821] (-713.458) (-703.301) * (-704.850) (-708.797) [-703.591] (-712.129) -- 0:01:42
47000 -- (-708.029) [-706.223] (-711.853) (-709.200) * [-704.396] (-709.372) (-705.131) (-709.468) -- 0:01:41
47500 -- (-706.990) (-710.922) (-707.545) [-700.905] * (-706.576) [-703.440] (-703.919) (-713.614) -- 0:01:40
48000 -- (-706.857) (-707.350) (-707.981) [-702.199] * (-704.713) (-706.769) (-701.395) [-701.087] -- 0:01:39
48500 -- [-705.674] (-706.466) (-711.774) (-700.893) * (-708.505) [-708.835] (-703.975) (-706.975) -- 0:01:38
49000 -- (-704.527) [-705.171] (-711.658) (-704.859) * [-701.257] (-701.578) (-701.004) (-704.434) -- 0:01:37
49500 -- (-708.154) (-702.043) (-713.630) [-704.151] * (-701.761) [-702.051] (-702.329) (-705.445) -- 0:01:36
50000 -- (-711.277) [-702.970] (-708.097) (-706.725) * (-703.474) (-702.745) [-704.825] (-710.304) -- 0:01:35
Average standard deviation of split frequencies: 0.006203
50500 -- (-705.783) (-714.957) (-704.736) [-711.194] * (-704.712) (-700.560) [-703.977] (-709.570) -- 0:01:34
51000 -- (-707.955) (-705.421) (-710.136) [-705.012] * (-706.296) (-704.268) (-703.555) [-704.384] -- 0:01:33
51500 -- [-711.536] (-707.881) (-703.072) (-705.951) * [-703.014] (-707.420) (-704.967) (-704.067) -- 0:01:32
52000 -- (-701.687) (-708.140) [-705.525] (-709.488) * (-707.266) [-710.604] (-708.416) (-706.545) -- 0:01:31
52500 -- [-703.238] (-714.110) (-704.450) (-709.885) * (-707.467) (-709.913) (-708.868) [-708.264] -- 0:01:30
53000 -- (-708.300) (-706.400) (-704.457) [-712.712] * (-710.169) [-706.332] (-705.271) (-708.758) -- 0:01:29
53500 -- (-706.778) (-719.682) [-701.805] (-706.907) * (-704.204) (-711.416) [-706.779] (-708.206) -- 0:01:28
54000 -- [-706.549] (-706.366) (-705.763) (-707.349) * (-701.149) (-710.188) [-700.824] (-707.498) -- 0:01:27
54500 -- (-707.701) (-703.640) (-705.943) [-705.004] * (-705.708) (-705.353) (-711.687) [-703.192] -- 0:01:26
55000 -- (-709.293) [-705.360] (-700.996) (-711.291) * [-705.368] (-701.069) (-706.784) (-708.348) -- 0:01:25
Average standard deviation of split frequencies: 0.022448
55500 -- (-709.954) [-708.892] (-704.307) (-708.586) * [-698.822] (-707.361) (-700.933) (-706.476) -- 0:01:42
56000 -- [-705.114] (-707.678) (-703.189) (-707.221) * (-703.304) (-705.032) (-704.891) [-704.750] -- 0:01:41
56500 -- (-702.606) [-706.618] (-703.575) (-705.791) * (-703.038) [-715.372] (-703.667) (-707.018) -- 0:01:40
57000 -- (-708.983) (-706.702) (-700.057) [-699.757] * [-704.504] (-712.384) (-716.658) (-710.835) -- 0:01:39
57500 -- (-702.395) [-707.265] (-705.583) (-705.222) * (-709.819) (-706.430) [-708.780] (-716.221) -- 0:01:38
58000 -- (-711.373) (-706.675) [-704.242] (-708.229) * (-707.294) [-708.397] (-708.395) (-712.529) -- 0:01:37
58500 -- (-711.881) (-708.737) (-710.922) [-708.997] * [-703.699] (-707.352) (-707.251) (-706.551) -- 0:01:36
59000 -- (-707.935) [-704.695] (-710.311) (-708.688) * (-706.130) [-707.464] (-703.746) (-707.517) -- 0:01:35
59500 -- (-712.197) [-708.660] (-709.751) (-715.662) * (-700.780) [-711.822] (-708.596) (-706.010) -- 0:01:34
60000 -- [-707.929] (-713.925) (-710.899) (-714.241) * (-702.487) (-707.598) [-703.148] (-706.034) -- 0:01:34
Average standard deviation of split frequencies: 0.025901
60500 -- [-705.989] (-711.936) (-703.919) (-712.683) * (-703.667) (-708.491) [-704.964] (-709.189) -- 0:01:33
61000 -- (-706.415) (-717.229) (-710.107) [-706.892] * [-700.848] (-705.736) (-704.111) (-712.921) -- 0:01:32
61500 -- (-704.041) (-710.831) (-711.500) [-710.380] * (-703.700) (-704.752) [-707.345] (-715.907) -- 0:01:31
62000 -- (-700.886) (-711.496) [-706.812] (-712.650) * (-703.535) [-706.429] (-705.116) (-716.076) -- 0:01:30
62500 -- [-703.842] (-709.475) (-708.200) (-711.165) * (-701.788) (-702.681) (-706.724) [-711.501] -- 0:01:30
63000 -- (-701.021) [-706.166] (-704.609) (-711.990) * [-707.404] (-713.222) (-707.315) (-710.942) -- 0:01:29
63500 -- (-710.691) [-709.212] (-705.711) (-706.906) * (-711.147) [-704.655] (-704.321) (-714.071) -- 0:01:28
64000 -- (-710.700) (-715.602) [-706.269] (-712.681) * (-706.693) (-703.598) (-704.116) [-706.005] -- 0:01:27
64500 -- (-705.461) (-707.447) [-705.528] (-714.909) * [-708.061] (-703.768) (-705.434) (-704.653) -- 0:01:27
65000 -- (-706.711) (-705.122) (-704.847) [-707.670] * [-702.675] (-708.676) (-709.814) (-709.078) -- 0:01:26
Average standard deviation of split frequencies: 0.009523
65500 -- (-708.239) (-712.072) (-714.250) [-707.051] * (-707.717) [-702.531] (-711.747) (-701.984) -- 0:01:25
66000 -- (-704.002) (-704.810) (-705.123) [-700.681] * (-708.121) [-707.496] (-712.141) (-706.212) -- 0:01:39
66500 -- (-709.045) (-707.122) (-707.431) [-701.471] * (-706.810) [-702.890] (-709.394) (-707.192) -- 0:01:38
67000 -- (-708.122) [-702.834] (-706.912) (-704.042) * (-708.505) (-704.026) [-705.386] (-710.674) -- 0:01:37
67500 -- [-705.410] (-703.669) (-709.562) (-716.995) * (-710.455) [-705.583] (-708.793) (-703.523) -- 0:01:36
68000 -- (-703.789) (-707.292) [-708.839] (-707.217) * (-709.312) [-701.843] (-706.352) (-703.796) -- 0:01:35
68500 -- (-707.786) (-703.952) (-713.090) [-708.448] * [-707.796] (-699.222) (-706.533) (-713.244) -- 0:01:35
69000 -- (-710.011) [-705.673] (-710.714) (-703.579) * (-707.636) (-704.834) (-705.250) [-709.911] -- 0:01:34
69500 -- (-704.218) (-705.901) (-708.166) [-704.392] * (-705.198) (-709.508) [-706.413] (-708.906) -- 0:01:33
70000 -- (-703.451) (-705.225) [-709.656] (-709.251) * (-703.045) (-708.571) (-703.301) [-701.684] -- 0:01:33
Average standard deviation of split frequencies: 0.031130
70500 -- [-710.661] (-705.799) (-717.259) (-710.481) * (-709.545) (-707.099) [-705.400] (-704.540) -- 0:01:32
71000 -- [-707.654] (-703.969) (-710.321) (-710.901) * [-711.128] (-707.171) (-706.373) (-703.767) -- 0:01:31
71500 -- [-713.120] (-709.693) (-711.620) (-715.691) * (-707.465) (-703.820) (-706.763) [-706.961] -- 0:01:30
72000 -- (-711.366) (-717.533) [-716.304] (-709.367) * (-714.798) (-709.182) [-706.096] (-707.288) -- 0:01:30
72500 -- (-706.239) (-706.231) (-723.006) [-711.043] * (-714.538) (-702.950) (-709.716) [-703.438] -- 0:01:29
73000 -- [-707.855] (-704.336) (-713.208) (-718.762) * (-713.011) (-701.705) (-712.719) [-708.047] -- 0:01:28
73500 -- (-704.157) [-707.087] (-707.201) (-706.791) * (-712.160) (-709.289) [-706.565] (-705.103) -- 0:01:28
74000 -- (-709.740) [-701.915] (-711.432) (-712.088) * (-707.043) [-705.912] (-706.062) (-703.689) -- 0:01:27
74500 -- (-709.280) (-705.402) (-707.358) [-707.783] * (-711.161) (-706.088) (-703.802) [-703.428] -- 0:01:26
75000 -- (-710.629) (-707.507) (-708.272) [-703.294] * [-706.806] (-705.318) (-706.503) (-702.217) -- 0:01:26
Average standard deviation of split frequencies: 0.037216
75500 -- (-710.733) (-706.102) (-709.293) [-704.250] * (-707.281) (-706.021) [-709.454] (-712.243) -- 0:01:25
76000 -- (-703.120) (-708.624) (-711.548) [-711.451] * (-713.158) [-701.360] (-703.944) (-703.968) -- 0:01:25
76500 -- [-706.279] (-705.658) (-708.610) (-708.697) * (-717.348) (-704.801) (-708.003) [-702.149] -- 0:01:24
77000 -- (-705.833) [-704.742] (-709.662) (-706.983) * (-712.417) (-709.068) (-708.528) [-703.007] -- 0:01:35
77500 -- (-703.235) (-707.365) (-707.104) [-705.776] * (-713.631) (-708.966) (-704.424) [-705.773] -- 0:01:35
78000 -- [-703.109] (-709.567) (-707.604) (-706.169) * (-710.139) (-711.302) (-707.718) [-710.012] -- 0:01:34
78500 -- (-711.546) (-705.409) [-704.186] (-705.880) * (-712.682) [-703.295] (-705.629) (-707.883) -- 0:01:33
79000 -- [-704.984] (-704.913) (-704.751) (-707.003) * (-714.781) (-708.580) [-703.925] (-709.479) -- 0:01:33
79500 -- [-703.922] (-705.032) (-704.393) (-709.073) * (-713.072) (-713.744) (-706.501) [-705.628] -- 0:01:32
80000 -- (-709.257) (-706.160) (-703.255) [-713.259] * [-703.583] (-706.568) (-705.337) (-703.349) -- 0:01:32
Average standard deviation of split frequencies: 0.046751
80500 -- (-714.041) [-706.138] (-709.415) (-710.598) * (-707.118) (-708.790) [-715.251] (-709.175) -- 0:01:31
81000 -- (-701.800) (-704.046) [-702.031] (-706.457) * [-706.710] (-707.272) (-705.973) (-717.732) -- 0:01:30
81500 -- (-704.457) (-706.789) [-705.499] (-702.203) * (-707.552) (-705.224) [-706.684] (-705.470) -- 0:01:30
82000 -- (-705.064) (-702.089) [-701.567] (-706.122) * (-707.065) (-701.329) [-710.482] (-702.977) -- 0:01:29
82500 -- [-714.145] (-704.274) (-709.315) (-710.625) * (-705.784) [-702.215] (-705.272) (-705.274) -- 0:01:28
83000 -- (-705.343) (-706.910) [-700.880] (-708.778) * (-707.705) [-703.400] (-706.314) (-707.858) -- 0:01:28
83500 -- (-711.375) (-705.119) [-702.113] (-713.426) * (-702.144) [-706.514] (-705.295) (-705.483) -- 0:01:27
84000 -- [-710.908] (-705.322) (-703.657) (-704.608) * (-706.219) (-716.177) (-708.468) [-708.038] -- 0:01:27
84500 -- [-698.173] (-704.211) (-708.240) (-709.556) * (-705.315) (-706.095) (-708.852) [-703.692] -- 0:01:26
85000 -- (-706.814) [-708.817] (-705.543) (-704.471) * (-704.064) (-704.642) [-706.179] (-704.801) -- 0:01:26
Average standard deviation of split frequencies: 0.032889
85500 -- (-708.365) [-702.195] (-711.379) (-704.320) * (-706.004) (-709.852) [-705.248] (-704.768) -- 0:01:25
86000 -- (-702.792) (-706.347) (-710.322) [-700.758] * [-702.534] (-707.140) (-711.364) (-702.909) -- 0:01:25
86500 -- (-707.875) (-704.322) [-700.456] (-700.850) * (-706.808) (-715.068) (-711.649) [-701.267] -- 0:01:24
87000 -- [-701.889] (-709.361) (-702.277) (-703.912) * [-705.086] (-708.615) (-706.344) (-700.836) -- 0:01:23
87500 -- (-707.092) (-706.895) [-706.666] (-715.956) * [-705.559] (-718.094) (-704.453) (-698.467) -- 0:01:23
88000 -- (-703.945) (-706.799) (-704.799) [-707.533] * (-700.933) (-712.543) [-712.556] (-703.428) -- 0:01:33
88500 -- (-713.875) (-703.357) (-704.799) [-705.273] * (-706.836) (-704.709) (-709.625) [-706.372] -- 0:01:32
89000 -- (-709.211) (-706.189) [-704.106] (-703.566) * (-714.078) [-705.347] (-707.378) (-705.671) -- 0:01:32
89500 -- (-706.225) (-703.974) (-708.729) [-705.210] * [-703.405] (-702.267) (-704.431) (-705.821) -- 0:01:31
90000 -- [-710.256] (-708.382) (-714.267) (-704.773) * (-709.479) (-704.016) (-708.335) [-715.189] -- 0:01:31
Average standard deviation of split frequencies: 0.031196
90500 -- [-704.268] (-706.302) (-702.400) (-709.720) * (-705.416) [-703.403] (-706.521) (-713.311) -- 0:01:30
91000 -- (-703.870) [-707.267] (-705.306) (-712.778) * (-707.263) [-706.776] (-706.472) (-712.819) -- 0:01:29
91500 -- (-703.754) (-708.521) [-705.981] (-706.563) * [-712.413] (-703.933) (-704.334) (-712.824) -- 0:01:29
92000 -- (-714.342) [-706.590] (-708.317) (-709.252) * (-711.075) (-707.232) (-703.885) [-708.918] -- 0:01:28
92500 -- [-703.059] (-704.245) (-704.395) (-704.593) * [-706.885] (-706.297) (-704.766) (-708.435) -- 0:01:28
93000 -- (-703.818) [-703.118] (-706.543) (-705.723) * [-705.894] (-704.747) (-705.358) (-707.390) -- 0:01:27
93500 -- (-708.037) (-705.808) [-703.535] (-705.750) * (-712.491) (-705.560) [-705.800] (-712.720) -- 0:01:27
94000 -- (-707.893) [-702.850] (-707.982) (-707.397) * (-708.688) (-710.152) (-702.322) [-707.957] -- 0:01:26
94500 -- (-701.407) (-706.186) (-704.730) [-708.668] * [-709.553] (-707.687) (-705.336) (-709.311) -- 0:01:26
95000 -- (-704.586) (-706.137) [-707.259] (-707.300) * (-704.884) (-709.356) [-706.566] (-713.113) -- 0:01:25
Average standard deviation of split frequencies: 0.036010
95500 -- (-706.157) [-702.592] (-704.537) (-705.622) * [-707.143] (-707.518) (-710.970) (-713.337) -- 0:01:25
96000 -- [-706.563] (-705.043) (-706.401) (-706.086) * (-706.903) (-708.000) (-705.075) [-705.543] -- 0:01:24
96500 -- (-701.503) (-710.963) (-702.756) [-706.099] * (-706.513) (-710.779) (-704.150) [-706.037] -- 0:01:24
97000 -- (-705.831) (-708.815) [-709.835] (-705.664) * (-706.286) [-706.674] (-703.908) (-709.004) -- 0:01:23
97500 -- (-702.754) (-702.351) [-702.844] (-705.651) * (-704.240) (-707.995) [-703.851] (-709.009) -- 0:01:23
98000 -- (-708.639) (-704.139) (-703.103) [-701.598] * [-704.778] (-707.230) (-701.338) (-713.873) -- 0:01:22
98500 -- (-708.337) [-710.330] (-706.606) (-703.832) * (-703.034) (-702.570) (-709.790) [-705.500] -- 0:01:31
99000 -- (-704.941) (-707.868) [-704.964] (-707.232) * (-706.942) [-702.707] (-703.162) (-704.364) -- 0:01:31
99500 -- (-707.000) (-701.618) [-703.869] (-703.537) * (-707.394) (-702.673) (-704.427) [-703.494] -- 0:01:30
100000 -- (-710.102) [-704.909] (-708.953) (-704.810) * [-708.625] (-701.677) (-706.404) (-707.570) -- 0:01:30
Average standard deviation of split frequencies: 0.046828
100500 -- (-711.444) [-702.543] (-707.969) (-704.483) * (-701.889) [-701.194] (-704.923) (-704.919) -- 0:01:29
101000 -- [-706.573] (-709.938) (-705.936) (-707.770) * (-702.704) (-713.537) [-704.610] (-711.113) -- 0:01:29
101500 -- (-707.613) (-705.238) [-707.359] (-703.967) * (-707.845) (-707.300) [-703.181] (-709.697) -- 0:01:28
102000 -- (-711.805) (-701.721) (-705.323) [-704.450] * [-702.726] (-703.929) (-703.530) (-705.469) -- 0:01:28
102500 -- (-710.912) [-702.656] (-711.721) (-704.878) * (-706.028) [-701.591] (-701.699) (-707.310) -- 0:01:27
103000 -- (-707.211) (-702.721) (-710.642) [-705.263] * (-706.638) (-702.798) (-704.452) [-709.034] -- 0:01:27
103500 -- (-704.496) (-706.197) [-703.512] (-702.185) * [-706.106] (-708.252) (-706.074) (-708.868) -- 0:01:26
104000 -- (-706.084) (-702.756) [-703.603] (-704.917) * (-708.207) (-703.219) (-705.178) [-708.887] -- 0:01:26
104500 -- (-704.787) [-707.041] (-707.470) (-704.033) * (-706.586) (-705.369) [-701.597] (-703.865) -- 0:01:25
105000 -- (-705.715) (-700.788) (-704.885) [-709.182] * (-704.514) (-708.741) [-708.041] (-707.092) -- 0:01:25
Average standard deviation of split frequencies: 0.035578
105500 -- (-710.584) (-705.534) (-700.994) [-703.609] * (-713.149) (-706.360) (-706.518) [-707.890] -- 0:01:24
106000 -- (-712.574) [-705.425] (-704.496) (-701.388) * (-702.224) (-707.789) [-704.457] (-703.681) -- 0:01:24
106500 -- [-713.458] (-702.153) (-706.242) (-703.434) * (-710.489) (-703.027) [-703.134] (-702.190) -- 0:01:23
107000 -- (-705.326) [-706.293] (-708.135) (-702.273) * (-710.523) (-707.459) (-705.438) [-704.095] -- 0:01:23
107500 -- (-703.723) [-705.475] (-708.817) (-708.123) * [-704.018] (-701.395) (-708.331) (-704.298) -- 0:01:23
108000 -- (-700.626) (-706.015) (-713.962) [-708.301] * (-711.484) (-700.467) (-708.738) [-704.218] -- 0:01:22
108500 -- [-704.781] (-709.909) (-708.166) (-705.615) * (-702.055) (-707.405) (-704.646) [-701.254] -- 0:01:22
109000 -- (-702.803) (-703.766) (-707.258) [-710.852] * (-704.237) [-703.217] (-710.151) (-705.215) -- 0:01:21
109500 -- (-701.729) (-703.655) (-704.671) [-703.706] * [-704.467] (-709.884) (-704.936) (-706.844) -- 0:01:29
110000 -- (-699.457) [-701.059] (-706.953) (-703.261) * (-708.717) [-705.780] (-711.800) (-703.055) -- 0:01:29
Average standard deviation of split frequencies: 0.031238
110500 -- (-714.459) (-703.316) (-705.278) [-708.740] * [-705.245] (-707.672) (-708.972) (-706.148) -- 0:01:28
111000 -- (-708.212) (-706.348) (-704.909) [-708.776] * (-711.097) (-708.342) [-705.194] (-706.549) -- 0:01:28
111500 -- (-704.215) (-716.287) [-706.361] (-703.502) * [-710.362] (-702.566) (-705.855) (-705.512) -- 0:01:27
112000 -- (-703.487) (-709.302) [-706.633] (-705.234) * (-712.771) [-706.950] (-709.000) (-707.148) -- 0:01:27
112500 -- (-706.171) (-708.516) (-709.059) [-704.254] * (-707.975) [-710.744] (-707.243) (-704.045) -- 0:01:26
113000 -- (-705.414) (-713.642) (-706.912) [-706.605] * (-706.681) (-709.195) [-704.319] (-708.682) -- 0:01:26
113500 -- (-705.644) (-710.323) (-709.058) [-706.211] * (-707.660) (-710.820) [-701.552] (-703.830) -- 0:01:25
114000 -- [-704.370] (-707.623) (-706.732) (-705.682) * (-709.094) (-708.388) (-705.312) [-709.354] -- 0:01:25
114500 -- (-704.637) (-712.205) [-707.790] (-703.070) * (-706.343) (-704.479) [-707.099] (-708.621) -- 0:01:25
115000 -- (-710.979) [-708.927] (-708.553) (-709.981) * [-709.153] (-707.111) (-706.870) (-708.337) -- 0:01:24
Average standard deviation of split frequencies: 0.024383
115500 -- (-708.283) (-708.037) [-704.436] (-706.039) * (-708.203) (-701.555) (-702.835) [-701.621] -- 0:01:24
116000 -- (-709.423) [-708.307] (-702.575) (-707.970) * [-712.380] (-703.219) (-705.445) (-703.634) -- 0:01:23
116500 -- (-707.653) [-706.568] (-704.990) (-707.903) * [-703.566] (-718.006) (-708.313) (-702.909) -- 0:01:23
117000 -- (-710.460) [-706.667] (-707.158) (-709.223) * (-716.920) (-707.131) [-705.127] (-702.772) -- 0:01:23
117500 -- (-709.289) [-701.974] (-703.626) (-709.127) * (-705.366) (-706.761) (-705.375) [-703.870] -- 0:01:22
118000 -- (-707.848) (-713.019) [-704.297] (-710.607) * (-702.933) (-705.331) [-702.988] (-702.581) -- 0:01:22
118500 -- (-708.511) (-709.983) [-703.219] (-707.260) * (-705.564) (-704.721) [-704.328] (-710.434) -- 0:01:21
119000 -- (-707.579) (-704.419) (-707.681) [-707.372] * (-704.671) (-712.265) [-702.161] (-711.288) -- 0:01:21
119500 -- [-707.576] (-706.232) (-707.987) (-711.859) * [-703.352] (-705.688) (-705.736) (-712.772) -- 0:01:21
120000 -- (-703.240) (-710.164) (-709.781) [-707.669] * (-709.070) (-704.961) (-705.913) [-708.177] -- 0:01:20
Average standard deviation of split frequencies: 0.028649
120500 -- (-707.565) (-705.123) (-705.336) [-704.621] * [-704.027] (-706.376) (-713.193) (-708.954) -- 0:01:27
121000 -- (-703.930) (-704.748) [-707.256] (-714.537) * (-700.803) [-706.509] (-710.542) (-706.977) -- 0:01:27
121500 -- (-701.328) [-703.811] (-708.015) (-702.852) * (-710.891) (-709.719) [-710.547] (-713.783) -- 0:01:26
122000 -- (-711.598) (-700.946) (-705.753) [-704.026] * (-704.450) (-705.130) [-706.550] (-712.102) -- 0:01:26
122500 -- (-704.816) (-700.237) (-710.707) [-704.803] * [-706.773] (-701.203) (-709.959) (-704.353) -- 0:01:25
123000 -- (-702.688) [-703.804] (-703.383) (-704.713) * [-703.585] (-707.365) (-707.949) (-708.960) -- 0:01:25
123500 -- (-700.994) [-704.728] (-701.023) (-708.959) * (-704.056) (-712.567) (-701.763) [-708.150] -- 0:01:25
124000 -- (-704.857) (-703.464) (-712.918) [-701.248] * (-704.048) (-708.102) [-704.974] (-704.242) -- 0:01:24
124500 -- [-702.830] (-706.500) (-707.410) (-702.815) * (-705.556) (-706.283) [-710.394] (-707.583) -- 0:01:24
125000 -- (-706.076) (-703.615) (-707.503) [-702.332] * [-704.860] (-704.500) (-705.363) (-703.049) -- 0:01:24
Average standard deviation of split frequencies: 0.029930
125500 -- (-708.376) [-702.759] (-703.098) (-705.270) * (-711.816) [-703.471] (-699.343) (-704.032) -- 0:01:23
126000 -- (-709.726) (-708.981) [-705.309] (-701.521) * (-702.455) (-700.270) [-700.815] (-703.338) -- 0:01:23
126500 -- (-706.119) (-705.347) [-704.093] (-702.727) * [-702.997] (-704.441) (-702.275) (-701.612) -- 0:01:22
127000 -- (-713.967) [-709.579] (-704.738) (-700.872) * [-702.984] (-702.216) (-706.426) (-704.462) -- 0:01:22
127500 -- (-716.862) [-707.357] (-703.305) (-703.017) * [-706.930] (-706.400) (-702.322) (-704.217) -- 0:01:22
128000 -- (-709.621) [-706.126] (-707.118) (-705.442) * (-707.905) (-705.641) [-700.483] (-705.502) -- 0:01:21
128500 -- (-711.655) [-704.977] (-699.017) (-713.141) * [-706.318] (-707.677) (-704.862) (-702.893) -- 0:01:21
129000 -- [-708.310] (-706.340) (-704.607) (-709.615) * [-701.067] (-702.056) (-703.148) (-702.783) -- 0:01:21
129500 -- (-702.586) [-706.433] (-708.531) (-705.977) * (-707.152) (-707.433) (-705.853) [-699.358] -- 0:01:20
130000 -- [-710.376] (-701.570) (-705.078) (-710.290) * (-709.945) (-707.951) (-709.955) [-703.838] -- 0:01:20
Average standard deviation of split frequencies: 0.043292
130500 -- (-710.430) [-704.796] (-704.758) (-705.899) * (-705.220) (-702.201) (-709.410) [-710.475] -- 0:01:19
131000 -- (-704.733) [-701.968] (-702.992) (-705.399) * [-706.526] (-705.242) (-710.576) (-708.079) -- 0:01:19
131500 -- (-707.849) (-708.931) (-703.963) [-702.856] * (-707.236) (-710.239) [-704.629] (-703.561) -- 0:01:25
132000 -- [-708.395] (-703.416) (-702.038) (-715.766) * (-701.678) (-705.460) [-702.534] (-706.502) -- 0:01:25
132500 -- (-704.430) [-704.208] (-700.585) (-715.499) * [-701.576] (-702.496) (-705.501) (-704.148) -- 0:01:25
133000 -- (-710.083) (-706.272) [-703.139] (-708.462) * (-709.867) (-707.739) [-701.667] (-701.580) -- 0:01:24
133500 -- [-706.625] (-702.739) (-703.827) (-706.944) * (-706.188) (-703.403) (-702.665) [-701.236] -- 0:01:24
134000 -- (-702.639) (-707.642) [-704.619] (-704.798) * (-707.067) (-702.890) (-706.731) [-704.989] -- 0:01:24
134500 -- (-704.747) (-706.883) (-708.346) [-708.491] * (-705.016) (-708.420) (-713.038) [-703.123] -- 0:01:23
135000 -- (-702.163) (-705.097) [-706.636] (-711.936) * [-705.749] (-710.664) (-714.161) (-704.455) -- 0:01:23
Average standard deviation of split frequencies: 0.041595
135500 -- [-702.997] (-706.565) (-706.471) (-704.148) * [-703.636] (-703.554) (-701.766) (-708.013) -- 0:01:22
136000 -- (-705.798) (-707.635) [-701.859] (-710.296) * [-703.756] (-707.118) (-702.902) (-701.411) -- 0:01:22
136500 -- (-707.357) [-699.380] (-703.007) (-707.008) * (-708.885) (-708.675) [-704.961] (-709.192) -- 0:01:22
137000 -- (-702.919) (-700.572) (-715.532) [-705.198] * (-708.278) (-717.806) [-702.671] (-702.192) -- 0:01:21
137500 -- [-703.916] (-706.205) (-704.469) (-702.854) * (-702.040) (-712.309) (-703.556) [-705.470] -- 0:01:21
138000 -- (-704.990) (-706.105) [-702.059] (-704.026) * (-706.558) (-706.652) [-706.518] (-702.959) -- 0:01:21
138500 -- (-707.226) [-703.541] (-701.439) (-713.040) * (-710.149) (-704.848) [-707.433] (-705.552) -- 0:01:20
139000 -- (-705.138) [-702.978] (-702.769) (-707.568) * (-714.301) (-709.842) [-702.087] (-706.529) -- 0:01:20
139500 -- (-706.288) (-706.972) (-702.176) [-708.908] * [-702.428] (-705.128) (-704.469) (-704.491) -- 0:01:20
140000 -- (-704.563) (-707.477) [-707.532] (-705.695) * (-702.916) [-705.876] (-701.250) (-708.523) -- 0:01:19
Average standard deviation of split frequencies: 0.040215
140500 -- (-701.893) (-707.166) (-703.478) [-711.005] * (-704.855) (-703.861) (-702.168) [-707.171] -- 0:01:19
141000 -- (-705.005) [-706.839] (-708.460) (-718.561) * (-704.075) (-704.321) [-705.961] (-705.153) -- 0:01:19
141500 -- (-705.623) [-706.606] (-707.561) (-710.414) * (-706.014) (-703.694) [-702.120] (-704.066) -- 0:01:18
142000 -- (-705.308) [-703.765] (-708.828) (-710.582) * (-701.636) (-705.568) [-701.870] (-705.135) -- 0:01:18
142500 -- (-703.387) (-703.740) [-706.598] (-707.925) * [-704.129] (-706.018) (-703.937) (-701.695) -- 0:01:24
143000 -- (-704.188) [-708.365] (-707.486) (-707.142) * (-702.722) (-704.934) (-705.798) [-707.394] -- 0:01:23
143500 -- (-712.960) (-708.473) [-708.073] (-707.837) * (-702.296) (-701.768) (-705.844) [-701.753] -- 0:01:23
144000 -- (-707.677) (-707.970) [-707.474] (-705.862) * (-707.220) (-706.105) [-705.381] (-704.706) -- 0:01:23
144500 -- (-712.431) [-707.124] (-706.645) (-707.974) * (-705.538) (-713.820) [-710.460] (-709.662) -- 0:01:22
145000 -- (-705.032) (-706.523) [-708.540] (-711.548) * (-706.204) (-706.822) [-707.105] (-706.430) -- 0:01:22
Average standard deviation of split frequencies: 0.049508
145500 -- [-703.531] (-704.005) (-717.189) (-706.843) * (-709.630) (-705.942) [-707.157] (-702.879) -- 0:01:22
146000 -- (-709.409) (-711.912) [-704.965] (-708.523) * (-709.426) (-706.052) [-700.583] (-707.692) -- 0:01:21
146500 -- (-702.528) (-709.627) (-709.659) [-706.629] * (-705.580) [-704.776] (-700.260) (-703.427) -- 0:01:21
147000 -- (-704.397) (-704.442) (-706.960) [-706.364] * (-704.828) [-713.549] (-702.808) (-709.068) -- 0:01:21
147500 -- (-707.436) (-705.133) (-707.685) [-702.658] * (-703.753) (-703.990) [-707.241] (-705.749) -- 0:01:20
148000 -- [-710.609] (-701.714) (-705.088) (-710.849) * [-702.748] (-701.251) (-704.142) (-706.844) -- 0:01:20
148500 -- (-705.778) (-706.109) [-703.734] (-713.420) * (-710.750) (-702.194) (-706.497) [-701.747] -- 0:01:20
149000 -- (-700.698) [-707.705] (-706.699) (-705.469) * (-714.894) [-703.438] (-702.424) (-706.578) -- 0:01:19
149500 -- [-702.274] (-703.369) (-703.220) (-707.365) * [-704.824] (-708.769) (-708.247) (-710.155) -- 0:01:19
150000 -- (-699.877) (-705.424) (-706.746) [-702.694] * [-703.165] (-709.208) (-708.681) (-706.532) -- 0:01:19
Average standard deviation of split frequencies: 0.039631
150500 -- (-704.939) (-708.401) [-702.613] (-699.736) * (-708.810) [-706.540] (-713.708) (-707.433) -- 0:01:19
151000 -- (-709.274) [-702.944] (-709.058) (-704.882) * (-712.037) (-704.969) (-707.652) [-704.060] -- 0:01:18
151500 -- (-706.109) (-703.604) (-704.259) [-703.626] * (-703.905) [-704.642] (-706.554) (-711.523) -- 0:01:18
152000 -- (-704.705) [-703.120] (-711.778) (-702.687) * (-706.035) [-708.642] (-710.605) (-703.177) -- 0:01:18
152500 -- (-706.459) [-706.064] (-706.636) (-707.534) * (-705.588) (-702.339) [-707.872] (-703.830) -- 0:01:17
153000 -- (-705.875) [-703.439] (-705.181) (-709.819) * (-715.329) [-701.002] (-704.617) (-702.814) -- 0:01:23
153500 -- (-711.689) (-707.354) (-706.199) [-701.259] * [-700.533] (-700.365) (-702.556) (-701.887) -- 0:01:22
154000 -- (-708.794) (-702.593) [-703.407] (-708.194) * (-708.352) (-704.644) [-704.633] (-709.194) -- 0:01:22
154500 -- (-714.185) (-708.474) [-703.332] (-706.808) * (-707.696) (-704.608) [-706.040] (-705.117) -- 0:01:22
155000 -- (-707.262) (-707.339) (-704.197) [-707.221] * [-707.142] (-702.416) (-705.896) (-703.747) -- 0:01:21
Average standard deviation of split frequencies: 0.034247
155500 -- [-702.216] (-704.057) (-707.158) (-706.314) * (-710.900) [-707.915] (-705.268) (-704.982) -- 0:01:21
156000 -- [-706.079] (-706.713) (-707.182) (-709.948) * [-707.528] (-707.612) (-708.758) (-707.387) -- 0:01:21
156500 -- [-701.954] (-707.312) (-707.853) (-710.239) * [-703.974] (-711.226) (-712.365) (-706.026) -- 0:01:20
157000 -- (-701.654) [-704.155] (-706.462) (-704.040) * (-708.424) (-708.420) [-703.780] (-710.289) -- 0:01:20
157500 -- (-707.958) [-703.851] (-703.407) (-706.465) * (-705.263) [-704.309] (-701.469) (-707.104) -- 0:01:20
158000 -- [-703.693] (-710.265) (-700.792) (-711.911) * [-703.746] (-707.674) (-703.442) (-703.019) -- 0:01:19
158500 -- (-700.659) (-712.897) [-705.293] (-710.664) * (-703.257) (-706.379) [-705.186] (-702.541) -- 0:01:19
159000 -- (-700.660) (-707.497) [-704.841] (-708.206) * (-705.909) [-705.106] (-706.841) (-706.508) -- 0:01:19
159500 -- (-704.280) (-710.451) [-702.215] (-708.516) * (-704.817) [-703.017] (-708.510) (-703.314) -- 0:01:19
160000 -- (-708.990) [-708.459] (-703.205) (-707.442) * (-707.533) (-705.003) (-707.856) [-705.898] -- 0:01:18
Average standard deviation of split frequencies: 0.031297
160500 -- (-703.954) [-703.307] (-702.839) (-705.759) * [-708.108] (-709.144) (-702.023) (-703.317) -- 0:01:18
161000 -- (-703.536) [-706.962] (-707.790) (-701.873) * (-703.641) (-702.192) (-702.881) [-708.323] -- 0:01:18
161500 -- (-702.672) [-704.394] (-714.806) (-708.235) * (-710.534) (-706.618) (-700.988) [-704.952] -- 0:01:17
162000 -- (-703.429) (-708.305) [-705.477] (-707.995) * (-705.479) (-701.700) [-710.018] (-702.195) -- 0:01:17
162500 -- (-709.353) [-707.467] (-707.588) (-707.372) * (-714.874) (-703.846) [-704.479] (-703.635) -- 0:01:17
163000 -- (-701.550) (-707.973) [-703.557] (-708.124) * (-710.771) (-703.850) [-707.294] (-705.696) -- 0:01:17
163500 -- (-707.216) (-702.693) [-704.214] (-712.216) * (-703.955) (-707.659) (-705.387) [-702.904] -- 0:01:16
164000 -- (-705.881) (-708.129) [-706.454] (-709.407) * (-706.941) (-701.586) [-706.173] (-706.109) -- 0:01:21
164500 -- [-703.937] (-701.787) (-715.876) (-704.767) * [-708.632] (-708.899) (-703.478) (-705.210) -- 0:01:21
165000 -- [-707.935] (-703.624) (-708.381) (-703.788) * [-702.210] (-709.141) (-707.044) (-704.675) -- 0:01:20
Average standard deviation of split frequencies: 0.024611
165500 -- (-704.148) (-707.363) [-703.560] (-704.425) * (-708.796) (-712.744) (-704.270) [-703.327] -- 0:01:20
166000 -- (-706.366) (-706.621) [-703.951] (-704.222) * (-703.711) (-707.273) [-701.295] (-709.644) -- 0:01:20
166500 -- (-707.422) (-704.424) [-707.875] (-707.178) * [-703.065] (-708.085) (-703.828) (-704.945) -- 0:01:20
167000 -- (-703.214) [-702.660] (-706.746) (-702.519) * [-704.119] (-710.083) (-706.593) (-705.426) -- 0:01:19
167500 -- (-703.848) (-707.968) [-707.749] (-708.601) * (-707.144) (-706.544) (-710.456) [-700.465] -- 0:01:19
168000 -- (-706.836) (-706.490) [-708.095] (-706.243) * (-701.298) (-706.927) [-704.269] (-703.597) -- 0:01:19
168500 -- [-705.716] (-703.234) (-712.173) (-706.269) * [-707.155] (-704.037) (-705.948) (-704.136) -- 0:01:18
169000 -- (-711.798) [-705.483] (-714.073) (-703.356) * (-704.597) (-705.200) (-705.611) [-706.934] -- 0:01:18
169500 -- (-708.390) (-708.228) [-710.078] (-706.756) * (-708.540) [-705.821] (-709.877) (-704.653) -- 0:01:18
170000 -- (-709.569) [-701.539] (-706.648) (-705.677) * (-707.420) [-704.746] (-710.473) (-707.580) -- 0:01:18
Average standard deviation of split frequencies: 0.031304
170500 -- (-704.882) [-701.838] (-708.206) (-706.819) * (-702.814) (-703.309) [-705.356] (-702.692) -- 0:01:17
171000 -- (-701.665) (-704.550) [-704.892] (-702.499) * (-710.640) [-702.476] (-704.416) (-710.861) -- 0:01:17
171500 -- (-712.698) [-702.855] (-707.105) (-703.226) * (-714.068) (-704.902) (-704.134) [-712.339] -- 0:01:17
172000 -- (-708.249) (-702.285) [-705.286] (-704.215) * (-705.145) [-700.460] (-703.812) (-707.907) -- 0:01:17
172500 -- [-709.641] (-702.841) (-706.219) (-713.711) * [-705.457] (-705.245) (-708.296) (-706.345) -- 0:01:16
173000 -- (-705.818) [-703.921] (-705.559) (-706.740) * (-705.358) (-703.544) [-710.821] (-708.155) -- 0:01:16
173500 -- [-703.683] (-705.143) (-708.555) (-709.052) * (-707.359) [-702.926] (-709.880) (-704.962) -- 0:01:16
174000 -- (-704.020) (-705.547) (-708.312) [-706.742] * (-706.046) [-702.285] (-711.571) (-704.733) -- 0:01:15
174500 -- [-702.853] (-711.221) (-713.470) (-704.191) * (-707.991) [-702.410] (-712.435) (-713.581) -- 0:01:15
175000 -- (-702.632) (-707.072) (-711.913) [-704.951] * (-706.702) [-702.730] (-707.854) (-705.016) -- 0:01:20
Average standard deviation of split frequencies: 0.023213
175500 -- [-705.759] (-713.389) (-708.595) (-709.034) * (-707.748) [-703.264] (-705.495) (-709.966) -- 0:01:19
176000 -- (-708.877) (-717.133) [-712.883] (-708.027) * [-709.571] (-706.735) (-706.263) (-710.737) -- 0:01:19
176500 -- (-705.844) (-707.595) (-702.859) [-703.950] * (-702.070) [-700.163] (-705.965) (-706.137) -- 0:01:19
177000 -- (-705.327) [-714.159] (-703.733) (-706.198) * [-706.887] (-704.910) (-703.895) (-710.602) -- 0:01:19
177500 -- (-707.372) (-709.009) [-703.346] (-704.725) * [-706.315] (-702.037) (-712.347) (-708.264) -- 0:01:18
178000 -- (-704.071) [-707.902] (-706.918) (-703.920) * (-705.918) [-699.326] (-709.494) (-703.268) -- 0:01:18
178500 -- [-707.263] (-705.850) (-704.939) (-705.215) * (-706.320) (-705.205) [-705.328] (-713.979) -- 0:01:18
179000 -- (-704.900) [-709.272] (-708.318) (-704.875) * (-703.814) (-702.163) [-702.115] (-703.640) -- 0:01:17
179500 -- (-704.076) [-708.223] (-710.269) (-704.573) * (-708.704) [-706.282] (-703.160) (-704.474) -- 0:01:17
180000 -- (-704.423) [-707.660] (-705.382) (-703.996) * (-705.765) [-702.785] (-704.835) (-702.214) -- 0:01:17
Average standard deviation of split frequencies: 0.017395
180500 -- [-704.771] (-712.965) (-704.359) (-708.383) * (-710.404) (-700.168) [-707.831] (-705.127) -- 0:01:17
181000 -- (-711.291) [-718.529] (-706.059) (-708.378) * (-710.841) [-714.111] (-707.040) (-707.826) -- 0:01:16
181500 -- [-704.313] (-710.927) (-706.542) (-708.462) * [-707.952] (-708.044) (-715.293) (-707.821) -- 0:01:16
182000 -- [-702.785] (-707.194) (-711.883) (-706.383) * (-716.181) (-709.562) [-710.527] (-710.894) -- 0:01:16
182500 -- [-701.980] (-713.501) (-710.245) (-702.981) * (-711.978) (-710.573) [-706.358] (-705.335) -- 0:01:16
183000 -- (-704.019) (-712.255) [-706.013] (-701.985) * (-707.951) [-708.858] (-712.927) (-714.586) -- 0:01:15
183500 -- (-707.453) [-712.779] (-711.919) (-710.911) * (-708.161) [-703.181] (-704.761) (-709.225) -- 0:01:15
184000 -- [-709.824] (-708.714) (-712.010) (-705.750) * [-706.831] (-705.560) (-706.245) (-707.525) -- 0:01:15
184500 -- (-714.793) (-711.682) [-712.382] (-703.475) * (-710.035) (-705.469) (-706.974) [-712.914] -- 0:01:15
185000 -- (-714.214) (-705.964) (-709.016) [-701.926] * (-712.068) (-710.658) (-704.316) [-709.671] -- 0:01:14
Average standard deviation of split frequencies: 0.021965
185500 -- (-708.346) (-707.868) (-708.444) [-700.633] * (-713.264) (-713.138) [-704.044] (-699.967) -- 0:01:19
186000 -- (-708.829) (-709.017) [-707.349] (-699.390) * (-710.748) [-709.898] (-701.092) (-702.378) -- 0:01:18
186500 -- (-711.314) (-708.703) [-703.372] (-703.607) * (-714.035) (-705.762) [-703.660] (-704.938) -- 0:01:18
187000 -- [-712.283] (-707.633) (-703.657) (-708.419) * (-708.387) (-702.900) (-709.892) [-703.663] -- 0:01:18
187500 -- (-707.806) [-708.199] (-708.652) (-713.941) * [-708.974] (-714.504) (-709.260) (-705.057) -- 0:01:18
188000 -- (-708.547) (-706.430) (-709.274) [-703.565] * (-708.285) (-714.194) (-703.090) [-711.128] -- 0:01:17
188500 -- (-705.979) (-708.298) [-706.697] (-705.772) * (-712.180) (-706.402) [-710.030] (-703.896) -- 0:01:17
189000 -- (-705.798) (-705.730) (-704.617) [-707.908] * (-703.096) [-703.058] (-703.435) (-707.336) -- 0:01:17
189500 -- (-704.646) (-710.708) [-703.660] (-705.404) * (-704.379) [-704.934] (-702.969) (-704.030) -- 0:01:16
190000 -- (-708.865) (-707.085) [-705.805] (-702.502) * (-708.985) (-704.654) (-704.282) [-703.954] -- 0:01:16
Average standard deviation of split frequencies: 0.031317
190500 -- (-708.192) (-707.689) (-709.470) [-702.772] * [-701.731] (-714.400) (-711.945) (-708.829) -- 0:01:16
191000 -- (-704.629) [-710.165] (-706.387) (-706.437) * (-709.881) (-709.278) (-713.084) [-704.592] -- 0:01:16
191500 -- (-713.543) [-709.394] (-702.595) (-704.162) * (-709.396) (-711.564) [-702.771] (-710.929) -- 0:01:15
192000 -- (-708.248) (-703.829) [-705.858] (-702.725) * (-703.688) (-707.281) [-707.058] (-705.862) -- 0:01:15
192500 -- (-707.868) [-706.454] (-702.433) (-705.096) * (-712.607) (-705.506) [-704.449] (-708.282) -- 0:01:15
193000 -- (-707.643) (-705.415) (-705.947) [-701.148] * [-708.699] (-702.919) (-708.064) (-707.741) -- 0:01:15
193500 -- [-711.911] (-707.545) (-706.671) (-706.281) * [-707.591] (-705.119) (-710.299) (-702.417) -- 0:01:15
194000 -- (-706.343) [-707.935] (-706.894) (-710.669) * (-701.907) [-705.019] (-703.689) (-706.184) -- 0:01:14
194500 -- [-704.007] (-708.274) (-703.557) (-707.082) * (-708.764) (-700.819) (-704.748) [-702.986] -- 0:01:14
195000 -- [-703.017] (-710.284) (-706.197) (-706.228) * (-705.069) (-707.141) (-703.981) [-701.764] -- 0:01:14
Average standard deviation of split frequencies: 0.027258
195500 -- (-704.720) (-703.503) [-708.137] (-710.360) * (-700.564) (-704.901) [-703.974] (-711.402) -- 0:01:14
196000 -- (-703.949) [-705.959] (-705.330) (-709.314) * (-703.002) (-706.789) (-706.061) [-702.693] -- 0:01:17
196500 -- [-702.381] (-703.279) (-707.612) (-709.803) * (-704.298) (-707.061) [-704.517] (-702.469) -- 0:01:17
197000 -- [-701.012] (-703.894) (-706.542) (-705.161) * (-703.858) [-703.439] (-706.711) (-703.726) -- 0:01:17
197500 -- (-704.371) [-703.516] (-704.802) (-707.186) * (-705.635) [-701.801] (-704.069) (-704.212) -- 0:01:17
198000 -- [-703.723] (-704.367) (-705.580) (-710.444) * (-705.649) [-703.151] (-706.459) (-702.940) -- 0:01:16
198500 -- (-703.683) (-703.760) [-704.760] (-716.341) * (-706.446) [-701.025] (-703.028) (-707.940) -- 0:01:16
199000 -- [-708.016] (-704.855) (-706.889) (-706.002) * (-710.694) (-704.528) [-703.204] (-707.777) -- 0:01:16
199500 -- (-709.359) [-704.701] (-702.622) (-707.904) * [-707.040] (-704.997) (-702.742) (-709.336) -- 0:01:16
200000 -- (-703.494) [-704.262] (-698.042) (-704.698) * [-703.978] (-701.926) (-709.590) (-708.474) -- 0:01:16
Average standard deviation of split frequencies: 0.028190
200500 -- (-707.741) (-708.193) (-713.785) [-715.049] * (-703.073) (-714.372) [-704.968] (-706.610) -- 0:01:15
201000 -- (-708.774) (-704.736) (-710.959) [-706.629] * (-700.527) (-706.883) [-706.756] (-705.898) -- 0:01:15
201500 -- (-700.739) (-703.670) (-706.833) [-703.967] * (-707.007) (-702.776) [-706.163] (-705.458) -- 0:01:15
202000 -- [-701.729] (-706.771) (-712.314) (-712.345) * (-708.195) [-706.591] (-703.899) (-710.780) -- 0:01:15
202500 -- (-701.866) (-706.919) (-704.653) [-710.153] * (-702.489) (-706.544) (-706.930) [-703.699] -- 0:01:14
203000 -- (-705.627) (-711.654) (-708.340) [-705.819] * (-703.478) [-707.680] (-703.235) (-704.688) -- 0:01:14
203500 -- (-704.732) (-707.054) (-705.193) [-706.472] * [-703.095] (-711.298) (-707.548) (-708.976) -- 0:01:14
204000 -- (-707.158) (-709.043) [-704.432] (-706.210) * (-708.228) (-710.713) [-702.253] (-704.646) -- 0:01:14
204500 -- [-702.108] (-705.639) (-704.368) (-708.340) * (-712.440) (-703.310) (-703.844) [-700.521] -- 0:01:13
205000 -- (-703.159) (-703.710) [-701.303] (-703.994) * (-714.859) [-701.608] (-704.613) (-710.413) -- 0:01:13
Average standard deviation of split frequencies: 0.028986
205500 -- (-705.591) (-709.379) (-703.781) [-702.500] * (-708.333) [-704.727] (-707.118) (-708.359) -- 0:01:13
206000 -- (-704.893) (-706.332) [-708.003] (-704.970) * (-706.349) (-704.090) (-704.402) [-707.716] -- 0:01:13
206500 -- (-700.439) (-707.996) [-705.564] (-707.017) * (-712.089) [-703.213] (-709.375) (-706.625) -- 0:01:13
207000 -- (-702.211) [-705.967] (-702.991) (-709.514) * [-705.948] (-705.039) (-703.378) (-706.826) -- 0:01:16
207500 -- (-705.373) [-700.894] (-701.818) (-705.796) * [-709.312] (-705.218) (-713.337) (-705.132) -- 0:01:16
208000 -- (-709.800) [-708.818] (-703.330) (-707.627) * (-703.955) (-703.338) [-710.830] (-704.067) -- 0:01:16
208500 -- (-703.143) (-706.437) [-706.346] (-713.619) * (-707.453) [-703.865] (-708.389) (-701.131) -- 0:01:15
209000 -- (-706.625) (-705.362) [-710.303] (-711.996) * (-705.806) [-706.508] (-712.029) (-708.694) -- 0:01:15
209500 -- [-701.490] (-706.564) (-703.895) (-704.389) * (-700.918) (-706.487) (-709.169) [-700.852] -- 0:01:15
210000 -- (-704.300) (-711.687) [-710.805] (-706.361) * (-701.123) (-703.047) [-707.189] (-707.071) -- 0:01:15
Average standard deviation of split frequencies: 0.025360
210500 -- [-701.729] (-708.531) (-706.881) (-706.192) * (-705.277) (-707.589) (-708.012) [-701.696] -- 0:01:15
211000 -- (-710.545) [-706.762] (-708.576) (-705.626) * (-708.575) (-706.133) (-709.037) [-706.747] -- 0:01:14
211500 -- (-704.549) [-708.106] (-711.740) (-710.858) * (-708.671) (-701.164) [-710.433] (-708.450) -- 0:01:14
212000 -- (-703.130) (-705.186) [-712.722] (-703.871) * (-714.403) (-703.489) (-706.028) [-707.088] -- 0:01:14
212500 -- (-707.342) (-705.950) (-708.178) [-700.868] * (-713.489) (-703.358) [-707.287] (-710.425) -- 0:01:14
213000 -- (-705.003) (-715.518) (-707.202) [-705.623] * (-708.348) [-706.443] (-701.393) (-703.302) -- 0:01:13
213500 -- (-705.986) (-707.483) (-704.584) [-705.783] * (-705.032) [-704.004] (-702.398) (-704.874) -- 0:01:13
214000 -- (-700.640) (-709.080) (-705.915) [-700.365] * (-705.677) (-710.832) [-703.267] (-700.604) -- 0:01:13
214500 -- (-711.720) [-704.394] (-706.166) (-710.256) * (-705.988) (-708.192) (-706.185) [-703.799] -- 0:01:13
215000 -- [-707.655] (-714.270) (-708.836) (-702.933) * (-705.862) [-703.779] (-706.221) (-708.520) -- 0:01:13
Average standard deviation of split frequencies: 0.021824
215500 -- [-708.315] (-705.763) (-708.472) (-702.879) * [-705.452] (-703.988) (-704.409) (-707.409) -- 0:01:12
216000 -- [-704.113] (-710.419) (-711.981) (-706.020) * (-707.016) (-713.323) (-713.110) [-704.627] -- 0:01:12
216500 -- [-701.229] (-708.196) (-701.426) (-703.121) * (-709.025) [-704.580] (-703.733) (-706.466) -- 0:01:12
217000 -- [-706.705] (-710.816) (-701.504) (-704.913) * (-702.949) (-703.584) (-707.196) [-706.266] -- 0:01:12
217500 -- (-702.927) [-703.046] (-700.416) (-701.606) * (-710.831) (-710.251) (-705.446) [-700.636] -- 0:01:11
218000 -- (-703.943) (-710.020) (-703.807) [-701.001] * (-714.779) (-709.782) (-703.990) [-706.608] -- 0:01:15
218500 -- (-711.463) (-706.175) (-709.184) [-703.254] * (-707.483) (-712.994) [-704.492] (-706.378) -- 0:01:15
219000 -- [-707.624] (-706.015) (-711.221) (-701.989) * [-707.211] (-712.364) (-706.831) (-704.176) -- 0:01:14
219500 -- [-704.919] (-706.168) (-709.381) (-710.186) * [-702.258] (-715.339) (-704.128) (-705.308) -- 0:01:14
220000 -- (-715.308) [-706.901] (-709.133) (-707.067) * [-704.724] (-707.787) (-704.678) (-702.088) -- 0:01:14
Average standard deviation of split frequencies: 0.019939
220500 -- [-708.871] (-707.681) (-707.005) (-700.985) * [-701.851] (-709.643) (-705.922) (-704.235) -- 0:01:14
221000 -- (-708.274) (-709.955) [-703.275] (-712.501) * (-704.289) (-700.182) [-702.483] (-704.890) -- 0:01:14
221500 -- [-704.205] (-707.809) (-701.361) (-708.694) * (-709.906) (-704.740) (-709.613) [-704.280] -- 0:01:13
222000 -- (-705.237) [-704.375] (-700.942) (-704.650) * [-704.492] (-706.588) (-710.660) (-707.067) -- 0:01:13
222500 -- (-709.745) (-701.117) [-706.320] (-705.777) * (-715.591) (-704.340) (-707.736) [-705.954] -- 0:01:13
223000 -- [-703.481] (-704.237) (-704.491) (-707.707) * (-708.409) (-707.809) (-709.602) [-702.571] -- 0:01:13
223500 -- (-703.461) (-705.565) [-705.931] (-705.565) * (-707.714) (-708.374) [-712.011] (-705.322) -- 0:01:12
224000 -- (-703.699) [-702.388] (-711.319) (-705.036) * (-706.301) (-710.449) [-705.849] (-704.528) -- 0:01:12
224500 -- [-702.790] (-708.829) (-700.572) (-708.890) * [-703.838] (-708.919) (-704.342) (-706.088) -- 0:01:12
225000 -- (-703.970) (-711.248) [-703.045] (-706.572) * [-700.939] (-711.479) (-706.792) (-706.789) -- 0:01:12
Average standard deviation of split frequencies: 0.023640
225500 -- [-701.488] (-708.899) (-700.881) (-711.286) * (-707.333) (-706.335) (-709.794) [-707.540] -- 0:01:12
226000 -- (-699.783) [-706.888] (-705.227) (-712.532) * (-702.139) (-702.066) (-712.081) [-702.503] -- 0:01:11
226500 -- (-703.932) (-706.478) (-702.812) [-705.455] * (-711.094) (-708.529) (-703.548) [-701.810] -- 0:01:11
227000 -- (-705.419) (-702.840) [-703.671] (-707.776) * [-702.842] (-706.563) (-706.326) (-702.128) -- 0:01:11
227500 -- [-699.797] (-705.795) (-706.200) (-707.061) * (-708.521) (-702.857) [-701.113] (-708.100) -- 0:01:11
228000 -- (-703.887) (-703.980) (-709.318) [-703.825] * (-709.680) (-709.435) (-702.631) [-701.983] -- 0:01:11
228500 -- (-705.521) (-711.669) (-705.920) [-705.960] * (-712.964) [-713.116] (-704.043) (-703.940) -- 0:01:10
229000 -- (-712.922) (-708.787) (-706.433) [-703.279] * (-706.763) (-704.584) [-704.411] (-704.518) -- 0:01:14
229500 -- [-707.100] (-708.188) (-708.395) (-703.190) * (-705.450) [-705.865] (-707.856) (-714.115) -- 0:01:13
230000 -- (-704.415) (-708.460) (-703.962) [-704.450] * (-704.926) [-705.982] (-706.018) (-701.086) -- 0:01:13
Average standard deviation of split frequencies: 0.024524
230500 -- (-704.474) (-709.158) [-704.222] (-704.337) * [-707.335] (-711.706) (-708.180) (-706.463) -- 0:01:13
231000 -- (-707.057) [-706.304] (-704.991) (-704.105) * [-701.290] (-716.786) (-706.922) (-710.409) -- 0:01:13
231500 -- (-710.744) (-704.318) [-705.108] (-702.669) * (-706.122) (-711.772) (-705.540) [-703.543] -- 0:01:13
232000 -- (-712.466) (-705.339) (-703.561) [-702.489] * [-704.739] (-703.481) (-707.806) (-703.616) -- 0:01:12
232500 -- (-704.924) [-704.309] (-700.693) (-704.339) * (-708.406) [-705.744] (-707.327) (-699.732) -- 0:01:12
233000 -- (-709.569) [-705.184] (-700.665) (-704.287) * (-705.371) (-710.468) (-707.501) [-705.172] -- 0:01:12
233500 -- (-703.561) (-702.740) (-701.913) [-703.586] * [-703.279] (-706.820) (-702.167) (-702.916) -- 0:01:12
234000 -- (-709.635) (-710.103) [-701.968] (-704.567) * (-705.262) (-707.667) [-701.910] (-707.616) -- 0:01:12
234500 -- (-707.035) (-704.485) [-702.389] (-708.851) * (-708.242) (-711.225) [-702.608] (-703.399) -- 0:01:11
235000 -- (-706.490) (-706.074) [-707.985] (-707.409) * [-704.101] (-717.423) (-709.298) (-704.610) -- 0:01:11
Average standard deviation of split frequencies: 0.019975
235500 -- [-711.146] (-703.572) (-704.650) (-708.147) * (-709.423) [-708.062] (-707.703) (-701.814) -- 0:01:11
236000 -- [-707.898] (-705.024) (-703.053) (-703.603) * (-706.775) (-704.264) (-700.833) [-706.087] -- 0:01:11
236500 -- (-710.542) [-708.356] (-702.522) (-702.265) * (-703.651) (-707.665) (-709.607) [-703.019] -- 0:01:11
237000 -- (-711.045) (-718.310) [-706.685] (-708.372) * (-706.239) (-710.139) (-707.946) [-703.933] -- 0:01:10
237500 -- (-715.232) (-708.600) (-705.168) [-706.891] * (-704.617) (-715.496) [-710.780] (-702.388) -- 0:01:10
238000 -- (-711.170) (-709.423) (-710.990) [-704.581] * (-703.404) (-709.686) (-707.146) [-700.763] -- 0:01:10
238500 -- [-704.943] (-705.024) (-708.672) (-707.586) * (-707.133) (-714.694) [-702.793] (-711.315) -- 0:01:10
239000 -- (-705.494) (-703.881) (-704.185) [-709.000] * [-699.517] (-704.925) (-706.641) (-702.844) -- 0:01:10
239500 -- [-707.035] (-707.223) (-710.685) (-707.508) * [-706.516] (-711.148) (-703.832) (-703.468) -- 0:01:13
240000 -- (-712.281) [-707.226] (-704.885) (-706.704) * (-707.716) (-721.639) [-700.805] (-705.408) -- 0:01:12
Average standard deviation of split frequencies: 0.019587
240500 -- [-709.123] (-705.744) (-707.355) (-708.783) * (-703.066) (-715.268) [-706.349] (-705.014) -- 0:01:12
241000 -- (-712.293) [-703.878] (-710.567) (-704.226) * (-707.804) [-708.537] (-703.634) (-707.038) -- 0:01:12
241500 -- [-702.328] (-704.455) (-708.149) (-705.067) * (-708.849) (-712.058) (-705.430) [-706.273] -- 0:01:12
242000 -- (-706.187) [-710.048] (-709.025) (-708.287) * [-708.819] (-711.996) (-706.643) (-705.650) -- 0:01:12
242500 -- (-706.013) (-704.907) (-707.638) [-704.808] * [-710.627] (-707.455) (-705.739) (-709.176) -- 0:01:11
243000 -- (-715.556) [-703.876] (-710.383) (-710.596) * (-708.776) [-708.396] (-715.908) (-706.592) -- 0:01:11
243500 -- (-709.685) [-706.042] (-702.045) (-707.791) * (-708.593) [-704.142] (-702.977) (-707.562) -- 0:01:11
244000 -- (-700.897) [-702.315] (-706.503) (-707.014) * (-709.015) (-711.925) (-705.512) [-704.148] -- 0:01:11
244500 -- (-702.981) [-703.424] (-705.374) (-707.589) * (-708.712) [-702.986] (-706.963) (-712.261) -- 0:01:11
245000 -- [-708.206] (-704.962) (-701.074) (-708.935) * [-705.047] (-702.679) (-706.353) (-710.774) -- 0:01:10
Average standard deviation of split frequencies: 0.019163
245500 -- (-706.493) [-699.488] (-714.188) (-703.687) * (-711.715) [-710.028] (-704.538) (-709.392) -- 0:01:10
246000 -- (-709.898) [-707.394] (-703.735) (-703.535) * (-711.704) (-710.561) [-707.247] (-704.406) -- 0:01:10
246500 -- (-709.787) (-703.824) (-702.601) [-710.043] * (-705.099) [-705.742] (-705.503) (-703.368) -- 0:01:10
247000 -- (-707.422) [-708.730] (-705.700) (-705.934) * [-705.011] (-706.043) (-708.701) (-709.655) -- 0:01:10
247500 -- (-707.624) (-704.104) [-704.839] (-704.020) * [-706.637] (-704.513) (-709.365) (-700.076) -- 0:01:09
248000 -- (-711.120) (-711.443) (-704.326) [-704.557] * (-713.904) [-709.432] (-706.193) (-703.449) -- 0:01:09
248500 -- [-707.687] (-711.517) (-707.147) (-709.047) * (-708.188) (-708.235) [-705.407] (-699.275) -- 0:01:09
249000 -- (-706.331) (-708.334) (-712.260) [-703.902] * (-718.946) (-703.723) (-701.217) [-701.407] -- 0:01:09
249500 -- [-704.571] (-706.826) (-707.039) (-706.258) * [-713.503] (-703.187) (-701.645) (-709.712) -- 0:01:09
250000 -- (-706.593) [-705.969] (-707.433) (-705.449) * (-705.758) (-704.665) (-703.754) [-701.195] -- 0:01:12
Average standard deviation of split frequencies: 0.017552
250500 -- (-704.506) (-708.917) (-707.041) [-702.118] * (-703.525) (-705.058) [-701.304] (-706.618) -- 0:01:11
251000 -- (-705.157) [-704.018] (-705.647) (-702.833) * (-705.059) (-704.361) [-705.397] (-704.960) -- 0:01:11
251500 -- (-706.802) [-703.151] (-708.884) (-708.243) * (-709.132) (-705.176) (-703.722) [-700.879] -- 0:01:11
252000 -- (-709.308) (-708.818) [-704.763] (-709.845) * (-702.407) (-705.236) (-710.893) [-703.159] -- 0:01:11
252500 -- [-709.676] (-705.651) (-709.165) (-705.560) * (-708.882) (-701.040) (-709.949) [-703.742] -- 0:01:11
253000 -- [-711.579] (-711.486) (-704.135) (-706.215) * (-707.312) (-707.826) [-709.077] (-707.081) -- 0:01:10
253500 -- [-700.296] (-711.104) (-706.582) (-710.302) * [-705.005] (-706.381) (-709.733) (-703.283) -- 0:01:10
254000 -- (-703.503) (-705.337) (-704.586) [-704.920] * [-704.635] (-703.981) (-707.852) (-703.458) -- 0:01:10
254500 -- (-701.222) (-707.863) (-704.020) [-711.054] * [-700.116] (-702.685) (-712.616) (-704.972) -- 0:01:10
255000 -- [-708.122] (-707.191) (-709.727) (-707.740) * (-701.927) (-703.476) (-707.510) [-705.530] -- 0:01:10
Average standard deviation of split frequencies: 0.015959
255500 -- (-701.649) (-712.836) (-705.497) [-706.878] * (-715.071) (-709.521) [-704.893] (-700.343) -- 0:01:09
256000 -- (-705.461) (-708.273) [-710.819] (-705.580) * (-705.645) [-711.070] (-706.301) (-715.308) -- 0:01:09
256500 -- (-709.625) (-708.651) [-707.263] (-710.281) * (-707.305) (-703.411) [-708.893] (-711.557) -- 0:01:09
257000 -- (-707.586) (-702.233) (-708.754) [-708.343] * [-701.802] (-705.250) (-706.409) (-707.681) -- 0:01:09
257500 -- (-711.457) [-702.697] (-710.388) (-707.985) * (-705.985) (-704.798) (-706.914) [-704.615] -- 0:01:09
258000 -- (-707.606) (-709.601) (-706.110) [-710.531] * [-702.267] (-706.236) (-702.145) (-703.923) -- 0:01:09
258500 -- (-712.728) (-702.892) (-702.771) [-707.077] * (-707.895) (-712.354) [-701.141] (-713.704) -- 0:01:08
259000 -- (-708.679) [-699.319] (-702.951) (-706.821) * (-702.319) (-706.280) [-705.777] (-707.305) -- 0:01:08
259500 -- (-713.247) (-703.500) [-703.045] (-707.514) * (-703.762) (-707.020) (-704.839) [-706.925] -- 0:01:08
260000 -- (-706.257) (-702.428) [-703.228] (-709.641) * (-708.135) (-706.567) (-707.393) [-704.238] -- 0:01:08
Average standard deviation of split frequencies: 0.012056
260500 -- (-706.624) [-707.896] (-704.578) (-704.546) * [-703.764] (-710.984) (-711.430) (-702.470) -- 0:01:08
261000 -- (-708.166) (-706.016) [-704.103] (-705.798) * (-704.069) [-710.240] (-709.934) (-704.440) -- 0:01:10
261500 -- (-708.537) [-705.249] (-707.539) (-707.914) * (-704.547) (-706.234) [-703.582] (-705.839) -- 0:01:10
262000 -- (-702.577) (-704.476) (-706.384) [-707.904] * (-701.490) (-703.533) (-702.364) [-706.591] -- 0:01:10
262500 -- (-706.465) [-703.954] (-705.437) (-706.817) * (-705.647) (-705.366) (-705.172) [-704.051] -- 0:01:10
263000 -- (-704.819) (-703.625) (-707.559) [-702.680] * (-703.123) (-706.208) [-704.501] (-713.683) -- 0:01:10
263500 -- (-700.614) (-705.456) (-700.304) [-705.692] * (-701.534) (-713.562) (-705.908) [-703.480] -- 0:01:09
264000 -- (-703.463) [-703.475] (-703.432) (-707.654) * [-707.129] (-711.556) (-709.826) (-713.248) -- 0:01:09
264500 -- [-705.873] (-707.420) (-704.314) (-709.914) * [-701.549] (-703.012) (-705.549) (-702.360) -- 0:01:09
265000 -- (-710.790) [-703.753] (-703.202) (-707.941) * (-704.377) (-705.123) [-704.104] (-703.956) -- 0:01:09
Average standard deviation of split frequencies: 0.016541
265500 -- (-708.055) (-704.840) (-704.350) [-704.605] * [-711.122] (-713.803) (-708.220) (-702.483) -- 0:01:09
266000 -- (-713.929) (-704.715) [-700.245] (-706.821) * (-709.383) [-707.728] (-706.889) (-710.088) -- 0:01:08
266500 -- (-712.703) [-704.204] (-704.247) (-704.500) * (-706.372) (-710.589) [-712.060] (-707.549) -- 0:01:08
267000 -- (-713.117) (-705.107) [-705.954] (-704.032) * (-703.911) [-705.442] (-708.699) (-701.760) -- 0:01:08
267500 -- (-715.597) [-703.339] (-700.645) (-706.622) * (-706.341) (-703.334) [-706.384] (-707.274) -- 0:01:08
268000 -- (-716.871) (-707.781) (-706.282) [-703.541] * [-708.490] (-704.110) (-706.493) (-707.466) -- 0:01:08
268500 -- (-712.805) [-704.638] (-706.273) (-705.180) * (-704.519) (-705.934) (-706.822) [-707.229] -- 0:01:08
269000 -- (-712.183) (-707.528) (-705.714) [-705.019] * (-703.626) (-704.792) [-705.175] (-705.679) -- 0:01:07
269500 -- (-713.135) [-702.399] (-706.218) (-702.890) * (-706.135) (-706.894) [-700.949] (-708.241) -- 0:01:07
270000 -- (-712.364) (-704.306) [-700.175] (-709.269) * (-712.813) (-703.680) [-703.990] (-712.232) -- 0:01:07
Average standard deviation of split frequencies: 0.012772
270500 -- (-721.781) (-709.228) (-705.863) [-703.275] * (-707.053) (-705.275) (-705.198) [-710.898] -- 0:01:07
271000 -- (-712.373) [-711.300] (-703.428) (-706.113) * (-708.341) [-704.454] (-709.931) (-708.907) -- 0:01:07
271500 -- (-712.660) [-706.892] (-703.578) (-711.910) * (-705.359) (-711.874) [-705.948] (-708.667) -- 0:01:09
272000 -- (-714.208) (-704.630) [-708.471] (-703.920) * [-708.706] (-702.658) (-707.680) (-710.923) -- 0:01:09
272500 -- (-707.785) (-706.731) (-705.682) [-705.669] * [-705.677] (-704.083) (-706.473) (-707.672) -- 0:01:09
273000 -- (-706.451) [-708.316] (-706.549) (-705.161) * (-710.762) (-702.877) (-710.330) [-704.909] -- 0:01:09
273500 -- (-707.230) (-708.688) [-706.560] (-707.497) * [-699.851] (-702.067) (-705.551) (-710.862) -- 0:01:09
274000 -- (-706.719) (-707.056) [-703.209] (-703.638) * (-704.068) [-705.170] (-710.072) (-707.838) -- 0:01:08
274500 -- [-708.908] (-704.955) (-704.880) (-705.920) * (-701.417) (-706.139) (-710.068) [-708.132] -- 0:01:08
275000 -- [-702.342] (-705.861) (-705.793) (-709.247) * [-700.929] (-704.304) (-707.685) (-712.034) -- 0:01:08
Average standard deviation of split frequencies: 0.012525
275500 -- (-705.944) (-708.354) (-707.939) [-706.099] * [-699.921] (-705.881) (-706.889) (-706.629) -- 0:01:08
276000 -- (-708.044) (-708.933) [-709.161] (-706.687) * (-701.620) (-700.902) (-701.592) [-703.564] -- 0:01:08
276500 -- (-712.783) (-705.382) (-703.754) [-702.469] * (-702.214) [-701.686] (-702.772) (-706.135) -- 0:01:08
277000 -- (-702.427) [-703.087] (-703.296) (-704.913) * (-706.717) [-702.071] (-707.548) (-706.289) -- 0:01:07
277500 -- (-701.671) [-699.943] (-704.191) (-702.749) * [-703.010] (-707.700) (-706.383) (-705.678) -- 0:01:07
278000 -- (-707.378) (-703.273) [-701.772] (-704.524) * [-709.485] (-703.447) (-708.280) (-705.837) -- 0:01:07
278500 -- (-713.210) (-708.934) (-704.816) [-709.280] * [-705.421] (-705.776) (-712.568) (-707.214) -- 0:01:07
279000 -- (-707.912) [-704.678] (-709.246) (-704.776) * (-702.967) (-706.012) [-703.732] (-703.762) -- 0:01:07
279500 -- (-708.862) [-709.035] (-704.196) (-703.702) * (-705.747) [-700.937] (-705.263) (-701.969) -- 0:01:07
280000 -- (-712.630) (-700.609) (-700.734) [-705.702] * (-708.475) [-704.475] (-706.830) (-703.424) -- 0:01:06
Average standard deviation of split frequencies: 0.015676
280500 -- (-704.783) (-704.588) (-709.872) [-703.506] * (-704.598) (-709.667) (-706.966) [-705.764] -- 0:01:06
281000 -- (-705.318) (-710.696) [-706.192] (-704.661) * [-710.781] (-704.787) (-704.622) (-706.863) -- 0:01:06
281500 -- (-707.720) [-704.721] (-701.290) (-712.768) * [-706.620] (-703.320) (-714.761) (-703.333) -- 0:01:06
282000 -- (-706.061) [-699.913] (-706.075) (-705.621) * (-708.907) [-705.159] (-707.563) (-705.449) -- 0:01:06
282500 -- [-707.284] (-701.403) (-714.011) (-703.507) * (-704.805) (-707.096) (-708.762) [-700.869] -- 0:01:08
283000 -- (-702.819) [-705.130] (-712.054) (-707.698) * (-710.117) (-702.862) [-705.685] (-705.877) -- 0:01:08
283500 -- (-705.928) [-711.266] (-707.000) (-708.957) * (-708.081) [-706.356] (-702.914) (-706.199) -- 0:01:08
284000 -- (-707.866) (-711.964) [-709.397] (-708.430) * (-703.670) (-707.968) [-711.090] (-702.849) -- 0:01:08
284500 -- (-706.432) [-700.880] (-711.613) (-702.241) * (-707.806) (-705.601) (-702.890) [-705.362] -- 0:01:07
285000 -- [-702.630] (-705.511) (-704.568) (-700.926) * (-709.598) [-703.780] (-708.038) (-710.882) -- 0:01:07
Average standard deviation of split frequencies: 0.012087
285500 -- [-707.035] (-707.148) (-705.750) (-704.486) * [-702.710] (-703.101) (-707.604) (-710.766) -- 0:01:07
286000 -- (-708.283) (-705.834) [-705.127] (-705.541) * (-705.702) (-707.111) [-704.764] (-706.818) -- 0:01:07
286500 -- (-708.316) (-705.428) (-703.077) [-713.041] * (-708.357) (-709.687) (-702.984) [-704.248] -- 0:01:07
287000 -- (-712.667) (-705.181) [-708.652] (-710.781) * (-706.839) (-708.646) [-704.708] (-712.332) -- 0:01:07
287500 -- (-706.270) (-704.141) (-707.263) [-710.093] * [-705.757] (-707.933) (-704.055) (-721.876) -- 0:01:06
288000 -- (-701.563) [-709.354] (-710.933) (-708.400) * (-706.970) (-708.651) [-706.781] (-712.900) -- 0:01:06
288500 -- (-708.433) [-702.691] (-705.679) (-705.859) * (-701.934) [-708.988] (-704.819) (-715.940) -- 0:01:06
289000 -- (-705.900) (-704.912) (-711.989) [-704.660] * [-710.162] (-709.288) (-707.388) (-705.204) -- 0:01:06
289500 -- (-707.140) (-702.612) [-703.958] (-702.386) * (-706.947) (-706.564) [-708.215] (-704.157) -- 0:01:06
290000 -- (-709.745) (-705.095) (-702.637) [-703.712] * (-708.733) [-703.288] (-702.332) (-704.942) -- 0:01:06
Average standard deviation of split frequencies: 0.009731
290500 -- (-709.168) [-704.447] (-707.846) (-706.110) * (-710.784) (-706.093) (-702.769) [-705.118] -- 0:01:05
291000 -- (-709.139) (-702.151) [-701.126] (-706.824) * (-707.567) [-705.682] (-707.330) (-705.084) -- 0:01:05
291500 -- [-701.728] (-701.953) (-710.671) (-702.439) * (-708.893) (-706.195) [-720.110] (-706.146) -- 0:01:05
292000 -- (-706.989) (-703.690) [-707.129] (-709.695) * (-712.107) [-706.080] (-712.334) (-708.347) -- 0:01:05
292500 -- (-706.551) (-705.706) [-706.325] (-708.507) * [-704.534] (-703.172) (-712.833) (-704.474) -- 0:01:05
293000 -- (-707.534) [-711.576] (-708.032) (-705.896) * [-701.798] (-706.700) (-708.325) (-703.405) -- 0:01:05
293500 -- (-706.212) (-704.929) [-703.467] (-705.995) * [-707.553] (-709.727) (-708.048) (-704.769) -- 0:01:07
294000 -- (-706.009) (-709.919) (-707.102) [-703.702] * (-706.489) [-708.201] (-710.263) (-712.977) -- 0:01:07
294500 -- (-709.714) [-706.337] (-704.848) (-708.957) * [-702.156] (-707.769) (-706.195) (-703.328) -- 0:01:07
295000 -- (-706.556) (-709.353) [-705.303] (-701.546) * (-705.494) (-705.822) [-705.473] (-707.922) -- 0:01:06
Average standard deviation of split frequencies: 0.009555
295500 -- (-710.485) [-703.164] (-706.139) (-700.718) * [-704.801] (-708.766) (-707.066) (-713.437) -- 0:01:06
296000 -- (-706.492) (-707.628) [-702.479] (-703.289) * [-704.272] (-706.848) (-708.995) (-712.147) -- 0:01:06
296500 -- (-706.150) (-705.114) (-705.202) [-699.268] * [-702.058] (-703.036) (-706.202) (-710.237) -- 0:01:06
297000 -- (-704.276) [-704.439] (-711.852) (-701.814) * (-710.273) [-706.238] (-711.860) (-712.805) -- 0:01:06
297500 -- (-706.678) (-704.385) (-711.962) [-706.469] * (-702.572) (-702.143) [-709.376] (-704.059) -- 0:01:06
298000 -- (-707.787) (-708.369) (-714.203) [-706.100] * (-707.245) [-703.427] (-705.114) (-710.286) -- 0:01:05
298500 -- (-705.392) [-702.383] (-710.328) (-706.398) * [-700.210] (-703.848) (-703.287) (-711.116) -- 0:01:05
299000 -- (-703.956) (-706.434) [-716.503] (-703.625) * [-701.296] (-706.630) (-705.924) (-710.312) -- 0:01:05
299500 -- (-710.658) [-701.279] (-701.788) (-705.829) * (-709.289) [-707.081] (-710.782) (-705.138) -- 0:01:05
300000 -- (-710.493) (-704.038) (-709.975) [-707.135] * (-710.081) (-707.401) [-703.556] (-707.646) -- 0:01:05
Average standard deviation of split frequencies: 0.006271
300500 -- [-705.800] (-712.374) (-711.449) (-705.481) * (-705.389) [-703.795] (-709.441) (-709.106) -- 0:01:05
301000 -- (-701.685) [-702.613] (-708.752) (-705.601) * (-706.409) [-702.369] (-713.252) (-708.266) -- 0:01:05
301500 -- (-704.492) [-708.658] (-706.198) (-703.926) * [-701.991] (-711.508) (-708.477) (-706.863) -- 0:01:04
302000 -- (-704.190) (-710.554) [-706.376] (-704.396) * (-707.337) (-708.094) (-709.535) [-703.837] -- 0:01:04
302500 -- (-712.345) (-708.296) (-710.152) [-705.413] * (-702.206) (-709.554) [-708.079] (-709.686) -- 0:01:04
303000 -- (-699.895) [-702.835] (-709.784) (-706.033) * (-704.575) (-712.220) [-709.606] (-704.571) -- 0:01:04
303500 -- (-702.195) (-707.689) (-707.272) [-703.373] * (-707.503) (-709.192) (-705.424) [-705.725] -- 0:01:04
304000 -- (-702.319) [-705.967] (-705.303) (-701.977) * (-704.731) (-707.323) [-709.081] (-703.556) -- 0:01:06
304500 -- (-707.772) (-711.478) (-703.034) [-705.399] * [-705.614] (-710.603) (-703.925) (-703.152) -- 0:01:06
305000 -- (-710.464) [-703.375] (-701.372) (-703.135) * (-706.013) (-712.780) [-706.891] (-703.415) -- 0:01:06
Average standard deviation of split frequencies: 0.004108
305500 -- (-706.992) (-708.356) (-705.358) [-703.327] * (-704.155) (-703.012) (-702.093) [-707.137] -- 0:01:05
306000 -- (-704.413) (-709.496) [-701.695] (-700.555) * [-705.547] (-715.988) (-707.255) (-702.528) -- 0:01:05
306500 -- (-705.544) (-707.015) (-703.637) [-700.973] * (-702.076) (-722.346) [-710.296] (-710.640) -- 0:01:05
307000 -- [-703.842] (-709.955) (-704.889) (-707.786) * (-711.028) (-709.012) (-704.106) [-707.063] -- 0:01:05
307500 -- (-713.592) [-712.191] (-702.879) (-709.924) * (-706.308) (-710.874) [-708.648] (-707.901) -- 0:01:05
308000 -- [-703.476] (-704.399) (-709.182) (-707.229) * (-707.118) [-712.161] (-707.444) (-708.205) -- 0:01:05
308500 -- (-706.159) (-709.716) [-706.071] (-712.336) * (-707.700) (-707.305) (-704.520) [-708.123] -- 0:01:05
309000 -- (-706.386) (-709.063) (-709.967) [-704.891] * (-707.153) (-711.518) (-706.656) [-705.834] -- 0:01:04
309500 -- [-701.324] (-717.402) (-709.189) (-704.091) * (-710.888) (-715.301) [-707.859] (-705.673) -- 0:01:04
310000 -- (-711.322) (-710.359) (-710.331) [-704.124] * (-711.743) (-700.768) [-702.757] (-704.416) -- 0:01:04
Average standard deviation of split frequencies: 0.005058
310500 -- (-710.156) (-715.606) (-704.503) [-699.831] * (-717.771) [-708.278] (-706.686) (-707.783) -- 0:01:04
311000 -- (-704.227) [-704.526] (-704.332) (-704.396) * [-707.056] (-709.580) (-706.795) (-707.497) -- 0:01:04
311500 -- [-704.211] (-710.096) (-711.880) (-703.219) * [-707.217] (-705.645) (-706.694) (-709.230) -- 0:01:04
312000 -- [-705.131] (-709.053) (-715.161) (-703.727) * (-712.108) (-703.725) (-711.349) [-700.947] -- 0:01:03
312500 -- (-706.783) (-710.676) (-705.470) [-711.886] * (-714.661) (-707.344) (-703.480) [-707.198] -- 0:01:03
313000 -- (-706.537) (-702.692) [-703.786] (-711.491) * (-702.840) [-702.865] (-701.598) (-706.047) -- 0:01:03
313500 -- (-704.536) [-702.574] (-703.614) (-717.405) * (-707.964) [-702.811] (-703.594) (-708.372) -- 0:01:03
314000 -- (-705.045) (-705.742) (-700.562) [-701.104] * (-709.129) (-700.677) [-706.774] (-706.830) -- 0:01:03
314500 -- [-707.344] (-704.019) (-706.760) (-701.047) * (-700.937) [-705.119] (-705.704) (-707.782) -- 0:01:03
315000 -- [-704.178] (-702.134) (-702.927) (-713.702) * (-705.530) (-702.310) (-706.847) [-703.230] -- 0:01:05
Average standard deviation of split frequencies: 0.008951
315500 -- [-705.504] (-715.486) (-713.483) (-701.279) * (-700.211) [-703.285] (-708.516) (-704.151) -- 0:01:05
316000 -- (-704.938) [-705.719] (-703.480) (-707.207) * (-706.408) (-707.997) (-704.875) [-710.917] -- 0:01:04
316500 -- (-710.917) [-706.092] (-701.617) (-704.442) * (-713.670) (-709.627) (-706.185) [-707.022] -- 0:01:04
317000 -- (-709.316) [-707.432] (-710.949) (-712.274) * (-711.531) (-703.270) (-707.371) [-707.178] -- 0:01:04
317500 -- [-708.474] (-709.229) (-703.819) (-709.046) * (-711.917) (-702.653) (-705.672) [-709.307] -- 0:01:04
318000 -- (-711.954) (-706.507) (-702.886) [-703.295] * (-703.840) [-703.866] (-704.452) (-713.995) -- 0:01:04
318500 -- (-708.252) [-701.677] (-704.252) (-704.321) * (-703.617) (-708.068) (-700.835) [-703.028] -- 0:01:04
319000 -- (-707.907) [-704.133] (-708.071) (-705.037) * [-707.480] (-701.135) (-705.635) (-705.968) -- 0:01:04
319500 -- (-709.860) (-704.248) (-704.478) [-704.128] * (-704.075) (-706.010) (-708.627) [-705.427] -- 0:01:03
320000 -- (-709.109) (-703.741) (-700.746) [-710.781] * (-712.004) [-705.027] (-700.891) (-712.159) -- 0:01:03
Average standard deviation of split frequencies: 0.009801
320500 -- (-706.955) (-708.953) [-702.211] (-708.908) * (-705.175) (-705.822) [-705.230] (-708.531) -- 0:01:03
321000 -- [-700.578] (-710.002) (-699.661) (-705.684) * (-704.669) (-709.274) (-706.844) [-703.245] -- 0:01:03
321500 -- (-703.760) (-705.395) (-709.262) [-703.488] * (-703.795) (-708.501) [-704.224] (-702.451) -- 0:01:03
322000 -- (-705.117) (-711.051) (-704.662) [-704.406] * (-705.353) (-708.690) [-703.367] (-706.554) -- 0:01:03
322500 -- (-705.026) (-713.140) (-703.631) [-704.683] * (-704.930) (-711.776) [-706.992] (-709.889) -- 0:01:03
323000 -- (-704.991) [-702.853] (-699.064) (-709.359) * (-708.979) (-711.416) [-703.533] (-707.858) -- 0:01:02
323500 -- (-703.085) [-703.936] (-705.398) (-711.922) * (-703.114) [-704.111] (-706.310) (-706.137) -- 0:01:02
324000 -- (-704.711) (-706.437) (-704.245) [-705.615] * (-707.356) (-702.877) [-705.262] (-705.781) -- 0:01:02
324500 -- (-699.403) (-703.487) [-703.264] (-699.952) * (-702.774) [-701.710] (-701.959) (-706.762) -- 0:01:02
325000 -- (-708.243) (-704.065) (-703.213) [-701.089] * (-707.740) (-702.884) [-702.802] (-705.555) -- 0:01:02
Average standard deviation of split frequencies: 0.011568
325500 -- (-709.362) [-702.788] (-702.662) (-701.009) * (-708.698) (-707.068) [-703.393] (-705.243) -- 0:01:04
326000 -- (-708.341) (-703.208) [-707.842] (-704.060) * (-708.020) (-707.179) [-707.628] (-707.687) -- 0:01:04
326500 -- [-701.318] (-705.035) (-712.010) (-705.686) * (-705.347) [-705.652] (-706.335) (-704.264) -- 0:01:03
327000 -- (-705.019) (-705.005) (-711.295) [-704.479] * (-706.239) (-705.711) (-703.642) [-702.195] -- 0:01:03
327500 -- (-705.965) (-704.999) (-704.193) [-707.326] * (-705.669) [-710.779] (-701.108) (-700.938) -- 0:01:03
328000 -- (-711.051) (-706.194) (-707.082) [-705.717] * (-708.880) (-703.715) (-703.230) [-702.060] -- 0:01:03
328500 -- (-707.986) (-705.281) (-703.885) [-713.830] * (-709.854) (-705.246) [-704.056] (-697.959) -- 0:01:03
329000 -- (-703.886) (-711.720) [-702.084] (-702.612) * (-705.973) (-706.481) (-703.672) [-703.495] -- 0:01:03
329500 -- [-705.527] (-711.732) (-707.671) (-706.664) * [-705.322] (-706.724) (-703.600) (-707.925) -- 0:01:03
330000 -- [-703.912] (-706.506) (-706.542) (-706.497) * (-700.556) (-706.139) (-716.398) [-702.173] -- 0:01:02
Average standard deviation of split frequencies: 0.012355
330500 -- [-706.789] (-706.392) (-710.008) (-704.880) * (-710.485) [-705.251] (-708.020) (-704.428) -- 0:01:02
331000 -- (-708.724) (-706.605) (-710.814) [-703.547] * (-706.600) (-704.871) [-706.824] (-703.034) -- 0:01:02
331500 -- (-701.917) [-704.668] (-699.128) (-703.267) * (-705.862) (-706.197) (-702.280) [-700.811] -- 0:01:02
332000 -- (-707.677) (-705.527) [-704.074] (-706.663) * (-705.488) [-705.467] (-707.695) (-709.599) -- 0:01:02
332500 -- (-709.824) (-702.373) (-705.505) [-707.538] * [-702.874] (-707.146) (-703.865) (-711.506) -- 0:01:02
333000 -- [-701.337] (-706.168) (-712.302) (-708.704) * (-704.440) (-702.613) [-703.773] (-710.252) -- 0:01:02
333500 -- [-707.232] (-705.493) (-705.476) (-700.815) * [-704.685] (-702.725) (-712.121) (-708.430) -- 0:01:01
334000 -- (-711.254) (-714.770) (-704.336) [-707.711] * (-709.043) (-705.536) [-702.213] (-709.294) -- 0:01:01
334500 -- (-713.797) [-703.950] (-708.237) (-703.287) * (-714.087) (-706.353) (-708.543) [-707.401] -- 0:01:01
335000 -- (-711.977) (-713.915) [-715.541] (-705.753) * (-701.859) [-706.199] (-708.089) (-706.738) -- 0:01:01
Average standard deviation of split frequencies: 0.014965
335500 -- [-703.878] (-713.490) (-713.841) (-700.970) * (-702.503) (-706.043) (-709.933) [-705.449] -- 0:01:01
336000 -- (-715.200) (-713.635) (-710.536) [-705.124] * (-705.846) (-710.639) [-708.665] (-702.401) -- 0:01:03
336500 -- (-705.235) (-704.852) (-709.076) [-705.609] * (-701.223) (-708.730) (-707.903) [-707.356] -- 0:01:03
337000 -- [-703.965] (-710.052) (-705.274) (-704.769) * (-702.118) [-705.012] (-711.671) (-706.529) -- 0:01:02
337500 -- (-705.379) (-705.558) (-706.625) [-705.731] * (-705.827) (-703.875) (-706.029) [-703.364] -- 0:01:02
338000 -- [-709.783] (-704.069) (-701.705) (-711.965) * [-708.706] (-709.662) (-701.696) (-701.260) -- 0:01:02
338500 -- (-713.103) (-710.572) (-703.449) [-711.752] * (-705.620) (-712.389) [-702.740] (-709.626) -- 0:01:02
339000 -- [-712.050] (-702.654) (-712.827) (-710.498) * (-705.460) (-710.402) [-707.296] (-709.291) -- 0:01:02
339500 -- [-710.739] (-706.059) (-703.895) (-706.673) * (-713.615) (-716.353) (-705.840) [-709.112] -- 0:01:02
340000 -- (-713.564) [-703.194] (-709.080) (-705.560) * (-704.570) (-707.900) (-709.528) [-705.798] -- 0:01:02
Average standard deviation of split frequencies: 0.013838
340500 -- (-708.770) (-709.870) (-703.803) [-705.224] * (-705.488) [-710.995] (-705.535) (-705.860) -- 0:01:01
341000 -- (-710.173) (-705.761) (-704.664) [-709.077] * [-709.384] (-704.338) (-707.886) (-704.235) -- 0:01:01
341500 -- (-706.980) (-707.665) (-700.219) [-709.279] * (-708.649) [-706.480] (-713.191) (-708.358) -- 0:01:01
342000 -- (-705.425) (-706.560) (-703.296) [-705.403] * (-703.865) [-704.494] (-708.637) (-703.270) -- 0:01:01
342500 -- (-707.076) [-702.754] (-702.434) (-704.351) * [-702.200] (-706.915) (-709.515) (-704.539) -- 0:01:01
343000 -- [-702.770] (-701.080) (-703.553) (-710.357) * (-707.431) (-710.110) [-713.698] (-707.132) -- 0:01:01
343500 -- (-705.405) [-701.524] (-707.672) (-703.897) * (-713.955) (-710.600) (-707.542) [-708.567] -- 0:01:01
344000 -- (-702.851) [-702.928] (-708.941) (-712.122) * (-706.531) [-704.322] (-705.014) (-713.795) -- 0:01:01
344500 -- [-708.925] (-703.145) (-700.946) (-702.681) * (-717.742) (-703.083) [-703.952] (-708.240) -- 0:01:00
345000 -- (-705.957) (-708.623) [-702.358] (-704.850) * [-708.317] (-699.680) (-707.169) (-717.013) -- 0:01:00
Average standard deviation of split frequencies: 0.016349
345500 -- [-705.229] (-701.942) (-706.390) (-704.946) * [-704.733] (-705.109) (-711.121) (-712.159) -- 0:01:02
346000 -- (-710.948) [-706.386] (-705.690) (-707.232) * [-705.677] (-703.742) (-714.260) (-715.906) -- 0:01:02
346500 -- (-701.921) (-707.548) [-703.777] (-709.132) * (-706.294) [-706.069] (-706.488) (-707.943) -- 0:01:02
347000 -- (-700.028) (-708.277) (-702.173) [-705.495] * [-702.890] (-713.940) (-708.906) (-706.755) -- 0:01:02
347500 -- [-700.944] (-709.534) (-700.689) (-708.683) * (-704.044) (-704.436) (-704.863) [-701.727] -- 0:01:01
348000 -- (-701.991) [-701.341] (-704.213) (-706.614) * (-706.417) (-706.048) (-709.075) [-707.507] -- 0:01:01
348500 -- [-703.418] (-707.511) (-709.067) (-703.616) * (-705.191) (-706.900) [-709.784] (-701.309) -- 0:01:01
349000 -- (-708.400) (-703.556) (-704.141) [-706.025] * (-704.558) (-705.636) (-704.197) [-703.110] -- 0:01:01
349500 -- (-706.470) (-710.131) [-702.337] (-706.231) * [-705.562] (-706.441) (-704.803) (-702.344) -- 0:01:01
350000 -- (-710.250) [-705.965] (-705.431) (-703.974) * (-708.863) (-705.670) [-700.247] (-706.411) -- 0:01:01
Average standard deviation of split frequencies: 0.017028
350500 -- (-703.356) (-707.181) (-706.526) [-701.953] * (-703.386) (-705.363) [-705.026] (-713.677) -- 0:01:01
351000 -- [-709.999] (-711.489) (-700.900) (-701.001) * [-702.623] (-704.032) (-707.136) (-708.100) -- 0:01:01
351500 -- [-702.508] (-703.247) (-705.264) (-702.987) * (-702.893) [-705.539] (-705.856) (-707.580) -- 0:01:00
352000 -- (-702.611) (-711.224) [-702.412] (-702.173) * (-704.068) (-710.934) [-702.405] (-714.609) -- 0:01:00
352500 -- (-706.520) (-706.780) (-701.785) [-702.698] * [-702.642] (-705.658) (-702.997) (-708.969) -- 0:01:00
353000 -- [-705.061] (-704.512) (-704.297) (-703.694) * (-705.062) (-708.754) [-708.044] (-713.753) -- 0:01:00
353500 -- (-701.381) (-707.434) [-705.425] (-703.147) * [-703.832] (-705.516) (-701.831) (-711.524) -- 0:01:00
354000 -- (-701.966) (-706.173) [-700.608] (-704.181) * (-705.932) [-699.739] (-706.665) (-714.679) -- 0:01:00
354500 -- (-705.031) (-703.951) (-709.498) [-701.325] * (-712.093) [-701.942] (-715.021) (-710.588) -- 0:01:00
355000 -- (-710.309) (-707.241) (-711.595) [-701.722] * (-703.825) (-703.830) (-709.707) [-706.778] -- 0:00:59
Average standard deviation of split frequencies: 0.017656
355500 -- (-708.702) [-706.285] (-706.139) (-700.782) * (-715.132) [-705.048] (-704.795) (-702.796) -- 0:00:59
356000 -- (-701.423) (-707.907) (-704.630) [-704.448] * (-711.440) (-702.321) (-700.614) [-704.384] -- 0:01:01
356500 -- (-706.008) (-710.442) [-702.090] (-710.511) * (-701.664) (-703.091) (-702.896) [-698.828] -- 0:01:01
357000 -- (-711.293) (-708.418) (-703.646) [-706.440] * (-707.993) [-707.071] (-705.679) (-702.095) -- 0:01:01
357500 -- (-707.457) (-705.095) [-711.726] (-708.176) * (-705.713) (-705.353) (-705.434) [-703.361] -- 0:01:01
358000 -- [-701.701] (-709.599) (-707.968) (-704.653) * (-709.191) [-705.390] (-703.575) (-704.648) -- 0:01:00
358500 -- (-707.701) (-705.386) (-705.053) [-705.538] * (-704.944) (-706.247) [-706.035] (-701.226) -- 0:01:00
359000 -- (-703.545) (-701.941) [-706.434] (-708.703) * (-704.196) (-704.591) (-704.220) [-706.408] -- 0:01:00
359500 -- (-703.761) [-703.542] (-701.463) (-703.920) * [-699.390] (-703.190) (-704.474) (-706.334) -- 0:01:00
360000 -- (-703.413) [-701.935] (-704.575) (-705.659) * [-708.988] (-706.019) (-705.873) (-702.359) -- 0:01:00
Average standard deviation of split frequencies: 0.019170
360500 -- (-707.572) [-699.890] (-705.223) (-706.285) * (-702.909) (-708.076) [-703.165] (-713.518) -- 0:01:00
361000 -- (-701.561) (-704.763) (-702.313) [-705.524] * (-704.728) [-702.972] (-710.600) (-705.769) -- 0:01:00
361500 -- [-704.540] (-703.130) (-707.849) (-710.994) * [-702.735] (-702.384) (-701.895) (-706.760) -- 0:01:00
362000 -- (-709.140) (-705.855) (-713.324) [-709.296] * (-714.108) (-702.847) [-700.331] (-709.638) -- 0:00:59
362500 -- (-706.944) [-708.059] (-708.631) (-706.244) * (-708.727) (-706.872) (-702.756) [-707.540] -- 0:00:59
363000 -- (-706.593) [-702.596] (-701.950) (-707.714) * (-710.953) [-702.702] (-706.902) (-703.131) -- 0:00:59
363500 -- (-709.693) [-704.078] (-700.363) (-706.396) * (-706.403) (-705.378) (-703.811) [-705.500] -- 0:00:59
364000 -- [-703.120] (-706.579) (-711.730) (-712.281) * [-706.680] (-706.543) (-711.072) (-709.226) -- 0:00:59
364500 -- (-705.187) [-704.919] (-706.340) (-705.382) * [-704.399] (-706.487) (-703.381) (-707.373) -- 0:00:59
365000 -- (-704.088) [-707.824] (-703.210) (-704.924) * (-706.709) (-706.011) [-702.336] (-709.791) -- 0:00:59
Average standard deviation of split frequencies: 0.020608
365500 -- (-709.438) (-705.750) (-704.686) [-700.395] * (-705.685) [-703.596] (-703.030) (-706.271) -- 0:00:59
366000 -- (-705.768) (-706.398) [-704.218] (-706.883) * (-703.402) [-709.110] (-709.243) (-706.206) -- 0:00:58
366500 -- (-708.713) (-706.167) (-708.214) [-713.152] * (-709.826) (-713.851) [-707.666] (-704.343) -- 0:00:58
367000 -- (-703.576) (-702.952) (-703.473) [-708.280] * (-706.025) (-712.724) (-706.558) [-702.815] -- 0:01:00
367500 -- (-708.715) [-701.900] (-702.063) (-704.646) * (-702.605) (-710.482) [-703.478] (-706.152) -- 0:01:00
368000 -- [-711.025] (-707.087) (-708.160) (-704.839) * [-699.930] (-704.966) (-706.273) (-708.804) -- 0:01:00
368500 -- [-701.799] (-703.889) (-707.796) (-702.944) * (-706.606) [-704.714] (-705.579) (-710.909) -- 0:00:59
369000 -- (-709.405) [-706.782] (-707.047) (-707.624) * (-705.837) [-703.792] (-706.029) (-709.886) -- 0:00:59
369500 -- [-704.701] (-705.929) (-707.090) (-706.455) * (-700.560) [-704.501] (-707.759) (-707.175) -- 0:00:59
370000 -- (-709.284) [-703.287] (-699.384) (-701.362) * [-707.394] (-708.498) (-705.854) (-707.585) -- 0:00:59
Average standard deviation of split frequencies: 0.020348
370500 -- (-711.457) (-702.472) [-698.374] (-706.950) * [-710.349] (-707.848) (-699.770) (-713.836) -- 0:00:59
371000 -- [-708.518] (-702.702) (-705.373) (-704.033) * [-704.862] (-709.337) (-709.525) (-702.089) -- 0:00:59
371500 -- [-708.037] (-707.641) (-706.739) (-703.937) * [-699.712] (-704.448) (-713.613) (-704.467) -- 0:00:59
372000 -- (-712.394) [-703.629] (-711.212) (-704.621) * (-709.844) (-704.177) (-707.497) [-702.926] -- 0:00:59
372500 -- [-707.200] (-698.989) (-705.042) (-706.079) * (-707.884) [-706.525] (-714.499) (-705.614) -- 0:00:58
373000 -- (-708.109) [-703.350] (-704.476) (-706.229) * (-709.330) (-702.872) (-709.942) [-701.450] -- 0:00:58
373500 -- (-703.735) (-702.662) (-707.284) [-709.265] * (-701.519) (-708.801) (-705.654) [-705.343] -- 0:00:58
374000 -- (-715.538) (-705.939) (-707.243) [-704.152] * (-713.556) (-701.253) (-706.015) [-705.312] -- 0:00:58
374500 -- (-708.590) (-704.992) (-703.621) [-705.456] * (-703.804) (-707.670) [-705.136] (-712.847) -- 0:00:58
375000 -- (-706.358) (-702.262) [-702.693] (-702.829) * (-702.208) (-713.411) [-704.908] (-703.938) -- 0:00:58
Average standard deviation of split frequencies: 0.015881
375500 -- (-703.216) (-704.464) [-705.399] (-703.056) * (-702.587) (-706.005) (-708.764) [-713.497] -- 0:00:58
376000 -- (-707.040) (-702.351) (-711.232) [-706.141] * [-710.109] (-706.510) (-711.312) (-706.140) -- 0:00:58
376500 -- (-705.277) (-706.015) [-703.878] (-709.133) * (-705.930) (-711.159) (-706.660) [-704.776] -- 0:00:57
377000 -- [-700.573] (-703.204) (-706.296) (-705.094) * (-705.825) [-711.300] (-703.439) (-702.162) -- 0:00:57
377500 -- [-708.312] (-706.985) (-709.785) (-709.337) * (-707.376) (-706.575) (-709.503) [-700.304] -- 0:00:57
378000 -- (-709.448) (-710.324) (-706.209) [-707.406] * (-707.147) (-710.126) (-702.233) [-702.004] -- 0:00:59
378500 -- (-711.871) (-704.854) (-701.855) [-713.026] * (-708.147) (-714.028) [-701.488] (-711.258) -- 0:00:59
379000 -- (-705.933) (-708.461) [-705.701] (-709.754) * (-707.822) (-707.868) [-704.192] (-706.521) -- 0:00:58
379500 -- [-708.228] (-700.907) (-706.618) (-709.636) * (-705.231) (-702.305) [-705.815] (-711.810) -- 0:00:58
380000 -- (-710.024) (-708.793) (-706.898) [-704.240] * (-704.426) [-707.663] (-707.779) (-711.566) -- 0:00:58
Average standard deviation of split frequencies: 0.016512
380500 -- (-712.168) (-708.907) (-706.363) [-711.136] * [-703.221] (-705.032) (-703.731) (-703.929) -- 0:00:58
381000 -- (-706.520) [-708.309] (-705.444) (-707.199) * (-706.760) (-710.862) [-705.801] (-705.405) -- 0:00:58
381500 -- (-709.501) [-709.596] (-708.667) (-706.520) * (-705.918) (-703.496) (-709.543) [-703.593] -- 0:00:58
382000 -- (-706.117) (-709.890) (-706.252) [-704.578] * (-709.989) (-704.246) [-706.797] (-706.487) -- 0:00:58
382500 -- [-708.008] (-709.776) (-706.731) (-705.634) * (-706.613) [-704.128] (-705.847) (-702.039) -- 0:00:58
383000 -- (-704.960) (-705.334) [-704.426] (-702.756) * (-705.611) (-711.790) [-700.938] (-703.173) -- 0:00:57
383500 -- (-705.021) (-704.265) (-707.298) [-712.083] * (-708.515) (-709.281) (-709.047) [-705.156] -- 0:00:57
384000 -- (-707.371) (-702.618) [-704.582] (-704.296) * (-705.639) [-710.410] (-710.286) (-706.326) -- 0:00:57
384500 -- [-702.934] (-706.590) (-703.054) (-708.657) * (-709.684) [-707.419] (-707.929) (-705.956) -- 0:00:57
385000 -- (-703.637) (-703.074) (-705.329) [-705.450] * (-708.813) (-712.222) (-706.875) [-703.095] -- 0:00:57
Average standard deviation of split frequencies: 0.015469
385500 -- (-705.874) (-707.652) (-710.019) [-704.052] * (-710.940) [-707.419] (-710.986) (-702.892) -- 0:00:57
386000 -- [-705.915] (-703.210) (-705.703) (-706.998) * (-704.089) [-705.362] (-708.937) (-707.015) -- 0:00:57
386500 -- (-708.982) [-706.412] (-709.239) (-705.884) * (-706.433) (-707.770) [-703.375] (-710.593) -- 0:00:57
387000 -- (-705.193) [-710.421] (-710.270) (-706.055) * (-707.257) (-713.087) [-704.963] (-704.086) -- 0:00:57
387500 -- (-702.903) (-704.135) (-704.357) [-712.719] * (-702.002) (-708.591) [-707.783] (-702.847) -- 0:00:56
388000 -- (-703.323) (-704.202) (-704.562) [-707.374] * [-700.696] (-707.843) (-704.490) (-711.185) -- 0:00:56
388500 -- (-703.062) [-701.388] (-706.192) (-704.777) * (-706.258) (-706.759) [-703.381] (-703.063) -- 0:00:56
389000 -- (-710.810) (-704.775) [-704.097] (-709.516) * (-706.263) (-702.199) (-705.615) [-701.257] -- 0:00:58
389500 -- (-710.765) (-705.634) (-705.372) [-703.814] * (-701.323) [-702.499] (-702.686) (-704.552) -- 0:00:57
390000 -- (-714.101) [-703.919] (-704.576) (-707.896) * (-713.639) (-703.419) (-702.454) [-703.490] -- 0:00:57
Average standard deviation of split frequencies: 0.014480
390500 -- (-715.135) (-708.783) (-705.604) [-702.763] * [-703.481] (-712.626) (-705.314) (-703.456) -- 0:00:57
391000 -- (-708.825) (-704.125) [-707.418] (-707.678) * (-705.979) (-706.230) (-700.281) [-701.278] -- 0:00:57
391500 -- (-704.539) (-703.845) (-705.330) [-709.039] * (-708.486) (-709.201) [-702.625] (-710.523) -- 0:00:57
392000 -- [-702.378] (-701.147) (-709.246) (-704.939) * (-706.188) [-705.225] (-703.313) (-703.981) -- 0:00:57
392500 -- (-706.618) (-708.705) [-709.335] (-705.899) * (-704.241) (-713.624) (-709.083) [-706.067] -- 0:00:57
393000 -- [-705.993] (-706.448) (-704.414) (-703.324) * [-705.227] (-709.971) (-711.227) (-707.125) -- 0:00:57
393500 -- (-705.405) (-702.806) [-707.494] (-711.120) * (-701.498) (-700.569) (-707.393) [-705.262] -- 0:00:57
394000 -- (-705.564) (-701.349) (-713.618) [-703.361] * [-703.781] (-704.371) (-700.460) (-707.883) -- 0:00:56
394500 -- (-707.626) (-701.230) [-706.244] (-703.859) * [-703.483] (-705.173) (-706.153) (-706.840) -- 0:00:56
395000 -- [-707.143] (-706.655) (-701.711) (-703.379) * [-709.561] (-702.983) (-703.223) (-713.965) -- 0:00:56
Average standard deviation of split frequencies: 0.016666
395500 -- (-712.758) (-711.473) (-705.013) [-699.678] * (-705.512) (-703.715) (-704.512) [-704.515] -- 0:00:56
396000 -- [-704.682] (-709.258) (-704.703) (-704.011) * (-709.711) (-707.939) (-700.689) [-707.874] -- 0:00:56
396500 -- (-706.944) [-701.870] (-703.877) (-701.970) * [-704.174] (-706.563) (-709.044) (-709.556) -- 0:00:56
397000 -- (-713.370) (-706.522) (-707.495) [-700.321] * (-713.889) (-710.563) [-706.953] (-706.011) -- 0:00:56
397500 -- (-705.925) (-702.741) [-703.908] (-703.086) * (-708.498) (-705.981) (-706.058) [-711.500] -- 0:00:56
398000 -- (-716.526) (-704.439) (-703.849) [-704.885] * [-706.887] (-709.682) (-707.976) (-708.243) -- 0:00:55
398500 -- [-710.523] (-707.572) (-708.284) (-705.725) * (-709.716) [-706.251] (-712.661) (-708.020) -- 0:00:55
399000 -- (-704.251) (-706.166) [-705.855] (-704.194) * (-704.379) (-709.024) [-706.109] (-713.110) -- 0:00:55
399500 -- (-704.042) (-706.874) (-706.251) [-706.826] * (-707.645) [-704.470] (-706.727) (-712.079) -- 0:00:57
400000 -- [-708.681] (-711.317) (-704.162) (-707.977) * (-705.670) (-702.325) (-707.285) [-709.829] -- 0:00:57
Average standard deviation of split frequencies: 0.016472
400500 -- [-702.629] (-708.947) (-705.621) (-711.081) * (-712.510) [-707.130] (-710.502) (-704.385) -- 0:00:56
401000 -- [-702.752] (-708.600) (-701.739) (-705.736) * (-700.719) (-709.079) (-702.460) [-705.001] -- 0:00:56
401500 -- (-705.483) [-705.670] (-701.093) (-702.050) * [-705.389] (-712.505) (-703.258) (-708.205) -- 0:00:56
402000 -- (-707.949) [-712.919] (-705.578) (-704.342) * (-704.204) (-704.885) (-710.693) [-712.631] -- 0:00:56
402500 -- [-701.998] (-707.526) (-705.261) (-705.101) * (-709.600) (-713.830) [-706.679] (-704.658) -- 0:00:56
403000 -- (-701.277) (-706.709) (-710.906) [-702.929] * (-706.060) (-707.802) (-700.673) [-704.131] -- 0:00:56
403500 -- (-702.511) (-703.205) [-708.884] (-704.341) * (-707.169) (-706.567) (-706.235) [-705.327] -- 0:00:56
404000 -- (-701.984) [-713.679] (-703.745) (-703.145) * [-703.409] (-709.483) (-710.249) (-708.468) -- 0:00:56
404500 -- [-703.083] (-700.334) (-708.222) (-705.389) * (-701.251) (-704.817) [-700.776] (-707.375) -- 0:00:55
405000 -- (-703.563) (-702.854) (-713.180) [-702.127] * (-701.401) [-706.457] (-709.217) (-711.551) -- 0:00:55
Average standard deviation of split frequencies: 0.013933
405500 -- (-705.274) (-705.558) (-703.484) [-712.266] * (-703.669) (-709.656) (-705.465) [-703.704] -- 0:00:55
406000 -- [-704.640] (-706.197) (-704.125) (-714.285) * (-705.704) (-710.030) [-705.705] (-713.527) -- 0:00:55
406500 -- (-708.409) (-708.049) (-708.184) [-708.220] * (-715.490) (-711.261) [-702.788] (-705.428) -- 0:00:55
407000 -- (-705.813) (-708.577) (-710.717) [-705.139] * (-710.036) (-707.087) [-705.343] (-706.794) -- 0:00:55
407500 -- [-708.292] (-706.683) (-706.074) (-706.458) * [-711.014] (-703.374) (-709.673) (-701.746) -- 0:00:55
408000 -- (-706.511) (-710.106) (-707.829) [-709.490] * (-705.947) [-704.976] (-710.796) (-705.892) -- 0:00:55
408500 -- (-707.480) (-704.596) [-705.304] (-704.013) * (-703.819) (-704.707) (-713.509) [-705.100] -- 0:00:55
409000 -- [-701.233] (-708.685) (-706.627) (-704.970) * (-703.453) [-705.814] (-702.489) (-709.197) -- 0:00:54
409500 -- (-707.497) [-701.687] (-705.223) (-703.052) * [-705.984] (-701.213) (-705.655) (-706.481) -- 0:00:54
410000 -- [-706.083] (-702.291) (-705.780) (-700.494) * (-706.750) [-702.204] (-712.515) (-704.527) -- 0:00:56
Average standard deviation of split frequencies: 0.011479
410500 -- (-703.064) (-705.573) [-707.514] (-702.993) * (-705.130) (-707.713) [-707.029] (-711.760) -- 0:00:56
411000 -- (-704.641) [-699.715] (-711.371) (-704.154) * [-702.933] (-703.765) (-705.718) (-712.253) -- 0:00:55
411500 -- (-707.080) [-702.728] (-702.865) (-709.896) * (-708.914) (-705.939) [-705.747] (-709.599) -- 0:00:55
412000 -- (-715.665) (-708.109) [-706.094] (-703.761) * (-703.475) [-705.801] (-706.680) (-710.707) -- 0:00:55
412500 -- (-706.026) [-706.859] (-708.991) (-707.595) * (-706.631) (-709.454) (-703.198) [-707.008] -- 0:00:55
413000 -- (-710.317) [-704.558] (-706.048) (-703.310) * (-714.354) (-711.307) (-709.857) [-708.616] -- 0:00:55
413500 -- (-706.971) [-701.917] (-707.995) (-706.530) * [-703.738] (-705.027) (-705.714) (-703.227) -- 0:00:55
414000 -- (-710.114) (-705.447) (-705.270) [-706.611] * (-705.225) [-702.118] (-702.889) (-707.001) -- 0:00:55
414500 -- (-710.314) [-702.805] (-713.364) (-707.636) * (-704.338) (-704.981) [-702.640] (-709.214) -- 0:00:55
415000 -- (-709.088) [-705.982] (-705.098) (-711.340) * (-701.142) (-712.370) [-702.808] (-713.021) -- 0:00:54
Average standard deviation of split frequencies: 0.012087
415500 -- [-704.609] (-705.998) (-706.230) (-710.236) * [-704.161] (-703.202) (-715.284) (-710.620) -- 0:00:54
416000 -- [-706.913] (-711.634) (-708.194) (-704.331) * (-707.338) (-707.089) [-706.966] (-705.925) -- 0:00:54
416500 -- (-707.413) (-712.317) (-703.367) [-704.699] * (-703.920) [-706.741] (-708.543) (-699.468) -- 0:00:54
417000 -- (-704.381) [-710.401] (-701.081) (-702.777) * (-706.095) (-704.157) [-707.448] (-709.291) -- 0:00:54
417500 -- (-706.266) (-711.393) (-708.457) [-705.091] * (-704.264) (-710.967) (-712.079) [-707.992] -- 0:00:54
418000 -- [-704.117] (-709.655) (-704.560) (-705.009) * (-703.980) (-707.921) [-704.077] (-706.185) -- 0:00:54
418500 -- [-710.893] (-702.898) (-707.012) (-710.912) * [-708.153] (-708.375) (-710.132) (-705.986) -- 0:00:54
419000 -- (-709.754) (-706.847) (-707.328) [-703.374] * (-704.606) [-704.392] (-707.148) (-705.474) -- 0:00:54
419500 -- (-709.111) (-711.706) [-703.462] (-702.411) * (-703.202) (-706.870) (-709.573) [-704.934] -- 0:00:53
420000 -- [-704.180] (-708.496) (-710.733) (-704.199) * (-706.313) (-710.191) [-702.501] (-705.743) -- 0:00:53
Average standard deviation of split frequencies: 0.013447
420500 -- (-703.670) (-712.755) (-703.530) [-706.251] * (-707.592) (-710.197) (-711.021) [-712.680] -- 0:00:53
421000 -- (-708.516) (-705.549) (-704.975) [-709.102] * (-704.540) (-703.181) [-702.824] (-716.145) -- 0:00:55
421500 -- (-710.175) (-716.176) [-704.305] (-703.984) * (-707.783) (-710.059) [-705.722] (-720.015) -- 0:00:54
422000 -- (-703.312) [-708.735] (-703.182) (-704.683) * (-702.390) (-707.632) [-711.112] (-709.882) -- 0:00:54
422500 -- [-703.074] (-704.279) (-701.701) (-709.545) * (-710.719) (-701.839) [-708.953] (-707.425) -- 0:00:54
423000 -- [-700.880] (-702.237) (-703.640) (-705.701) * (-712.364) [-701.746] (-713.068) (-706.567) -- 0:00:54
423500 -- [-703.669] (-704.279) (-709.843) (-706.397) * [-704.916] (-705.932) (-701.728) (-703.872) -- 0:00:54
424000 -- (-705.278) (-708.367) [-704.959] (-704.583) * (-716.227) (-707.674) [-701.592] (-705.188) -- 0:00:54
424500 -- (-705.376) (-703.617) (-709.355) [-705.429] * (-708.758) (-705.371) [-705.034] (-709.055) -- 0:00:54
425000 -- (-709.354) [-706.044] (-702.893) (-700.200) * (-706.866) (-704.827) [-706.157] (-709.514) -- 0:00:54
Average standard deviation of split frequencies: 0.013279
425500 -- (-701.886) (-703.626) [-699.929] (-703.675) * [-706.039] (-705.814) (-712.299) (-705.216) -- 0:00:54
426000 -- (-703.528) (-706.515) (-702.297) [-707.953] * (-712.093) [-703.329] (-710.785) (-710.304) -- 0:00:53
426500 -- [-708.927] (-704.834) (-707.590) (-711.545) * (-706.304) (-707.315) (-712.603) [-702.686] -- 0:00:53
427000 -- [-708.098] (-706.049) (-710.367) (-705.399) * [-701.906] (-704.003) (-707.309) (-702.874) -- 0:00:53
427500 -- [-703.692] (-705.552) (-707.321) (-702.223) * [-710.629] (-706.959) (-706.585) (-709.623) -- 0:00:53
428000 -- (-704.597) [-702.149] (-708.847) (-708.863) * (-708.355) [-706.328] (-709.583) (-704.650) -- 0:00:53
428500 -- [-700.931] (-703.587) (-714.879) (-701.590) * (-713.838) [-707.291] (-701.286) (-706.311) -- 0:00:53
429000 -- (-707.359) (-705.553) (-702.720) [-705.066] * [-711.550] (-705.770) (-706.334) (-706.319) -- 0:00:53
429500 -- (-706.184) [-707.864] (-701.126) (-707.410) * [-710.202] (-709.917) (-710.545) (-709.034) -- 0:00:53
430000 -- [-700.998] (-707.539) (-707.917) (-704.702) * (-714.835) (-701.267) (-702.232) [-702.824] -- 0:00:53
Average standard deviation of split frequencies: 0.014595
430500 -- (-704.573) (-707.160) [-711.192] (-709.726) * (-713.138) [-705.651] (-714.319) (-703.388) -- 0:00:52
431000 -- (-710.825) [-707.003] (-711.186) (-705.115) * (-708.257) (-711.472) [-706.332] (-707.378) -- 0:00:52
431500 -- (-707.569) (-702.110) (-708.071) [-701.065] * (-709.947) [-706.205] (-704.194) (-701.483) -- 0:00:52
432000 -- (-703.165) (-706.474) [-709.781] (-712.470) * (-709.603) [-703.888] (-703.250) (-705.553) -- 0:00:53
432500 -- (-713.664) (-704.825) [-704.838] (-708.524) * (-710.676) (-710.417) (-711.244) [-703.054] -- 0:00:53
433000 -- (-709.351) (-704.384) (-708.497) [-698.969] * (-709.663) [-706.531] (-707.748) (-707.683) -- 0:00:53
433500 -- (-707.737) [-704.651] (-710.557) (-705.467) * [-713.800] (-712.020) (-704.139) (-707.505) -- 0:00:53
434000 -- (-705.175) (-707.953) [-704.288] (-705.382) * (-711.070) (-707.913) (-703.095) [-705.994] -- 0:00:53
434500 -- [-703.497] (-702.895) (-702.786) (-710.618) * [-718.043] (-705.212) (-700.381) (-704.562) -- 0:00:53
435000 -- (-708.335) (-701.831) [-702.061] (-700.984) * (-708.240) (-701.017) (-708.332) [-709.743] -- 0:00:53
Average standard deviation of split frequencies: 0.015858
435500 -- (-709.787) [-704.261] (-705.456) (-705.326) * [-704.051] (-709.286) (-705.865) (-703.306) -- 0:00:53
436000 -- (-711.844) [-702.136] (-704.896) (-702.987) * (-705.317) (-707.331) (-706.772) [-703.985] -- 0:00:53
436500 -- (-709.291) [-703.616] (-702.816) (-704.744) * (-705.364) (-701.469) [-705.544] (-703.323) -- 0:00:52
437000 -- (-704.115) (-702.141) [-704.581] (-704.176) * (-708.128) (-706.701) [-713.300] (-705.265) -- 0:00:52
437500 -- [-706.531] (-701.402) (-702.294) (-700.327) * (-705.973) (-700.819) (-710.387) [-703.968] -- 0:00:52
438000 -- (-705.118) [-700.304] (-706.990) (-702.346) * (-707.411) (-706.107) (-715.994) [-703.603] -- 0:00:52
438500 -- (-702.414) (-699.502) [-701.710] (-705.745) * (-710.065) (-704.812) (-711.871) [-704.122] -- 0:00:52
439000 -- [-705.801] (-701.806) (-702.370) (-708.991) * (-702.625) (-708.075) (-708.194) [-703.893] -- 0:00:52
439500 -- (-704.270) (-705.341) [-700.181] (-710.660) * (-700.746) (-706.189) [-704.136] (-711.441) -- 0:00:52
440000 -- (-709.996) (-702.188) (-703.764) [-703.797] * (-705.421) (-707.235) (-707.266) [-708.144] -- 0:00:52
Average standard deviation of split frequencies: 0.017116
440500 -- (-708.567) [-705.603] (-708.435) (-703.637) * (-704.449) (-704.725) [-704.409] (-710.853) -- 0:00:52
441000 -- (-702.180) [-703.032] (-705.057) (-711.055) * (-704.185) (-706.847) (-706.974) [-711.150] -- 0:00:51
441500 -- (-703.342) [-706.669] (-705.814) (-710.119) * [-704.785] (-704.735) (-711.644) (-711.397) -- 0:00:51
442000 -- (-704.041) (-707.025) (-707.610) [-703.759] * (-705.016) [-706.279] (-710.917) (-709.688) -- 0:00:51
442500 -- (-703.489) (-711.694) (-706.456) [-705.062] * (-717.181) [-710.503] (-706.458) (-702.664) -- 0:00:52
443000 -- [-703.705] (-701.805) (-702.268) (-705.965) * (-707.643) (-706.835) (-707.292) [-704.060] -- 0:00:52
443500 -- (-709.057) (-707.537) (-703.046) [-705.468] * (-711.015) (-706.583) [-707.345] (-700.228) -- 0:00:52
444000 -- (-712.542) (-706.879) [-703.048] (-702.641) * [-706.504] (-711.605) (-706.186) (-704.253) -- 0:00:52
444500 -- (-708.198) (-709.124) [-706.013] (-707.451) * (-701.991) (-703.570) (-706.001) [-704.266] -- 0:00:52
445000 -- [-703.216] (-708.828) (-703.013) (-707.041) * (-712.002) (-701.619) [-705.233] (-715.915) -- 0:00:52
Average standard deviation of split frequencies: 0.017616
445500 -- [-706.032] (-709.844) (-701.476) (-701.533) * (-706.329) (-704.848) (-706.041) [-707.358] -- 0:00:52
446000 -- (-707.718) (-704.186) [-703.191] (-707.450) * (-712.506) [-709.230] (-709.266) (-702.024) -- 0:00:52
446500 -- [-703.417] (-704.494) (-702.344) (-711.705) * [-705.442] (-707.379) (-711.128) (-704.067) -- 0:00:52
447000 -- (-708.713) (-707.947) (-705.508) [-704.659] * [-703.698] (-714.554) (-706.527) (-705.245) -- 0:00:51
447500 -- (-702.883) [-706.757] (-701.443) (-707.678) * (-702.704) (-718.560) (-707.181) [-703.622] -- 0:00:51
448000 -- (-705.841) [-700.890] (-703.871) (-707.804) * (-704.239) [-712.054] (-710.968) (-710.919) -- 0:00:51
448500 -- (-702.630) (-707.490) [-704.367] (-704.017) * (-701.164) (-706.107) [-703.927] (-712.742) -- 0:00:51
449000 -- [-704.690] (-706.709) (-715.549) (-704.004) * (-709.485) [-703.478] (-705.225) (-707.604) -- 0:00:51
449500 -- (-705.466) (-703.594) [-703.931] (-706.872) * (-710.417) [-704.135] (-706.358) (-701.331) -- 0:00:51
450000 -- (-711.078) [-702.314] (-711.262) (-705.538) * (-706.328) (-703.604) [-705.956] (-703.270) -- 0:00:51
Average standard deviation of split frequencies: 0.018828
450500 -- (-704.323) (-710.854) [-701.679] (-702.111) * (-702.941) (-705.053) (-706.198) [-703.728] -- 0:00:51
451000 -- (-704.608) (-706.200) [-703.589] (-706.688) * (-705.918) [-706.551] (-707.005) (-708.978) -- 0:00:51
451500 -- (-708.867) (-704.257) (-708.688) [-706.884] * (-702.562) (-707.683) (-704.574) [-706.349] -- 0:00:51
452000 -- (-705.557) (-702.533) [-708.375] (-707.708) * (-700.847) (-706.784) [-705.530] (-710.438) -- 0:00:50
452500 -- (-706.483) [-704.413] (-707.929) (-708.954) * (-703.892) [-704.139] (-705.262) (-708.192) -- 0:00:52
453000 -- (-707.439) (-705.499) [-706.828] (-703.378) * (-704.895) (-710.088) (-704.135) [-712.045] -- 0:00:51
453500 -- (-704.586) [-704.274] (-704.204) (-706.488) * [-708.984] (-712.633) (-706.293) (-703.011) -- 0:00:51
454000 -- [-707.473] (-706.265) (-704.179) (-707.797) * (-703.093) (-703.872) (-707.480) [-709.140] -- 0:00:51
454500 -- (-707.778) [-703.149] (-705.489) (-704.396) * (-704.425) (-703.996) (-702.623) [-704.921] -- 0:00:51
455000 -- (-701.147) [-704.957] (-704.730) (-706.763) * [-709.574] (-707.613) (-703.173) (-706.143) -- 0:00:51
Average standard deviation of split frequencies: 0.019297
455500 -- [-714.039] (-707.069) (-705.831) (-708.267) * (-708.203) [-710.284] (-702.914) (-715.179) -- 0:00:51
456000 -- [-703.795] (-706.246) (-703.061) (-706.509) * (-708.985) (-705.557) [-704.985] (-704.884) -- 0:00:51
456500 -- (-704.434) [-704.680] (-712.321) (-702.212) * (-709.711) (-706.352) [-703.463] (-701.910) -- 0:00:51
457000 -- (-706.199) [-711.714] (-704.654) (-705.483) * (-708.141) [-708.865] (-707.750) (-704.943) -- 0:00:51
457500 -- (-706.275) (-707.253) (-707.643) [-702.176] * [-708.670] (-709.427) (-702.082) (-705.891) -- 0:00:50
458000 -- (-708.432) [-705.489] (-704.653) (-709.300) * (-709.321) (-704.285) (-706.232) [-707.114] -- 0:00:50
458500 -- [-704.856] (-703.871) (-703.485) (-709.062) * [-702.477] (-707.544) (-708.123) (-704.846) -- 0:00:50
459000 -- (-702.646) (-706.036) (-707.187) [-710.274] * (-711.001) [-708.749] (-707.317) (-704.486) -- 0:00:50
459500 -- (-704.859) [-712.497] (-708.981) (-704.363) * [-706.284] (-702.574) (-701.321) (-706.634) -- 0:00:50
460000 -- (-709.982) [-702.919] (-708.202) (-709.793) * (-710.085) (-706.477) [-703.314] (-703.393) -- 0:00:50
Average standard deviation of split frequencies: 0.021148
460500 -- (-703.409) (-710.400) (-702.670) [-702.601] * (-701.469) [-708.785] (-708.118) (-718.254) -- 0:00:50
461000 -- [-705.111] (-708.956) (-701.556) (-707.286) * [-709.612] (-705.556) (-705.898) (-709.039) -- 0:00:50
461500 -- (-701.349) (-704.749) (-706.123) [-703.160] * (-711.096) [-702.751] (-704.683) (-702.738) -- 0:00:50
462000 -- (-702.292) [-699.568] (-711.187) (-705.057) * (-706.181) (-702.836) [-707.980] (-702.417) -- 0:00:51
462500 -- [-704.132] (-702.295) (-703.284) (-702.521) * (-704.741) (-708.366) [-703.964] (-709.083) -- 0:00:51
463000 -- [-701.815] (-707.259) (-709.971) (-709.093) * (-707.836) (-705.292) [-703.104] (-704.643) -- 0:00:51
463500 -- (-705.044) (-704.833) (-703.529) [-712.110] * (-704.281) [-707.118] (-706.075) (-707.474) -- 0:00:50
464000 -- [-702.511] (-704.502) (-708.199) (-707.564) * [-703.242] (-708.961) (-704.403) (-701.637) -- 0:00:50
464500 -- [-701.863] (-707.360) (-704.928) (-708.995) * (-705.088) (-707.209) (-705.602) [-702.624] -- 0:00:50
465000 -- [-703.691] (-702.958) (-709.182) (-704.904) * (-705.451) [-702.815] (-707.146) (-705.284) -- 0:00:50
Average standard deviation of split frequencies: 0.022930
465500 -- (-709.075) (-705.990) (-703.711) [-705.419] * (-709.149) [-704.791] (-705.742) (-711.139) -- 0:00:50
466000 -- (-700.693) [-705.653] (-702.235) (-705.129) * (-705.385) (-701.535) [-703.896] (-706.837) -- 0:00:50
466500 -- [-701.775] (-704.004) (-703.198) (-705.125) * [-710.246] (-701.404) (-707.398) (-700.740) -- 0:00:50
467000 -- (-706.748) [-701.580] (-703.990) (-707.898) * (-705.259) (-705.156) [-704.791] (-711.104) -- 0:00:50
467500 -- (-709.883) [-709.570] (-703.776) (-709.992) * (-703.041) [-703.751] (-710.403) (-708.102) -- 0:00:50
468000 -- (-707.104) (-704.716) [-704.539] (-710.008) * (-710.878) (-702.900) (-706.992) [-704.732] -- 0:00:50
468500 -- (-706.730) (-707.933) (-703.001) [-707.700] * [-701.351] (-704.737) (-713.287) (-706.452) -- 0:00:49
469000 -- (-701.404) (-700.356) [-703.115] (-705.481) * (-709.783) (-705.592) [-714.713] (-711.735) -- 0:00:49
469500 -- (-708.577) [-702.639] (-702.008) (-706.450) * (-700.759) [-704.576] (-711.583) (-704.208) -- 0:00:49
470000 -- (-704.380) (-703.542) [-706.216] (-705.876) * [-703.747] (-702.082) (-708.038) (-706.011) -- 0:00:49
Average standard deviation of split frequencies: 0.020699
470500 -- [-708.433] (-702.302) (-703.413) (-703.929) * (-701.016) (-709.943) [-706.913] (-706.510) -- 0:00:49
471000 -- (-706.728) [-703.965] (-716.248) (-706.500) * (-706.421) (-703.993) (-705.993) [-705.436] -- 0:00:49
471500 -- (-705.346) (-703.750) (-701.920) [-703.951] * (-703.990) (-711.678) (-713.449) [-704.795] -- 0:00:49
472000 -- (-706.038) (-704.210) [-707.012] (-703.458) * [-703.211] (-707.311) (-708.052) (-704.082) -- 0:00:50
472500 -- (-709.498) [-705.893] (-703.872) (-709.173) * (-705.085) [-706.715] (-711.285) (-707.735) -- 0:00:50
473000 -- (-702.913) (-700.451) [-702.626] (-713.820) * (-708.879) [-705.865] (-714.482) (-703.530) -- 0:00:50
473500 -- (-709.109) (-702.634) (-710.976) [-710.114] * (-705.160) [-704.158] (-713.491) (-708.874) -- 0:00:50
474000 -- (-703.419) [-706.461] (-707.533) (-707.707) * (-701.830) (-705.062) (-710.474) [-709.662] -- 0:00:49
474500 -- [-704.808] (-700.085) (-707.638) (-712.491) * [-700.209] (-706.797) (-705.335) (-710.174) -- 0:00:49
475000 -- (-704.635) (-704.578) [-702.481] (-707.707) * (-708.428) (-705.555) [-707.555] (-713.021) -- 0:00:49
Average standard deviation of split frequencies: 0.020467
475500 -- [-705.702] (-709.484) (-709.476) (-705.431) * (-704.586) (-708.535) (-703.738) [-705.922] -- 0:00:49
476000 -- (-701.973) [-705.650] (-712.443) (-706.868) * (-705.507) (-708.618) [-710.220] (-707.749) -- 0:00:49
476500 -- (-703.158) [-703.415] (-706.278) (-708.308) * [-705.884] (-709.566) (-702.700) (-707.094) -- 0:00:49
477000 -- (-708.269) [-706.920] (-704.687) (-712.582) * [-707.068] (-705.289) (-700.765) (-708.710) -- 0:00:49
477500 -- (-710.197) [-713.814] (-714.093) (-709.110) * (-705.976) (-707.483) [-701.432] (-705.945) -- 0:00:49
478000 -- (-704.189) (-713.358) (-707.618) [-707.983] * (-705.689) [-704.797] (-705.258) (-704.566) -- 0:00:49
478500 -- (-705.363) [-704.145] (-715.923) (-713.062) * [-706.139] (-713.434) (-703.949) (-702.786) -- 0:00:49
479000 -- (-701.100) (-704.690) [-704.543] (-705.907) * (-707.344) (-702.284) (-702.899) [-704.913] -- 0:00:48
479500 -- [-705.740] (-705.389) (-706.715) (-709.204) * (-707.061) (-707.158) [-704.520] (-702.066) -- 0:00:48
480000 -- (-709.960) (-707.904) [-704.286] (-703.160) * (-702.181) [-707.269] (-710.423) (-707.446) -- 0:00:48
Average standard deviation of split frequencies: 0.020268
480500 -- [-704.500] (-710.205) (-706.252) (-706.243) * [-705.013] (-709.688) (-704.005) (-700.879) -- 0:00:48
481000 -- (-711.269) (-704.222) [-705.183] (-708.495) * (-703.642) (-701.839) (-711.032) [-701.215] -- 0:00:48
481500 -- (-705.015) [-708.035] (-708.389) (-709.796) * [-710.300] (-706.280) (-711.421) (-706.096) -- 0:00:48
482000 -- (-720.927) [-713.897] (-708.057) (-706.040) * (-709.855) (-706.170) [-707.469] (-703.959) -- 0:00:49
482500 -- (-708.880) (-713.618) (-711.041) [-710.686] * (-710.434) [-703.499] (-706.572) (-710.505) -- 0:00:49
483000 -- (-704.127) [-710.011] (-702.475) (-707.703) * (-711.222) (-707.694) [-702.944] (-711.036) -- 0:00:49
483500 -- (-705.981) (-699.986) (-706.964) [-708.316] * (-706.468) (-709.170) [-701.462] (-704.401) -- 0:00:49
484000 -- [-705.609] (-705.923) (-710.155) (-708.752) * (-709.036) (-705.269) [-706.632] (-703.553) -- 0:00:49
484500 -- (-709.719) (-708.738) [-707.378] (-714.374) * [-703.290] (-705.655) (-705.698) (-707.730) -- 0:00:48
485000 -- (-710.523) [-708.183] (-708.291) (-707.358) * (-702.185) (-706.079) [-707.671] (-699.996) -- 0:00:48
Average standard deviation of split frequencies: 0.019399
485500 -- [-708.155] (-710.153) (-708.065) (-710.178) * (-701.807) (-707.968) (-699.614) [-707.837] -- 0:00:48
486000 -- (-704.395) (-712.888) (-709.029) [-709.590] * (-706.947) (-709.205) (-705.012) [-700.896] -- 0:00:48
486500 -- (-706.317) (-708.712) [-704.333] (-710.020) * (-704.077) [-702.992] (-705.588) (-703.960) -- 0:00:48
487000 -- (-703.614) (-711.038) (-705.325) [-707.240] * (-702.964) [-708.136] (-708.795) (-707.476) -- 0:00:48
487500 -- (-705.680) (-705.771) (-715.936) [-703.089] * (-713.254) [-708.029] (-701.585) (-707.523) -- 0:00:48
488000 -- (-702.915) (-703.482) [-711.736] (-707.265) * (-716.828) (-706.491) [-702.907] (-703.222) -- 0:00:48
488500 -- (-704.543) [-701.342] (-705.899) (-702.464) * (-708.502) (-706.777) (-708.202) [-704.606] -- 0:00:48
489000 -- (-701.827) (-702.369) [-703.002] (-707.538) * (-708.128) [-709.276] (-705.092) (-704.782) -- 0:00:48
489500 -- (-704.037) [-710.192] (-708.797) (-702.916) * [-700.953] (-702.330) (-705.716) (-714.908) -- 0:00:47
490000 -- (-709.222) [-708.200] (-710.899) (-704.788) * [-704.278] (-709.164) (-704.677) (-703.526) -- 0:00:47
Average standard deviation of split frequencies: 0.019855
490500 -- (-706.320) (-711.856) (-711.629) [-707.987] * (-710.548) (-705.134) (-703.768) [-703.929] -- 0:00:47
491000 -- (-710.079) [-708.244] (-710.430) (-712.936) * (-704.446) (-712.568) [-711.903] (-710.331) -- 0:00:47
491500 -- (-705.888) (-703.133) [-701.546] (-703.219) * (-709.945) (-706.267) (-705.196) [-706.981] -- 0:00:47
492000 -- (-704.984) (-704.389) (-704.562) [-704.593] * (-704.227) (-705.088) [-706.417] (-701.849) -- 0:00:48
492500 -- (-709.079) (-705.118) (-714.857) [-705.232] * [-703.678] (-704.248) (-707.318) (-707.737) -- 0:00:48
493000 -- (-706.741) [-708.640] (-709.340) (-703.612) * (-704.004) [-703.066] (-705.473) (-704.406) -- 0:00:48
493500 -- (-709.335) (-704.476) (-708.676) [-703.709] * (-716.251) [-704.338] (-710.174) (-705.336) -- 0:00:48
494000 -- (-711.267) (-700.904) [-709.610] (-704.884) * (-701.017) (-707.240) [-706.194] (-705.523) -- 0:00:48
494500 -- (-704.524) (-707.760) (-704.598) [-704.700] * (-706.621) [-702.914] (-704.042) (-711.472) -- 0:00:48
495000 -- (-717.072) [-704.894] (-706.396) (-705.247) * (-710.210) (-709.066) (-708.017) [-706.967] -- 0:00:47
Average standard deviation of split frequencies: 0.018375
495500 -- [-706.893] (-705.737) (-707.989) (-702.507) * [-701.529] (-703.611) (-711.337) (-707.114) -- 0:00:47
496000 -- [-702.981] (-704.473) (-714.012) (-701.525) * (-705.274) (-706.674) [-707.792] (-705.593) -- 0:00:47
496500 -- (-706.217) (-705.771) (-705.283) [-700.422] * (-704.113) [-706.628] (-703.268) (-704.091) -- 0:00:47
497000 -- (-707.855) (-704.009) (-708.872) [-704.985] * (-711.765) (-708.878) [-712.720] (-708.630) -- 0:00:47
497500 -- (-713.659) (-712.322) (-708.920) [-707.182] * (-707.909) (-704.339) (-708.181) [-701.707] -- 0:00:47
498000 -- [-704.161] (-709.121) (-706.956) (-707.077) * (-706.590) (-707.674) (-704.995) [-704.305] -- 0:00:47
498500 -- (-710.059) (-709.145) [-701.317] (-708.463) * [-702.436] (-709.172) (-703.172) (-706.843) -- 0:00:47
499000 -- (-711.701) (-710.168) [-703.162] (-707.455) * [-703.989] (-705.553) (-699.317) (-702.549) -- 0:00:47
499500 -- (-708.031) (-708.413) (-703.121) [-702.486] * [-703.612] (-707.537) (-700.829) (-704.179) -- 0:00:47
500000 -- [-704.563] (-705.455) (-704.702) (-709.431) * (-704.755) [-704.733] (-704.320) (-701.915) -- 0:00:47
Average standard deviation of split frequencies: 0.020086
500500 -- (-706.331) [-707.134] (-706.575) (-708.850) * (-705.062) (-709.674) [-702.650] (-704.298) -- 0:00:46
501000 -- [-708.750] (-706.737) (-707.429) (-705.334) * (-702.254) (-707.777) (-710.134) [-703.587] -- 0:00:46
501500 -- [-706.091] (-703.787) (-706.326) (-704.082) * (-709.873) [-707.915] (-713.520) (-704.192) -- 0:00:46
502000 -- (-706.956) [-705.204] (-707.727) (-706.498) * (-703.946) (-702.758) (-707.850) [-706.058] -- 0:00:46
502500 -- [-709.363] (-708.908) (-704.181) (-706.172) * [-705.682] (-711.370) (-708.242) (-703.140) -- 0:00:47
503000 -- (-710.095) (-709.801) (-708.893) [-699.746] * [-701.294] (-704.988) (-701.005) (-703.456) -- 0:00:47
503500 -- (-708.112) (-713.511) [-703.419] (-704.829) * (-710.704) (-704.479) [-706.577] (-702.957) -- 0:00:47
504000 -- (-710.748) (-707.682) (-703.078) [-701.964] * (-706.843) (-704.570) [-703.992] (-714.067) -- 0:00:47
504500 -- (-711.229) (-708.123) [-703.417] (-704.193) * (-709.664) (-706.797) (-705.835) [-707.386] -- 0:00:47
505000 -- (-702.880) (-703.976) (-706.025) [-703.101] * (-708.970) (-708.814) [-704.226] (-715.316) -- 0:00:47
Average standard deviation of split frequencies: 0.020496
505500 -- [-710.257] (-710.816) (-707.750) (-708.971) * (-705.366) (-700.636) (-701.440) [-711.051] -- 0:00:46
506000 -- (-706.949) [-700.402] (-703.441) (-701.836) * (-704.912) [-704.454] (-707.405) (-706.312) -- 0:00:46
506500 -- [-706.297] (-704.132) (-704.921) (-702.962) * (-707.838) (-703.555) [-702.624] (-702.458) -- 0:00:46
507000 -- (-705.809) (-701.146) [-706.003] (-704.883) * (-707.796) [-701.395] (-711.931) (-712.802) -- 0:00:46
507500 -- (-704.878) [-702.853] (-709.860) (-704.080) * (-702.520) [-705.349] (-700.470) (-709.441) -- 0:00:46
508000 -- (-707.259) (-704.165) (-706.580) [-701.968] * (-706.768) [-706.419] (-709.362) (-707.660) -- 0:00:46
508500 -- [-708.772] (-705.363) (-704.330) (-705.262) * (-710.397) (-700.224) [-706.022] (-710.170) -- 0:00:46
509000 -- (-704.578) [-703.982] (-703.182) (-708.002) * [-702.820] (-710.590) (-702.007) (-704.958) -- 0:00:46
509500 -- (-702.024) (-721.573) [-704.746] (-705.588) * (-706.334) [-704.657] (-698.489) (-708.240) -- 0:00:46
510000 -- (-704.868) (-703.305) (-715.870) [-702.634] * [-704.764] (-709.227) (-702.861) (-704.757) -- 0:00:46
Average standard deviation of split frequencies: 0.023386
510500 -- (-709.574) [-709.593] (-710.746) (-708.172) * [-706.756] (-705.377) (-708.404) (-711.635) -- 0:00:46
511000 -- [-705.137] (-705.756) (-708.067) (-702.617) * (-702.914) (-701.817) [-703.959] (-706.174) -- 0:00:45
511500 -- (-711.000) (-711.461) (-708.561) [-702.106] * [-708.464] (-703.723) (-703.196) (-707.494) -- 0:00:45
512000 -- (-708.017) (-706.211) [-703.467] (-702.357) * [-706.440] (-711.500) (-699.755) (-703.421) -- 0:00:45
512500 -- [-710.224] (-711.206) (-715.325) (-702.586) * (-717.018) (-705.604) (-701.843) [-705.163] -- 0:00:45
513000 -- (-702.292) (-705.044) [-708.983] (-708.532) * (-706.780) (-708.076) [-701.529] (-700.192) -- 0:00:46
513500 -- (-710.075) [-704.322] (-710.933) (-716.641) * (-708.389) (-711.632) (-705.841) [-700.753] -- 0:00:46
514000 -- (-708.155) (-703.467) (-708.177) [-705.096] * (-700.776) (-704.132) (-714.315) [-702.935] -- 0:00:46
514500 -- (-714.025) (-703.797) [-704.204] (-703.745) * [-707.240] (-704.572) (-710.472) (-704.964) -- 0:00:46
515000 -- (-712.121) [-711.470] (-702.381) (-705.183) * (-703.464) (-712.045) (-705.769) [-700.236] -- 0:00:46
Average standard deviation of split frequencies: 0.023144
515500 -- [-703.607] (-704.648) (-708.959) (-708.809) * (-707.574) (-707.196) [-707.973] (-701.946) -- 0:00:46
516000 -- (-704.498) (-704.977) (-710.198) [-705.633] * (-705.323) (-710.126) [-704.159] (-705.653) -- 0:00:45
516500 -- [-703.672] (-704.757) (-705.041) (-706.834) * (-708.111) (-706.759) [-702.132] (-705.983) -- 0:00:45
517000 -- [-705.795] (-711.768) (-705.522) (-708.329) * (-709.840) (-704.930) (-707.399) [-703.289] -- 0:00:45
517500 -- (-705.955) (-706.811) [-704.783] (-709.108) * (-702.905) (-704.992) (-711.686) [-700.192] -- 0:00:45
518000 -- (-705.205) (-704.161) [-704.018] (-713.627) * (-699.903) (-707.803) (-712.570) [-702.833] -- 0:00:45
518500 -- (-700.235) (-706.408) [-702.317] (-708.442) * [-700.879] (-711.096) (-706.597) (-702.820) -- 0:00:45
519000 -- (-703.290) (-701.962) [-706.176] (-716.933) * [-701.603] (-711.028) (-704.142) (-702.230) -- 0:00:45
519500 -- (-704.329) (-707.461) [-706.728] (-711.954) * (-708.180) (-713.129) [-704.005] (-710.439) -- 0:00:45
520000 -- (-708.466) [-703.144] (-700.280) (-708.134) * (-700.928) (-711.984) [-705.445] (-705.574) -- 0:00:45
Average standard deviation of split frequencies: 0.021126
520500 -- (-703.045) [-706.353] (-705.511) (-705.821) * (-709.355) [-705.605] (-704.932) (-701.666) -- 0:00:45
521000 -- [-702.566] (-703.796) (-706.748) (-701.657) * (-713.713) (-706.908) (-706.562) [-705.611] -- 0:00:45
521500 -- (-704.770) (-707.566) [-700.596] (-706.022) * (-703.288) (-707.758) [-705.616] (-701.629) -- 0:00:44
522000 -- (-707.955) [-703.261] (-704.564) (-708.274) * (-704.498) (-700.367) [-707.902] (-701.663) -- 0:00:44
522500 -- (-705.395) (-706.107) [-703.611] (-703.349) * [-706.565] (-710.088) (-707.792) (-703.937) -- 0:00:44
523000 -- (-710.980) (-706.938) [-702.391] (-709.615) * [-703.134] (-703.060) (-714.802) (-710.312) -- 0:00:44
523500 -- (-707.558) (-704.236) [-702.525] (-710.624) * [-706.542] (-705.220) (-705.194) (-708.569) -- 0:00:45
524000 -- (-707.533) (-706.728) (-704.524) [-712.904] * (-704.982) (-704.455) (-712.515) [-700.910] -- 0:00:45
524500 -- (-707.572) [-710.523] (-705.410) (-706.446) * (-705.129) [-701.599] (-712.638) (-701.599) -- 0:00:45
525000 -- (-707.297) [-705.379] (-711.051) (-707.814) * [-702.220] (-704.491) (-721.390) (-703.592) -- 0:00:45
Average standard deviation of split frequencies: 0.022704
525500 -- (-704.207) [-705.952] (-707.237) (-707.028) * (-703.075) (-705.821) (-701.931) [-709.332] -- 0:00:45
526000 -- (-701.123) (-702.675) (-708.408) [-703.013] * (-706.174) (-704.998) (-702.872) [-705.605] -- 0:00:45
526500 -- (-710.286) (-701.305) (-707.695) [-704.396] * (-707.381) [-707.157] (-705.781) (-704.981) -- 0:00:44
527000 -- [-704.146] (-706.137) (-704.977) (-706.777) * (-704.994) [-709.917] (-708.421) (-704.738) -- 0:00:44
527500 -- [-709.496] (-710.487) (-704.332) (-701.112) * (-713.704) [-701.198] (-707.230) (-700.990) -- 0:00:44
528000 -- (-708.499) [-707.924] (-703.061) (-707.533) * (-702.935) (-705.893) [-703.063] (-704.112) -- 0:00:44
528500 -- [-704.634] (-709.533) (-701.427) (-705.061) * (-704.798) (-708.424) (-703.794) [-705.175] -- 0:00:44
529000 -- (-712.830) (-707.545) (-702.146) [-699.805] * [-706.792] (-703.072) (-702.153) (-705.020) -- 0:00:44
529500 -- (-706.722) (-709.239) (-706.366) [-702.655] * (-704.263) (-706.552) [-707.704] (-705.416) -- 0:00:44
530000 -- (-705.799) [-713.535] (-706.060) (-711.657) * (-707.999) (-704.339) [-705.342] (-704.863) -- 0:00:44
Average standard deviation of split frequencies: 0.023689
530500 -- (-706.369) (-710.906) (-703.408) [-703.049] * (-702.181) [-706.017] (-706.137) (-704.898) -- 0:00:44
531000 -- (-715.772) (-702.431) (-704.146) [-712.427] * (-709.503) (-705.975) [-699.887] (-708.506) -- 0:00:44
531500 -- (-706.706) (-704.679) (-709.304) [-704.080] * (-704.910) [-703.387] (-703.196) (-703.762) -- 0:00:44
532000 -- (-713.302) (-700.780) (-712.789) [-705.540] * (-702.062) (-706.718) (-703.967) [-704.193] -- 0:00:43
532500 -- (-710.626) (-702.616) [-701.339] (-706.760) * [-702.454] (-709.929) (-707.477) (-703.747) -- 0:00:43
533000 -- (-703.073) (-699.507) [-701.376] (-707.996) * (-700.062) [-714.496] (-703.924) (-704.754) -- 0:00:43
533500 -- [-704.366] (-710.147) (-702.051) (-704.711) * [-705.719] (-702.873) (-704.705) (-701.612) -- 0:00:43
534000 -- (-703.926) (-716.466) (-705.787) [-703.189] * [-704.359] (-704.373) (-703.159) (-711.640) -- 0:00:43
534500 -- (-705.368) (-706.389) [-702.235] (-703.275) * (-705.301) (-703.840) (-705.203) [-707.522] -- 0:00:44
535000 -- [-701.834] (-704.527) (-706.659) (-704.935) * (-706.765) (-707.394) (-705.280) [-711.607] -- 0:00:44
Average standard deviation of split frequencies: 0.024626
535500 -- (-706.210) (-712.228) (-708.192) [-705.147] * (-704.334) (-704.121) (-707.409) [-708.661] -- 0:00:44
536000 -- (-702.324) (-706.454) [-705.929] (-704.088) * (-702.859) (-703.065) (-704.836) [-709.830] -- 0:00:44
536500 -- (-705.744) [-708.598] (-708.064) (-702.955) * (-705.464) [-703.293] (-706.476) (-707.411) -- 0:00:44
537000 -- (-710.135) (-706.404) [-708.504] (-701.901) * (-703.412) (-704.383) (-706.682) [-700.768] -- 0:00:43
537500 -- [-701.728] (-704.647) (-705.587) (-703.938) * (-703.692) (-715.198) [-702.014] (-706.486) -- 0:00:43
538000 -- (-705.954) (-706.504) [-706.326] (-712.951) * (-709.274) (-711.696) [-703.184] (-703.388) -- 0:00:43
538500 -- (-705.393) (-714.986) (-707.121) [-705.349] * (-704.963) (-707.883) (-702.618) [-706.166] -- 0:00:43
539000 -- (-706.668) (-706.017) [-712.657] (-699.804) * (-716.959) (-710.743) (-702.160) [-704.521] -- 0:00:43
539500 -- (-703.148) (-704.484) (-707.241) [-704.742] * [-710.196] (-703.360) (-703.260) (-706.097) -- 0:00:43
540000 -- (-703.087) (-704.625) (-705.781) [-704.304] * [-708.805] (-710.002) (-708.558) (-703.475) -- 0:00:43
Average standard deviation of split frequencies: 0.024994
540500 -- (-706.697) (-703.792) (-702.040) [-703.190] * (-713.591) (-704.679) (-703.821) [-707.381] -- 0:00:43
541000 -- [-700.902] (-704.113) (-707.263) (-700.534) * (-703.730) (-707.102) (-701.009) [-703.454] -- 0:00:43
541500 -- (-701.626) (-705.083) [-704.431] (-703.781) * (-706.240) [-704.092] (-703.574) (-708.119) -- 0:00:43
542000 -- (-706.976) (-703.449) [-704.405] (-704.624) * (-707.358) (-704.988) [-703.528] (-714.298) -- 0:00:43
542500 -- (-702.276) [-705.021] (-705.928) (-708.618) * (-706.149) [-709.549] (-716.964) (-709.662) -- 0:00:43
543000 -- (-713.792) (-712.079) (-705.989) [-704.338] * (-704.130) (-704.432) (-703.834) [-704.539] -- 0:00:42
543500 -- (-707.030) [-706.761] (-703.277) (-709.128) * (-703.424) (-708.548) [-704.216] (-708.632) -- 0:00:42
544000 -- [-708.856] (-706.197) (-700.922) (-714.161) * [-704.978] (-710.669) (-703.380) (-701.281) -- 0:00:42
544500 -- (-715.921) (-711.348) [-707.819] (-701.570) * (-706.811) (-704.132) (-703.680) [-702.770] -- 0:00:42
545000 -- (-708.784) (-707.019) (-710.327) [-704.534] * (-706.640) (-708.593) [-704.358] (-708.492) -- 0:00:42
Average standard deviation of split frequencies: 0.024750
545500 -- (-709.129) (-708.094) (-709.115) [-706.161] * [-712.458] (-707.200) (-702.810) (-712.869) -- 0:00:43
546000 -- (-708.177) [-704.244] (-715.136) (-705.985) * [-707.608] (-704.999) (-704.210) (-704.681) -- 0:00:43
546500 -- [-708.992] (-707.141) (-707.272) (-702.826) * (-702.891) [-702.219] (-709.408) (-706.770) -- 0:00:43
547000 -- [-706.279] (-708.371) (-705.123) (-707.791) * (-703.933) (-702.464) (-702.583) [-713.050] -- 0:00:43
547500 -- [-705.800] (-704.068) (-705.206) (-701.338) * (-711.555) (-715.605) [-700.305] (-702.597) -- 0:00:42
548000 -- [-704.856] (-704.915) (-707.988) (-711.093) * [-703.921] (-709.403) (-703.453) (-702.450) -- 0:00:42
548500 -- (-708.267) [-708.534] (-701.654) (-707.953) * [-701.203] (-712.305) (-707.208) (-705.157) -- 0:00:42
549000 -- (-703.586) (-708.569) [-704.047] (-702.545) * [-700.770] (-709.922) (-706.478) (-705.845) -- 0:00:42
549500 -- [-702.544] (-709.699) (-704.839) (-705.384) * (-706.773) [-706.100] (-708.526) (-712.375) -- 0:00:42
550000 -- (-702.826) (-707.912) [-705.558] (-705.807) * [-704.866] (-703.416) (-707.085) (-707.146) -- 0:00:42
Average standard deviation of split frequencies: 0.023970
550500 -- [-705.481] (-708.814) (-711.656) (-710.549) * (-710.633) (-702.791) [-702.029] (-705.431) -- 0:00:42
551000 -- [-705.117] (-704.387) (-706.262) (-710.615) * (-702.238) (-705.690) (-708.349) [-706.556] -- 0:00:42
551500 -- (-708.530) [-706.247] (-705.895) (-707.225) * [-702.737] (-704.923) (-704.309) (-705.912) -- 0:00:42
552000 -- (-718.072) (-703.154) (-708.827) [-703.907] * [-706.095] (-709.333) (-706.641) (-706.519) -- 0:00:42
552500 -- (-714.598) (-703.166) [-704.881] (-704.641) * (-702.705) (-711.915) (-709.024) [-711.622] -- 0:00:42
553000 -- (-713.537) (-710.561) [-703.559] (-703.379) * [-705.215] (-701.802) (-707.046) (-708.848) -- 0:00:42
553500 -- (-711.705) [-702.617] (-709.101) (-704.022) * (-710.809) (-704.284) (-706.612) [-702.255] -- 0:00:41
554000 -- (-708.395) [-707.876] (-705.469) (-707.901) * [-703.536] (-707.665) (-707.404) (-705.251) -- 0:00:41
554500 -- [-702.210] (-703.063) (-708.311) (-701.966) * [-706.857] (-704.082) (-707.467) (-703.727) -- 0:00:41
555000 -- [-701.809] (-706.013) (-704.935) (-712.237) * (-706.537) [-703.407] (-711.272) (-709.232) -- 0:00:42
Average standard deviation of split frequencies: 0.024870
555500 -- (-704.701) (-701.230) [-707.240] (-712.942) * (-706.455) [-704.066] (-706.439) (-709.762) -- 0:00:42
556000 -- (-705.402) (-711.752) [-704.830] (-709.299) * (-703.001) (-702.638) (-707.519) [-707.453] -- 0:00:42
556500 -- [-704.178] (-706.883) (-703.927) (-711.745) * [-712.167] (-706.142) (-709.393) (-705.519) -- 0:00:42
557000 -- (-712.240) (-707.068) (-701.259) [-704.786] * (-705.763) [-707.695] (-709.310) (-703.753) -- 0:00:42
557500 -- (-707.236) (-708.406) (-708.696) [-705.500] * (-708.068) (-706.291) [-703.934] (-709.127) -- 0:00:42
558000 -- [-703.849] (-713.357) (-706.980) (-706.978) * [-711.252] (-713.700) (-705.006) (-708.023) -- 0:00:41
558500 -- (-704.336) (-709.604) [-702.058] (-709.404) * [-709.982] (-706.920) (-709.498) (-707.587) -- 0:00:41
559000 -- (-705.591) (-711.284) [-702.499] (-714.456) * [-703.269] (-711.193) (-702.484) (-703.970) -- 0:00:41
559500 -- (-712.072) (-706.492) [-706.249] (-710.814) * (-705.964) [-708.386] (-707.829) (-705.077) -- 0:00:41
560000 -- [-707.408] (-715.205) (-711.850) (-712.260) * (-707.410) [-704.237] (-708.518) (-704.089) -- 0:00:41
Average standard deviation of split frequencies: 0.025784
560500 -- (-704.299) [-710.672] (-713.991) (-718.902) * [-703.272] (-710.297) (-701.869) (-701.604) -- 0:00:41
561000 -- (-705.440) (-714.121) [-706.279] (-718.498) * (-701.166) (-705.489) [-708.692] (-704.428) -- 0:00:41
561500 -- (-704.618) (-708.625) [-703.715] (-706.917) * [-706.604] (-704.222) (-705.125) (-702.849) -- 0:00:41
562000 -- [-702.266] (-713.498) (-703.197) (-705.549) * (-699.045) (-711.917) (-711.884) [-700.963] -- 0:00:41
562500 -- (-711.644) [-709.023] (-711.566) (-708.815) * (-703.186) [-705.242] (-708.585) (-706.206) -- 0:00:41
563000 -- (-706.518) (-705.119) (-702.301) [-714.515] * (-707.801) (-712.303) [-707.782] (-708.007) -- 0:00:41
563500 -- (-710.698) (-711.495) (-713.314) [-703.465] * (-704.795) (-700.858) (-710.570) [-705.653] -- 0:00:41
564000 -- (-711.101) (-706.071) (-704.776) [-705.092] * (-703.966) (-702.067) (-703.150) [-708.168] -- 0:00:40
564500 -- (-705.543) (-711.079) [-703.972] (-705.249) * (-718.672) (-705.283) (-703.224) [-705.529] -- 0:00:40
565000 -- (-705.296) [-706.692] (-702.733) (-712.477) * (-709.397) [-709.555] (-710.496) (-705.656) -- 0:00:40
Average standard deviation of split frequencies: 0.025541
565500 -- [-704.321] (-704.882) (-706.587) (-702.650) * (-713.538) [-705.949] (-714.617) (-706.645) -- 0:00:41
566000 -- (-705.373) (-704.186) (-705.510) [-702.272] * [-704.042] (-705.821) (-709.380) (-709.733) -- 0:00:41
566500 -- (-709.005) (-703.223) [-707.674] (-710.200) * [-704.808] (-705.237) (-705.762) (-710.432) -- 0:00:41
567000 -- (-701.415) (-706.431) (-702.139) [-703.709] * (-703.246) [-703.307] (-704.907) (-711.196) -- 0:00:41
567500 -- (-705.367) [-704.236] (-699.559) (-702.657) * [-708.461] (-702.752) (-703.035) (-707.475) -- 0:00:41
568000 -- (-702.927) (-705.307) (-704.070) [-701.180] * [-705.178] (-701.296) (-704.972) (-708.883) -- 0:00:41
568500 -- (-703.935) (-712.792) [-702.846] (-711.601) * (-703.880) [-701.190] (-708.212) (-712.181) -- 0:00:40
569000 -- (-709.524) (-703.762) [-703.575] (-703.473) * (-706.561) (-703.504) [-702.400] (-712.596) -- 0:00:40
569500 -- (-704.632) [-705.237] (-704.472) (-710.391) * (-699.854) (-704.561) (-704.093) [-707.626] -- 0:00:40
570000 -- (-706.964) (-702.195) (-703.958) [-705.166] * [-703.611] (-714.184) (-706.873) (-705.270) -- 0:00:40
Average standard deviation of split frequencies: 0.024782
570500 -- (-707.506) (-705.137) [-707.169] (-704.937) * (-704.038) [-707.641] (-702.483) (-710.067) -- 0:00:40
571000 -- (-702.646) (-701.641) [-705.815] (-704.686) * (-701.662) (-709.236) [-706.590] (-710.588) -- 0:00:40
571500 -- (-704.108) (-707.518) [-705.062] (-701.059) * (-702.750) (-703.144) [-702.685] (-709.142) -- 0:00:40
572000 -- [-706.054] (-711.463) (-705.492) (-705.901) * [-714.048] (-709.731) (-707.998) (-708.686) -- 0:00:40
572500 -- [-701.158] (-709.694) (-708.310) (-706.263) * (-710.331) (-708.292) (-715.610) [-704.723] -- 0:00:40
573000 -- [-704.507] (-705.214) (-710.632) (-708.802) * (-703.981) [-705.833] (-711.540) (-703.443) -- 0:00:40
573500 -- (-706.925) (-712.302) (-704.757) [-702.389] * (-710.388) [-709.473] (-712.311) (-705.946) -- 0:00:40
574000 -- (-703.795) (-713.558) (-714.144) [-704.306] * [-704.045] (-703.795) (-709.880) (-704.207) -- 0:00:40
574500 -- (-707.086) (-715.105) (-708.676) [-703.340] * (-707.235) (-708.890) (-705.082) [-710.434] -- 0:00:39
575000 -- (-707.051) (-702.674) [-706.148] (-702.824) * (-710.717) (-704.090) [-704.761] (-707.821) -- 0:00:39
Average standard deviation of split frequencies: 0.024007
575500 -- [-704.232] (-705.175) (-714.896) (-707.882) * (-704.039) (-705.258) [-711.307] (-709.845) -- 0:00:39
576000 -- (-701.921) (-704.779) (-705.590) [-704.762] * (-711.201) [-704.787] (-705.940) (-706.560) -- 0:00:39
576500 -- (-707.747) (-705.115) [-705.479] (-705.768) * (-709.151) (-709.712) [-707.305] (-699.772) -- 0:00:40
577000 -- (-703.414) (-706.414) (-702.265) [-706.617] * [-707.779] (-710.282) (-705.328) (-701.474) -- 0:00:40
577500 -- [-704.233] (-704.152) (-707.899) (-705.516) * (-704.941) (-706.220) (-704.479) [-707.633] -- 0:00:40
578000 -- [-705.261] (-711.581) (-714.470) (-709.507) * [-704.089] (-707.321) (-704.255) (-702.319) -- 0:00:40
578500 -- (-707.634) (-700.970) [-705.073] (-704.234) * (-706.594) (-705.453) [-702.945] (-706.366) -- 0:00:40
579000 -- [-707.187] (-703.848) (-713.596) (-702.303) * [-709.298] (-708.862) (-705.754) (-709.838) -- 0:00:39
579500 -- [-705.205] (-710.431) (-709.440) (-701.055) * (-707.351) [-707.830] (-704.700) (-710.583) -- 0:00:39
580000 -- [-707.229] (-706.348) (-711.902) (-705.201) * (-701.289) (-709.766) (-709.817) [-709.635] -- 0:00:39
Average standard deviation of split frequencies: 0.024896
580500 -- (-712.029) [-706.341] (-711.523) (-708.269) * (-707.896) [-704.250] (-707.817) (-705.492) -- 0:00:39
581000 -- (-705.899) (-709.144) (-711.703) [-707.243] * (-708.122) [-706.678] (-704.411) (-709.347) -- 0:00:39
581500 -- (-704.560) (-711.712) (-709.866) [-707.070] * (-709.146) (-704.245) [-710.096] (-706.969) -- 0:00:39
582000 -- (-710.612) (-708.135) [-701.033] (-701.003) * (-704.379) (-710.429) (-714.400) [-702.377] -- 0:00:39
582500 -- [-709.312] (-711.346) (-712.035) (-704.970) * (-709.313) [-705.556] (-707.128) (-712.441) -- 0:00:39
583000 -- (-706.344) (-711.713) [-703.638] (-708.845) * [-704.317] (-708.564) (-710.879) (-706.646) -- 0:00:39
583500 -- (-702.396) (-702.139) [-708.534] (-708.650) * (-706.007) [-705.233] (-712.282) (-704.289) -- 0:00:39
584000 -- (-706.862) [-704.348] (-704.294) (-701.059) * (-706.100) [-709.891] (-714.826) (-703.709) -- 0:00:39
584500 -- [-706.922] (-708.968) (-703.179) (-700.311) * [-710.378] (-703.815) (-717.214) (-706.054) -- 0:00:39
585000 -- (-703.052) (-705.994) [-700.782] (-707.948) * [-704.801] (-703.560) (-706.391) (-707.407) -- 0:00:39
Average standard deviation of split frequencies: 0.024670
585500 -- (-708.011) (-707.633) [-706.494] (-706.499) * (-703.925) (-708.022) (-708.775) [-704.820] -- 0:00:38
586000 -- (-705.341) (-707.847) (-709.418) [-704.549] * (-710.945) (-709.651) [-704.724] (-708.302) -- 0:00:38
586500 -- (-705.027) (-710.877) [-699.975] (-704.989) * (-700.861) [-700.950] (-703.499) (-705.774) -- 0:00:38
587000 -- [-709.967] (-703.226) (-709.296) (-712.311) * [-702.560] (-709.973) (-706.930) (-707.276) -- 0:00:38
587500 -- (-705.145) [-704.879] (-706.175) (-705.208) * [-705.986] (-708.727) (-700.861) (-707.539) -- 0:00:39
588000 -- (-703.855) [-702.843] (-707.944) (-713.023) * (-709.633) (-709.994) [-700.634] (-707.325) -- 0:00:39
588500 -- (-704.732) (-708.904) [-703.230] (-712.755) * (-704.046) (-709.591) (-700.730) [-706.820] -- 0:00:39
589000 -- (-704.122) (-704.616) [-705.876] (-711.772) * (-705.627) (-704.029) [-707.923] (-707.390) -- 0:00:39
589500 -- (-703.641) [-708.226] (-705.794) (-716.599) * [-708.638] (-704.105) (-704.285) (-709.609) -- 0:00:38
590000 -- (-707.097) (-702.332) (-705.202) [-715.098] * (-699.706) (-706.274) [-705.439] (-710.133) -- 0:00:38
Average standard deviation of split frequencies: 0.025007
590500 -- (-708.610) (-705.831) (-708.122) [-716.730] * (-706.647) [-704.001] (-703.046) (-709.323) -- 0:00:38
591000 -- (-704.657) (-704.263) (-702.696) [-704.535] * (-702.195) (-704.079) (-701.437) [-707.078] -- 0:00:38
591500 -- (-709.539) (-704.071) [-704.961] (-707.768) * (-703.633) [-703.437] (-709.584) (-708.738) -- 0:00:38
592000 -- (-707.864) (-704.723) (-708.113) [-706.471] * (-708.536) (-706.183) (-705.498) [-703.738] -- 0:00:38
592500 -- [-702.730] (-712.018) (-712.095) (-707.106) * [-703.534] (-707.756) (-709.817) (-706.547) -- 0:00:38
593000 -- [-703.622] (-712.831) (-705.144) (-707.864) * [-704.873] (-704.517) (-700.723) (-710.469) -- 0:00:38
593500 -- [-704.192] (-706.177) (-710.470) (-709.626) * (-706.334) [-705.362] (-706.184) (-707.630) -- 0:00:38
594000 -- [-712.120] (-703.946) (-701.797) (-702.980) * (-713.738) [-709.255] (-705.827) (-704.570) -- 0:00:38
594500 -- [-709.881] (-706.573) (-705.642) (-702.657) * (-703.310) (-706.574) [-710.261] (-711.701) -- 0:00:38
595000 -- (-710.786) (-708.123) [-706.322] (-705.866) * (-707.114) (-708.186) [-703.252] (-705.205) -- 0:00:38
Average standard deviation of split frequencies: 0.023728
595500 -- [-708.048] (-704.023) (-705.846) (-706.790) * (-710.146) [-703.471] (-706.096) (-711.030) -- 0:00:38
596000 -- (-702.611) [-700.910] (-703.825) (-711.444) * (-702.959) (-705.198) [-701.992] (-708.633) -- 0:00:37
596500 -- [-706.429] (-702.434) (-709.673) (-706.403) * (-705.724) (-708.387) [-701.679] (-711.561) -- 0:00:37
597000 -- [-705.574] (-703.277) (-708.464) (-704.194) * (-707.049) [-702.958] (-706.087) (-709.279) -- 0:00:37
597500 -- (-707.579) (-708.548) (-710.966) [-704.860] * (-706.966) (-706.164) (-713.081) [-709.566] -- 0:00:37
598000 -- (-706.583) [-708.530] (-705.856) (-706.498) * (-703.778) [-705.843] (-705.388) (-705.386) -- 0:00:37
598500 -- (-708.255) (-711.405) [-707.802] (-706.670) * (-700.565) (-704.260) (-705.945) [-702.989] -- 0:00:38
599000 -- (-713.330) (-705.206) [-702.423] (-707.267) * (-710.851) (-706.702) (-708.092) [-700.171] -- 0:00:38
599500 -- (-707.938) (-704.093) [-704.364] (-712.995) * [-702.428] (-705.441) (-701.721) (-704.419) -- 0:00:38
600000 -- (-705.262) (-709.448) (-715.210) [-704.072] * (-706.945) (-704.751) [-703.386] (-704.731) -- 0:00:38
Average standard deviation of split frequencies: 0.021451
600500 -- [-700.454] (-702.448) (-705.753) (-702.978) * (-709.819) [-704.929] (-701.146) (-703.652) -- 0:00:37
601000 -- (-699.978) (-703.557) [-709.054] (-708.863) * (-709.271) (-710.546) (-708.761) [-701.385] -- 0:00:37
601500 -- [-703.856] (-709.303) (-705.682) (-701.466) * (-719.615) (-711.241) [-700.540] (-711.375) -- 0:00:37
602000 -- (-707.429) (-706.172) [-708.187] (-709.317) * (-708.833) (-708.110) [-702.017] (-707.121) -- 0:00:37
602500 -- [-704.468] (-706.269) (-710.178) (-699.681) * (-711.597) (-701.923) [-709.974] (-704.581) -- 0:00:37
603000 -- [-704.932] (-708.335) (-706.722) (-703.650) * (-709.750) (-703.148) [-701.943] (-709.832) -- 0:00:37
603500 -- [-710.395] (-706.620) (-715.684) (-706.445) * [-708.168] (-705.708) (-703.956) (-709.100) -- 0:00:37
604000 -- (-701.644) (-700.530) (-709.240) [-701.812] * [-707.017] (-704.780) (-704.414) (-701.220) -- 0:00:37
604500 -- (-701.251) (-703.534) (-704.062) [-704.939] * (-712.397) (-705.368) [-704.639] (-704.480) -- 0:00:37
605000 -- [-704.989] (-703.902) (-705.185) (-703.382) * (-711.834) [-708.151] (-700.589) (-703.470) -- 0:00:37
Average standard deviation of split frequencies: 0.020744
605500 -- (-703.977) (-711.771) (-709.524) [-708.281] * (-705.731) [-704.096] (-704.111) (-709.269) -- 0:00:37
606000 -- (-705.315) (-703.668) (-704.237) [-701.130] * (-705.741) [-706.378] (-703.791) (-712.910) -- 0:00:37
606500 -- (-706.428) (-702.412) (-700.656) [-707.459] * (-711.188) (-703.685) (-704.760) [-705.253] -- 0:00:36
607000 -- (-705.519) (-708.989) [-699.636] (-706.523) * [-705.280] (-711.226) (-712.618) (-708.254) -- 0:00:36
607500 -- (-707.746) [-711.698] (-705.046) (-705.692) * [-707.751] (-712.086) (-703.836) (-706.624) -- 0:00:36
608000 -- (-706.837) (-704.358) [-707.668] (-705.954) * (-704.735) (-710.462) [-700.240] (-710.147) -- 0:00:36
608500 -- (-701.517) [-704.436] (-705.477) (-703.883) * (-711.411) (-702.775) (-704.936) [-708.304] -- 0:00:36
609000 -- (-708.458) (-705.401) (-706.811) [-704.885] * [-706.563] (-703.127) (-703.388) (-708.850) -- 0:00:37
609500 -- (-711.383) (-705.085) [-705.878] (-708.840) * [-710.401] (-707.427) (-709.829) (-712.950) -- 0:00:37
610000 -- (-708.708) (-703.072) [-706.973] (-702.527) * [-704.021] (-713.096) (-702.910) (-710.482) -- 0:00:37
Average standard deviation of split frequencies: 0.018527
610500 -- [-707.360] (-703.946) (-703.383) (-699.899) * (-706.262) (-705.047) [-702.550] (-713.386) -- 0:00:37
611000 -- (-707.294) (-702.036) (-708.528) [-703.103] * (-706.137) (-705.690) (-708.578) [-713.330] -- 0:00:36
611500 -- (-708.033) (-706.186) [-703.290] (-707.402) * (-705.276) (-711.163) [-705.439] (-706.726) -- 0:00:36
612000 -- (-705.014) (-704.945) (-703.789) [-706.289] * [-702.306] (-715.733) (-714.146) (-706.247) -- 0:00:36
612500 -- (-707.976) (-705.731) (-707.400) [-704.669] * (-702.496) (-708.971) [-699.728] (-718.674) -- 0:00:36
613000 -- [-704.722] (-711.418) (-704.712) (-705.274) * (-702.809) (-703.981) [-701.470] (-713.424) -- 0:00:36
613500 -- [-707.203] (-707.113) (-712.180) (-705.983) * (-711.272) [-704.527] (-707.311) (-706.797) -- 0:00:36
614000 -- [-705.680] (-702.691) (-703.526) (-708.762) * (-702.919) (-705.235) (-708.392) [-711.095] -- 0:00:36
614500 -- (-707.924) (-703.620) (-714.222) [-707.271] * (-705.085) (-709.390) (-707.063) [-708.865] -- 0:00:36
615000 -- (-709.512) [-708.205] (-706.361) (-708.703) * (-704.058) (-709.201) [-703.211] (-703.012) -- 0:00:36
Average standard deviation of split frequencies: 0.017346
615500 -- (-709.785) [-705.306] (-711.726) (-710.475) * (-706.109) (-705.939) [-708.219] (-708.952) -- 0:00:36
616000 -- [-706.061] (-708.939) (-707.413) (-706.178) * [-704.848] (-706.214) (-701.183) (-705.583) -- 0:00:36
616500 -- [-707.903] (-709.593) (-707.367) (-705.599) * (-704.299) (-706.728) (-701.428) [-701.462] -- 0:00:36
617000 -- (-706.110) (-709.087) [-706.912] (-709.274) * [-704.950] (-705.606) (-703.788) (-706.950) -- 0:00:36
617500 -- [-713.071] (-705.856) (-706.675) (-705.945) * [-699.778] (-705.780) (-703.356) (-708.248) -- 0:00:35
618000 -- (-707.894) (-708.392) [-705.137] (-705.804) * (-705.336) (-705.259) (-709.702) [-705.083] -- 0:00:35
618500 -- (-706.170) (-710.921) [-704.642] (-705.136) * [-699.784] (-704.880) (-703.724) (-706.910) -- 0:00:35
619000 -- (-704.757) [-702.643] (-709.750) (-699.560) * [-704.491] (-709.790) (-706.298) (-705.662) -- 0:00:35
619500 -- [-709.486] (-710.477) (-702.074) (-713.753) * (-700.927) (-707.316) (-702.967) [-705.278] -- 0:00:35
620000 -- (-708.309) (-705.037) (-702.666) [-704.620] * (-704.301) [-710.175] (-703.072) (-705.946) -- 0:00:36
Average standard deviation of split frequencies: 0.017216
620500 -- [-703.239] (-711.857) (-703.296) (-706.549) * (-701.589) (-705.934) [-708.058] (-706.266) -- 0:00:36
621000 -- (-704.948) [-706.487] (-707.161) (-706.565) * (-708.135) (-701.775) (-708.441) [-702.000] -- 0:00:36
621500 -- [-706.006] (-710.334) (-708.764) (-707.189) * (-708.872) (-706.634) [-703.589] (-707.683) -- 0:00:35
622000 -- (-706.482) (-712.633) (-708.039) [-701.586] * (-704.722) (-700.873) (-709.867) [-710.919] -- 0:00:35
622500 -- (-705.387) (-701.586) (-712.190) [-704.853] * (-707.323) (-703.824) (-708.246) [-706.781] -- 0:00:35
623000 -- [-703.574] (-707.431) (-710.543) (-703.685) * [-702.638] (-703.615) (-711.169) (-706.562) -- 0:00:35
623500 -- (-704.626) (-706.476) [-706.987] (-708.189) * (-702.603) (-703.538) [-710.637] (-706.720) -- 0:00:35
624000 -- (-705.997) [-701.867] (-706.400) (-704.871) * (-704.722) (-705.073) [-707.135] (-710.334) -- 0:00:35
624500 -- (-710.229) [-708.038] (-710.763) (-715.259) * (-703.916) (-712.259) (-709.518) [-705.227] -- 0:00:35
625000 -- (-706.108) (-707.770) [-707.639] (-703.474) * [-701.305] (-707.569) (-705.377) (-704.403) -- 0:00:35
Average standard deviation of split frequencies: 0.018575
625500 -- (-712.230) (-705.525) [-713.255] (-704.317) * (-705.967) [-704.461] (-703.778) (-704.115) -- 0:00:35
626000 -- (-711.379) [-700.175] (-710.122) (-706.666) * [-705.572] (-709.335) (-706.064) (-709.046) -- 0:00:35
626500 -- (-708.201) (-703.056) (-707.607) [-708.080] * (-703.550) [-704.940] (-703.740) (-712.156) -- 0:00:35
627000 -- (-708.752) [-705.960] (-710.799) (-711.074) * (-711.311) (-704.733) [-707.315] (-716.321) -- 0:00:35
627500 -- (-708.898) (-704.813) (-707.145) [-699.665] * [-704.957] (-717.239) (-709.417) (-707.230) -- 0:00:35
628000 -- (-706.862) (-710.956) [-702.247] (-703.703) * (-712.926) (-701.148) [-706.573] (-710.855) -- 0:00:34
628500 -- (-712.145) (-704.054) (-713.086) [-702.838] * [-706.698] (-707.016) (-710.900) (-702.401) -- 0:00:34
629000 -- (-710.519) (-705.656) (-707.725) [-715.109] * (-709.486) [-707.898] (-709.223) (-704.651) -- 0:00:34
629500 -- [-705.339] (-710.358) (-702.719) (-705.769) * (-704.027) [-704.410] (-709.002) (-713.214) -- 0:00:34
630000 -- [-703.637] (-712.986) (-706.276) (-705.509) * (-706.774) [-699.373] (-710.383) (-710.186) -- 0:00:34
Average standard deviation of split frequencies: 0.018438
630500 -- (-707.243) (-711.087) [-702.642] (-701.555) * [-705.015] (-701.147) (-705.653) (-705.789) -- 0:00:34
631000 -- (-711.822) [-704.264] (-702.698) (-703.825) * [-705.301] (-703.846) (-705.733) (-704.941) -- 0:00:35
631500 -- (-704.257) [-705.604] (-709.308) (-708.519) * [-710.179] (-711.624) (-703.608) (-707.475) -- 0:00:35
632000 -- (-705.056) (-707.329) (-706.654) [-706.655] * (-701.321) (-708.866) [-706.693] (-702.339) -- 0:00:34
632500 -- (-703.605) (-709.879) [-704.862] (-703.198) * [-702.709] (-712.271) (-704.668) (-705.001) -- 0:00:34
633000 -- (-708.239) [-711.841] (-702.424) (-701.655) * (-707.042) (-709.172) (-704.632) [-704.769] -- 0:00:34
633500 -- [-709.339] (-702.220) (-705.064) (-703.476) * [-704.915] (-706.973) (-704.880) (-708.103) -- 0:00:34
634000 -- (-710.336) (-707.969) (-705.368) [-702.835] * (-707.575) [-705.991] (-706.814) (-705.637) -- 0:00:34
634500 -- (-707.938) (-709.374) (-711.092) [-708.801] * (-707.815) [-704.677] (-713.796) (-707.367) -- 0:00:34
635000 -- (-707.009) (-708.602) (-712.297) [-705.342] * (-711.463) (-712.502) (-700.349) [-710.815] -- 0:00:34
Average standard deviation of split frequencies: 0.019765
635500 -- (-709.052) (-709.397) [-704.288] (-709.311) * [-708.553] (-703.857) (-702.557) (-710.718) -- 0:00:34
636000 -- [-709.481] (-707.158) (-705.549) (-709.846) * [-702.176] (-703.988) (-705.327) (-705.494) -- 0:00:34
636500 -- [-708.206] (-705.308) (-704.728) (-710.045) * (-702.282) (-702.485) [-704.247] (-700.532) -- 0:00:34
637000 -- (-703.423) (-704.540) (-705.985) [-703.445] * (-707.553) [-701.379] (-703.668) (-701.887) -- 0:00:34
637500 -- (-707.104) (-704.790) [-704.246] (-701.312) * (-705.085) (-708.512) [-701.169] (-703.316) -- 0:00:34
638000 -- (-703.852) [-702.511] (-710.149) (-702.909) * (-707.017) (-704.889) (-704.653) [-713.365] -- 0:00:34
638500 -- [-703.983] (-704.560) (-702.489) (-703.104) * (-704.057) (-707.743) [-708.551] (-708.752) -- 0:00:33
639000 -- [-707.374] (-705.204) (-703.237) (-712.872) * (-711.976) [-702.381] (-707.108) (-705.892) -- 0:00:33
639500 -- [-703.919] (-702.585) (-703.472) (-703.224) * (-708.067) (-710.653) (-706.574) [-707.406] -- 0:00:33
640000 -- (-703.124) (-707.246) [-702.443] (-706.235) * (-703.741) (-704.557) (-704.798) [-703.593] -- 0:00:33
Average standard deviation of split frequencies: 0.019131
640500 -- (-709.632) (-706.519) [-705.518] (-710.869) * [-704.357] (-713.918) (-707.440) (-707.886) -- 0:00:33
641000 -- (-702.653) (-705.457) (-707.136) [-707.581] * (-710.964) (-708.350) (-709.386) [-711.265] -- 0:00:33
641500 -- [-704.995] (-702.823) (-704.000) (-712.681) * (-705.465) [-710.219] (-712.952) (-702.348) -- 0:00:34
642000 -- (-706.940) (-706.467) [-706.007] (-709.215) * (-706.843) [-702.512] (-705.091) (-703.712) -- 0:00:34
642500 -- (-706.158) (-709.749) [-703.728] (-708.070) * (-707.996) [-700.329] (-703.053) (-703.350) -- 0:00:33
643000 -- (-708.345) (-709.451) [-705.952] (-712.452) * (-699.963) (-699.495) (-709.239) [-703.573] -- 0:00:33
643500 -- [-703.888] (-710.025) (-705.430) (-709.568) * (-704.033) (-702.786) (-710.318) [-704.392] -- 0:00:33
644000 -- [-706.378] (-709.216) (-710.422) (-710.549) * (-703.979) (-711.325) (-703.278) [-706.550] -- 0:00:33
644500 -- (-708.094) (-704.477) (-707.390) [-712.921] * (-703.730) [-706.840] (-715.557) (-701.655) -- 0:00:33
645000 -- [-703.823] (-704.951) (-707.216) (-701.249) * [-704.777] (-710.930) (-712.531) (-705.587) -- 0:00:33
Average standard deviation of split frequencies: 0.019459
645500 -- (-710.476) [-700.649] (-708.219) (-712.421) * (-708.420) (-706.538) (-706.531) [-705.637] -- 0:00:33
646000 -- (-707.758) (-709.772) (-702.497) [-706.157] * (-711.532) (-709.560) (-712.864) [-708.011] -- 0:00:33
646500 -- (-707.154) (-705.632) [-708.169] (-716.806) * (-707.430) (-710.761) [-703.522] (-701.811) -- 0:00:33
647000 -- (-704.561) (-700.800) (-701.290) [-711.605] * (-704.516) (-705.452) [-702.618] (-703.973) -- 0:00:33
647500 -- (-710.517) (-706.339) (-703.572) [-706.122] * [-701.423] (-700.161) (-709.725) (-709.898) -- 0:00:33
648000 -- (-708.713) (-700.155) (-704.875) [-701.477] * [-703.642] (-704.478) (-705.096) (-705.922) -- 0:00:33
648500 -- (-714.297) [-700.247] (-705.077) (-705.422) * [-702.377] (-702.515) (-707.011) (-705.859) -- 0:00:33
649000 -- (-709.198) (-704.830) [-704.097] (-702.722) * (-700.356) (-712.967) [-704.081] (-710.808) -- 0:00:32
649500 -- [-708.538] (-709.585) (-705.176) (-708.245) * (-701.764) [-710.230] (-703.922) (-704.081) -- 0:00:32
650000 -- [-706.739] (-708.527) (-708.548) (-703.116) * (-708.831) (-706.390) [-704.852] (-703.400) -- 0:00:32
Average standard deviation of split frequencies: 0.018837
650500 -- [-711.454] (-707.959) (-706.242) (-709.902) * (-706.640) [-708.306] (-713.623) (-705.929) -- 0:00:32
651000 -- [-710.828] (-709.641) (-706.585) (-706.575) * [-701.875] (-703.246) (-712.277) (-706.300) -- 0:00:32
651500 -- [-705.614] (-705.180) (-706.310) (-707.822) * (-701.956) (-703.325) [-716.555] (-708.907) -- 0:00:32
652000 -- (-712.574) (-708.892) (-707.300) [-702.333] * (-706.754) [-706.630] (-707.262) (-706.398) -- 0:00:32
652500 -- (-703.432) (-710.617) [-702.599] (-707.588) * (-705.698) (-701.275) (-708.019) [-710.437] -- 0:00:33
653000 -- (-704.756) (-702.797) [-702.072] (-704.571) * (-705.404) (-703.072) [-705.431] (-703.772) -- 0:00:32
653500 -- (-705.807) (-708.576) [-702.980] (-704.653) * [-705.624] (-704.159) (-711.786) (-707.535) -- 0:00:32
654000 -- (-703.584) [-710.112] (-709.332) (-710.354) * (-710.671) (-701.042) (-709.276) [-706.382] -- 0:00:32
654500 -- (-704.652) [-712.390] (-703.667) (-707.893) * [-708.616] (-702.427) (-706.923) (-705.871) -- 0:00:32
655000 -- [-707.380] (-703.451) (-703.023) (-704.900) * (-706.132) (-702.872) (-706.909) [-705.109] -- 0:00:32
Average standard deviation of split frequencies: 0.020121
655500 -- [-703.948] (-705.713) (-705.776) (-708.800) * (-703.734) [-708.371] (-707.454) (-708.520) -- 0:00:32
656000 -- [-702.263] (-706.928) (-704.187) (-710.774) * (-703.525) (-708.872) [-701.886] (-705.897) -- 0:00:32
656500 -- [-703.677] (-713.462) (-707.419) (-706.269) * [-705.340] (-702.693) (-702.075) (-705.223) -- 0:00:32
657000 -- (-704.415) (-713.990) [-704.704] (-707.469) * (-707.166) (-707.743) [-700.947] (-705.556) -- 0:00:32
657500 -- (-707.510) (-710.328) [-707.459] (-709.862) * (-712.107) (-702.374) [-704.892] (-703.184) -- 0:00:32
658000 -- (-709.075) (-715.887) (-707.255) [-705.561] * (-701.382) (-709.305) [-705.679] (-704.650) -- 0:00:32
658500 -- (-712.434) (-707.908) (-714.768) [-707.631] * (-705.364) [-704.361] (-710.135) (-704.599) -- 0:00:32
659000 -- [-709.912] (-701.253) (-707.865) (-703.878) * (-705.542) [-702.131] (-707.566) (-708.026) -- 0:00:32
659500 -- (-709.208) (-712.546) [-709.898] (-705.279) * (-705.385) (-705.258) [-701.666] (-705.702) -- 0:00:32
660000 -- (-714.583) [-709.165] (-710.453) (-703.219) * (-708.941) [-704.304] (-699.822) (-703.550) -- 0:00:31
Average standard deviation of split frequencies: 0.019979
660500 -- (-709.803) (-706.531) (-711.287) [-704.795] * (-703.697) (-708.055) (-702.554) [-707.811] -- 0:00:31
661000 -- (-709.785) [-707.059] (-701.612) (-705.035) * (-710.145) (-704.322) (-707.093) [-707.585] -- 0:00:31
661500 -- [-700.576] (-706.082) (-706.475) (-703.137) * (-717.079) (-710.851) [-702.946] (-705.039) -- 0:00:31
662000 -- [-701.270] (-704.032) (-708.181) (-702.566) * (-713.396) (-703.736) (-705.837) [-705.726] -- 0:00:31
662500 -- (-704.711) (-711.255) [-702.955] (-712.783) * [-707.561] (-713.057) (-701.565) (-702.316) -- 0:00:32
663000 -- (-708.158) (-712.203) [-705.709] (-703.331) * (-717.690) (-717.272) (-703.939) [-705.474] -- 0:00:32
663500 -- [-707.779] (-704.603) (-706.881) (-708.936) * (-705.340) [-709.183] (-708.144) (-706.067) -- 0:00:31
664000 -- (-703.309) (-710.046) [-705.913] (-701.897) * [-708.858] (-704.821) (-706.777) (-704.645) -- 0:00:31
664500 -- (-704.103) (-703.816) [-704.161] (-705.647) * (-702.721) (-710.978) (-702.673) [-705.972] -- 0:00:31
665000 -- [-705.493] (-704.268) (-705.274) (-711.174) * (-708.088) (-702.785) (-705.945) [-700.657] -- 0:00:31
Average standard deviation of split frequencies: 0.019347
665500 -- (-701.029) [-706.807] (-711.711) (-710.446) * (-706.151) (-702.277) [-707.310] (-709.726) -- 0:00:31
666000 -- [-701.343] (-708.680) (-702.727) (-711.125) * (-707.111) [-702.083] (-704.575) (-705.663) -- 0:00:31
666500 -- (-702.692) (-707.916) (-705.232) [-704.316] * (-710.903) (-711.225) (-703.848) [-704.031] -- 0:00:31
667000 -- (-704.878) (-707.505) [-705.432] (-703.652) * (-711.079) (-706.426) (-707.783) [-704.322] -- 0:00:31
667500 -- [-701.848] (-704.635) (-707.067) (-704.291) * (-709.688) (-705.917) (-707.061) [-708.745] -- 0:00:31
668000 -- [-703.472] (-705.883) (-709.432) (-713.656) * (-710.258) (-701.092) [-701.776] (-713.377) -- 0:00:31
668500 -- (-704.583) (-704.815) [-706.016] (-708.052) * [-704.226] (-703.241) (-709.405) (-709.244) -- 0:00:31
669000 -- (-707.828) (-701.090) [-706.478] (-706.766) * [-706.027] (-708.131) (-702.860) (-704.118) -- 0:00:31
669500 -- (-705.106) [-708.476] (-707.027) (-709.503) * (-708.185) [-708.006] (-704.941) (-709.062) -- 0:00:31
670000 -- (-708.727) [-705.732] (-704.908) (-706.539) * (-706.692) (-711.534) (-711.527) [-705.361] -- 0:00:31
Average standard deviation of split frequencies: 0.019212
670500 -- (-706.378) (-713.592) [-707.499] (-701.531) * (-706.439) (-706.490) [-710.628] (-704.310) -- 0:00:30
671000 -- [-707.170] (-705.065) (-703.674) (-701.033) * (-703.987) (-706.083) [-707.312] (-702.941) -- 0:00:30
671500 -- (-701.071) (-706.183) [-703.597] (-706.770) * (-703.992) [-710.749] (-708.855) (-705.082) -- 0:00:30
672000 -- (-707.487) [-702.737] (-707.695) (-705.522) * (-705.009) [-704.333] (-708.500) (-706.694) -- 0:00:30
672500 -- (-704.017) (-702.972) [-709.189] (-704.127) * [-701.120] (-701.561) (-708.439) (-709.704) -- 0:00:30
673000 -- (-703.003) (-703.654) (-703.243) [-706.608] * (-703.063) [-702.625] (-710.017) (-702.327) -- 0:00:30
673500 -- (-704.749) (-708.143) (-703.826) [-702.220] * (-706.707) [-704.081] (-708.364) (-706.947) -- 0:00:31
674000 -- [-703.911] (-709.184) (-706.745) (-704.317) * (-702.923) (-704.619) (-705.895) [-703.118] -- 0:00:30
674500 -- (-705.081) (-702.934) [-707.562] (-709.854) * (-705.213) [-706.277] (-705.935) (-710.076) -- 0:00:30
675000 -- (-709.356) (-708.424) [-704.979] (-700.770) * [-708.793] (-710.805) (-708.833) (-704.353) -- 0:00:30
Average standard deviation of split frequencies: 0.018596
675500 -- (-708.197) (-703.771) (-702.014) [-707.415] * (-704.415) (-707.461) [-702.748] (-708.792) -- 0:00:30
676000 -- (-702.752) (-711.539) (-704.698) [-708.953] * (-706.731) (-711.868) (-707.614) [-702.882] -- 0:00:30
676500 -- (-704.234) [-704.055] (-708.423) (-704.621) * [-707.551] (-705.521) (-711.061) (-705.678) -- 0:00:30
677000 -- [-701.197] (-709.881) (-706.164) (-706.042) * (-702.890) [-710.976] (-710.492) (-705.277) -- 0:00:30
677500 -- (-705.224) (-719.904) [-708.541] (-706.029) * [-705.038] (-702.815) (-707.906) (-708.057) -- 0:00:30
678000 -- (-709.376) (-707.803) (-710.629) [-713.475] * (-705.303) (-709.273) [-706.181] (-706.946) -- 0:00:30
678500 -- (-704.203) (-710.961) (-704.678) [-709.281] * (-705.470) (-708.403) (-708.039) [-704.069] -- 0:00:30
679000 -- (-704.039) [-703.721] (-710.885) (-710.565) * (-710.429) (-704.843) [-705.186] (-706.927) -- 0:00:30
679500 -- (-704.617) [-703.370] (-707.584) (-705.087) * (-708.855) (-705.830) [-700.681] (-704.724) -- 0:00:30
680000 -- [-705.651] (-704.215) (-709.729) (-713.858) * (-705.751) (-711.182) (-702.760) [-706.955] -- 0:00:30
Average standard deviation of split frequencies: 0.018468
680500 -- (-705.127) [-705.193] (-713.113) (-708.891) * [-705.992] (-705.064) (-707.878) (-707.479) -- 0:00:30
681000 -- (-703.086) (-699.221) [-708.476] (-707.347) * (-703.620) [-708.525] (-706.145) (-702.803) -- 0:00:29
681500 -- (-705.826) [-701.711] (-709.233) (-706.937) * (-705.668) [-699.771] (-711.267) (-703.990) -- 0:00:29
682000 -- [-706.048] (-703.727) (-715.486) (-711.091) * (-706.977) (-706.969) [-702.152] (-708.284) -- 0:00:29
682500 -- (-705.380) (-703.078) [-713.356] (-706.581) * (-708.039) (-707.981) (-706.031) [-702.289] -- 0:00:29
683000 -- (-703.396) [-711.348] (-705.897) (-703.741) * [-706.511] (-699.744) (-704.355) (-710.625) -- 0:00:29
683500 -- [-705.590] (-717.507) (-709.788) (-711.255) * (-708.179) (-702.486) [-701.074] (-707.270) -- 0:00:29
684000 -- [-708.567] (-713.888) (-711.069) (-703.494) * (-710.905) (-713.040) (-702.535) [-707.737] -- 0:00:29
684500 -- (-705.180) (-713.804) (-703.510) [-706.085] * (-711.185) (-709.259) (-711.532) [-709.369] -- 0:00:29
685000 -- [-704.103] (-709.304) (-701.566) (-706.178) * (-707.632) [-704.284] (-701.505) (-711.410) -- 0:00:29
Average standard deviation of split frequencies: 0.018783
685500 -- [-705.970] (-704.696) (-700.714) (-702.550) * (-707.012) (-710.120) (-704.534) [-712.714] -- 0:00:29
686000 -- (-716.013) (-711.979) (-701.886) [-708.410] * (-708.161) (-709.087) [-704.581] (-701.946) -- 0:00:29
686500 -- (-706.177) (-709.624) (-707.317) [-708.549] * (-705.479) (-706.515) [-701.164] (-704.547) -- 0:00:29
687000 -- (-706.405) (-704.611) [-706.319] (-705.507) * (-709.193) (-710.802) (-704.048) [-711.290] -- 0:00:29
687500 -- [-703.870] (-705.239) (-702.985) (-708.008) * [-704.996] (-702.728) (-705.647) (-704.451) -- 0:00:29
688000 -- (-703.257) (-708.243) (-704.551) [-707.923] * (-703.661) [-702.536] (-707.309) (-703.141) -- 0:00:29
688500 -- (-704.799) [-704.416] (-702.513) (-707.878) * [-705.482] (-701.596) (-704.759) (-707.199) -- 0:00:29
689000 -- (-708.764) (-704.207) (-706.668) [-702.582] * (-716.172) [-705.117] (-707.744) (-705.420) -- 0:00:29
689500 -- (-707.465) [-701.989] (-707.618) (-705.163) * (-704.355) [-707.480] (-704.391) (-703.084) -- 0:00:29
690000 -- (-705.249) [-707.221] (-713.221) (-705.997) * [-702.256] (-710.757) (-703.608) (-709.252) -- 0:00:29
Average standard deviation of split frequencies: 0.020931
690500 -- [-703.989] (-707.900) (-705.044) (-706.012) * [-708.578] (-704.711) (-706.713) (-701.978) -- 0:00:29
691000 -- [-706.522] (-711.490) (-703.967) (-703.076) * (-702.319) (-705.372) [-703.842] (-705.504) -- 0:00:29
691500 -- (-704.817) (-706.930) [-702.143] (-708.048) * [-703.293] (-708.981) (-705.249) (-705.125) -- 0:00:28
692000 -- (-704.004) (-708.699) [-703.675] (-701.581) * (-703.561) (-707.061) [-706.418] (-703.812) -- 0:00:28
692500 -- [-704.735] (-707.416) (-705.376) (-702.251) * (-708.121) (-712.675) (-702.461) [-710.203] -- 0:00:28
693000 -- [-707.361] (-705.014) (-707.682) (-705.609) * (-708.818) (-709.230) [-706.679] (-703.112) -- 0:00:28
693500 -- (-703.268) [-701.798] (-707.055) (-702.502) * (-705.305) (-707.916) (-707.958) [-709.984] -- 0:00:28
694000 -- [-704.249] (-700.975) (-703.612) (-708.812) * (-707.385) [-709.952] (-706.852) (-706.863) -- 0:00:28
694500 -- (-706.486) (-709.757) [-714.301] (-706.082) * (-707.401) (-709.878) (-708.012) [-705.268] -- 0:00:28
695000 -- (-709.004) (-705.529) (-706.060) [-707.453] * (-701.193) (-704.313) [-714.649] (-709.155) -- 0:00:28
Average standard deviation of split frequencies: 0.021674
695500 -- (-708.675) (-706.210) (-706.692) [-707.106] * (-710.111) (-707.641) (-712.702) [-706.624] -- 0:00:28
696000 -- (-706.879) (-709.221) (-703.539) [-703.606] * [-701.560] (-712.040) (-709.821) (-709.115) -- 0:00:28
696500 -- (-707.246) (-702.796) [-700.796] (-707.503) * [-699.410] (-701.814) (-708.894) (-710.416) -- 0:00:28
697000 -- (-704.097) [-703.056] (-704.886) (-714.911) * (-710.399) [-703.433] (-708.550) (-715.974) -- 0:00:28
697500 -- (-709.517) [-703.830] (-709.971) (-705.461) * [-702.230] (-707.100) (-708.901) (-709.437) -- 0:00:28
698000 -- (-707.252) (-703.361) [-707.608] (-705.651) * (-712.368) (-705.167) [-702.748] (-709.218) -- 0:00:28
698500 -- (-705.884) [-706.615] (-710.268) (-703.917) * (-701.633) [-705.719] (-704.159) (-706.041) -- 0:00:28
699000 -- (-704.007) [-711.387] (-710.882) (-706.817) * (-710.031) [-706.763] (-706.415) (-700.896) -- 0:00:28
699500 -- (-703.604) [-705.265] (-706.318) (-704.748) * (-705.633) [-705.005] (-709.246) (-711.741) -- 0:00:28
700000 -- (-701.966) (-706.202) [-709.615] (-703.512) * [-713.182] (-705.234) (-701.419) (-708.865) -- 0:00:28
Average standard deviation of split frequencies: 0.020632
700500 -- (-709.047) [-703.493] (-706.366) (-714.693) * (-705.705) (-704.667) [-702.624] (-702.948) -- 0:00:28
701000 -- [-702.276] (-705.350) (-706.696) (-704.338) * (-704.570) (-706.168) (-709.701) [-707.500] -- 0:00:28
701500 -- [-716.544] (-709.532) (-706.344) (-705.398) * (-710.017) (-707.549) [-703.793] (-703.151) -- 0:00:28
702000 -- [-710.636] (-704.660) (-702.731) (-705.193) * (-704.048) (-705.922) [-708.983] (-704.361) -- 0:00:28
702500 -- [-710.973] (-701.768) (-703.366) (-702.130) * (-703.870) (-702.894) (-712.044) [-700.205] -- 0:00:27
703000 -- [-707.329] (-712.600) (-706.805) (-705.650) * (-704.787) (-701.186) (-708.150) [-705.230] -- 0:00:27
703500 -- [-706.200] (-713.700) (-703.782) (-706.133) * [-704.855] (-701.207) (-702.747) (-705.107) -- 0:00:27
704000 -- (-708.885) (-712.489) [-705.861] (-703.250) * [-703.429] (-704.682) (-713.363) (-708.528) -- 0:00:27
704500 -- (-710.068) (-713.885) [-710.411] (-704.299) * (-699.499) (-713.190) [-702.329] (-713.561) -- 0:00:27
705000 -- (-706.220) (-705.674) [-703.258] (-700.849) * (-702.423) [-704.946] (-706.723) (-716.974) -- 0:00:27
Average standard deviation of split frequencies: 0.020031
705500 -- (-704.425) (-712.029) [-711.363] (-701.960) * (-700.522) (-704.197) (-707.599) [-715.806] -- 0:00:27
706000 -- (-704.451) (-703.601) (-716.258) [-700.852] * (-711.378) (-710.081) [-704.734] (-712.692) -- 0:00:27
706500 -- (-704.533) [-711.676] (-703.003) (-703.480) * (-706.588) [-706.067] (-709.079) (-707.317) -- 0:00:27
707000 -- (-709.201) [-702.635] (-703.751) (-702.787) * [-702.863] (-710.260) (-711.312) (-709.375) -- 0:00:27
707500 -- (-703.129) (-709.439) [-703.442] (-701.681) * (-707.445) [-707.613] (-706.410) (-704.543) -- 0:00:27
708000 -- (-703.553) (-704.947) (-702.848) [-702.512] * (-701.550) [-707.243] (-713.017) (-706.738) -- 0:00:27
708500 -- (-703.985) (-705.460) (-709.862) [-704.083] * [-704.680] (-705.232) (-706.645) (-702.842) -- 0:00:27
709000 -- (-707.160) (-708.492) [-702.705] (-709.371) * (-707.428) (-703.957) (-709.968) [-704.878] -- 0:00:27
709500 -- (-706.560) (-706.495) [-704.270] (-705.579) * (-706.153) (-704.274) (-706.739) [-706.298] -- 0:00:27
710000 -- (-705.487) (-710.456) (-707.183) [-707.190] * [-707.308] (-706.107) (-711.208) (-703.479) -- 0:00:27
Average standard deviation of split frequencies: 0.021669
710500 -- [-702.016] (-709.051) (-704.791) (-702.774) * (-706.421) [-704.936] (-705.292) (-702.829) -- 0:00:27
711000 -- [-700.496] (-713.628) (-706.472) (-707.387) * (-704.705) (-705.138) [-708.755] (-704.291) -- 0:00:27
711500 -- (-702.227) (-708.400) (-708.593) [-703.325] * (-705.198) (-701.653) (-708.967) [-706.719] -- 0:00:27
712000 -- (-703.311) (-704.155) (-705.931) [-703.314] * (-706.270) (-706.708) (-709.827) [-703.965] -- 0:00:27
712500 -- (-704.029) [-705.802] (-713.172) (-705.062) * (-703.957) (-706.739) [-709.104] (-703.371) -- 0:00:27
713000 -- (-704.772) (-708.902) (-707.266) [-704.795] * [-700.268] (-702.668) (-704.489) (-703.106) -- 0:00:26
713500 -- [-708.590] (-716.577) (-706.348) (-709.634) * (-701.269) (-708.677) [-709.065] (-707.596) -- 0:00:26
714000 -- (-716.530) (-719.913) (-703.294) [-706.592] * [-706.068] (-701.932) (-706.990) (-706.393) -- 0:00:26
714500 -- (-706.044) (-706.469) (-706.067) [-707.126] * (-713.513) (-707.115) (-712.532) [-708.097] -- 0:00:26
715000 -- (-703.781) (-709.937) (-708.213) [-702.648] * (-708.608) (-705.629) (-706.324) [-707.331] -- 0:00:26
Average standard deviation of split frequencies: 0.023263
715500 -- [-703.430] (-707.156) (-708.483) (-704.519) * (-708.178) (-705.006) [-704.317] (-705.995) -- 0:00:26
716000 -- (-711.350) (-708.225) [-705.875] (-703.668) * (-704.662) [-707.021] (-702.947) (-702.704) -- 0:00:26
716500 -- (-708.752) [-707.642] (-707.192) (-706.003) * [-700.898] (-712.031) (-709.304) (-711.216) -- 0:00:26
717000 -- (-705.973) (-709.251) [-703.110] (-702.168) * (-705.345) [-702.915] (-704.443) (-702.304) -- 0:00:26
717500 -- (-708.136) (-707.088) [-704.667] (-706.049) * (-707.705) (-707.005) (-707.188) [-705.158] -- 0:00:26
718000 -- (-708.950) (-704.557) [-702.449] (-704.892) * (-706.057) [-704.776] (-705.497) (-704.339) -- 0:00:26
718500 -- [-706.229] (-703.517) (-712.852) (-703.588) * (-709.892) (-700.473) (-703.496) [-705.896] -- 0:00:26
719000 -- [-703.936] (-706.937) (-710.891) (-709.522) * [-705.432] (-704.677) (-705.942) (-707.957) -- 0:00:26
719500 -- (-702.198) (-705.011) [-704.268] (-701.297) * (-706.591) (-700.308) [-702.218] (-709.145) -- 0:00:26
720000 -- [-703.561] (-705.083) (-711.106) (-701.574) * (-704.425) (-706.334) [-700.581] (-703.746) -- 0:00:26
Average standard deviation of split frequencies: 0.023985
720500 -- [-705.412] (-703.958) (-702.077) (-701.645) * [-700.395] (-711.612) (-701.130) (-707.080) -- 0:00:26
721000 -- (-702.580) [-708.285] (-702.481) (-707.852) * (-708.535) (-707.783) [-708.561] (-710.311) -- 0:00:26
721500 -- (-705.990) (-703.378) (-703.565) [-704.934] * (-704.094) [-704.422] (-704.943) (-707.365) -- 0:00:26
722000 -- (-705.832) [-702.144] (-704.644) (-704.613) * [-702.078] (-704.325) (-703.752) (-703.946) -- 0:00:26
722500 -- (-703.943) [-705.806] (-706.544) (-704.976) * (-705.387) (-709.106) [-707.789] (-702.397) -- 0:00:26
723000 -- (-713.082) (-705.341) (-709.153) [-700.265] * (-705.319) [-702.758] (-707.092) (-702.437) -- 0:00:26
723500 -- (-703.143) [-702.292] (-715.471) (-705.311) * (-702.664) [-702.762] (-708.022) (-704.008) -- 0:00:25
724000 -- (-707.590) [-702.249] (-701.808) (-701.884) * (-704.200) (-705.819) (-705.766) [-705.363] -- 0:00:25
724500 -- (-711.523) [-703.259] (-705.000) (-709.729) * [-700.953] (-703.406) (-707.768) (-700.322) -- 0:00:25
725000 -- (-705.625) (-703.809) (-703.438) [-702.813] * [-700.432] (-701.484) (-709.802) (-707.223) -- 0:00:25
Average standard deviation of split frequencies: 0.022943
725500 -- (-709.121) [-703.617] (-703.172) (-704.316) * [-703.932] (-706.447) (-708.059) (-708.251) -- 0:00:25
726000 -- (-702.194) (-700.896) [-706.232] (-705.148) * (-703.451) (-704.751) (-705.102) [-705.827] -- 0:00:25
726500 -- (-713.713) [-707.297] (-706.759) (-705.142) * (-705.834) [-708.992] (-705.408) (-709.128) -- 0:00:25
727000 -- (-706.680) [-708.818] (-705.408) (-713.375) * (-705.800) [-705.773] (-701.987) (-709.572) -- 0:00:25
727500 -- [-710.636] (-706.844) (-711.824) (-716.219) * (-707.275) [-705.722] (-702.984) (-712.842) -- 0:00:25
728000 -- (-707.885) (-706.761) [-703.965] (-713.450) * (-702.366) [-704.128] (-700.620) (-708.044) -- 0:00:25
728500 -- (-707.481) [-705.192] (-708.228) (-714.106) * (-706.137) (-703.698) [-704.495] (-710.594) -- 0:00:25
729000 -- (-709.972) (-702.874) (-706.857) [-704.474] * [-699.592] (-706.657) (-706.802) (-707.505) -- 0:00:25
729500 -- (-702.643) (-701.638) [-707.987] (-702.959) * (-704.265) (-704.211) [-701.683] (-702.718) -- 0:00:25
730000 -- (-705.403) (-708.015) (-710.097) [-702.471] * (-703.757) [-707.646] (-709.140) (-705.509) -- 0:00:25
Average standard deviation of split frequencies: 0.022366
730500 -- [-707.820] (-714.087) (-703.836) (-704.540) * (-702.839) (-708.918) (-704.046) [-704.004] -- 0:00:25
731000 -- [-711.106] (-711.531) (-703.124) (-704.995) * (-706.748) (-707.400) (-703.604) [-704.339] -- 0:00:25
731500 -- [-704.187] (-707.761) (-708.730) (-710.952) * (-715.220) [-709.437] (-708.310) (-709.181) -- 0:00:25
732000 -- (-706.464) (-707.463) (-704.983) [-702.581] * (-707.115) (-710.216) (-703.204) [-702.336] -- 0:00:25
732500 -- (-705.336) (-704.566) [-706.588] (-704.072) * (-705.658) (-707.016) [-703.088] (-701.528) -- 0:00:25
733000 -- [-703.436] (-706.928) (-704.166) (-707.805) * (-704.063) [-703.405] (-700.850) (-716.499) -- 0:00:25
733500 -- (-701.836) (-702.893) (-703.711) [-705.591] * (-712.169) (-706.696) [-706.050] (-709.257) -- 0:00:25
734000 -- (-702.788) [-705.612] (-712.186) (-708.345) * (-711.974) (-718.262) (-705.438) [-711.609] -- 0:00:25
734500 -- [-701.018] (-712.438) (-712.330) (-703.796) * (-708.145) (-713.287) [-710.989] (-711.025) -- 0:00:24
735000 -- (-704.980) [-706.737] (-703.724) (-709.902) * (-707.689) (-706.026) (-705.694) [-706.962] -- 0:00:24
Average standard deviation of split frequencies: 0.019642
735500 -- (-704.582) (-700.358) [-702.329] (-702.978) * [-709.171] (-712.124) (-705.853) (-703.527) -- 0:00:24
736000 -- (-707.576) [-703.523] (-703.882) (-706.782) * (-707.959) (-702.960) (-704.506) [-704.579] -- 0:00:24
736500 -- (-704.071) (-709.125) (-710.753) [-708.824] * (-704.823) (-704.492) [-703.324] (-707.594) -- 0:00:24
737000 -- (-698.624) (-708.874) (-704.622) [-706.523] * (-708.675) (-708.267) (-702.299) [-706.089] -- 0:00:24
737500 -- (-703.407) [-704.762] (-705.506) (-704.599) * (-706.181) (-705.806) (-703.396) [-711.738] -- 0:00:24
738000 -- [-708.062] (-707.248) (-702.657) (-706.907) * (-709.537) (-703.363) [-702.699] (-701.823) -- 0:00:24
738500 -- (-709.601) (-701.340) (-713.009) [-707.004] * (-707.488) [-702.801] (-704.213) (-700.791) -- 0:00:24
739000 -- [-700.349] (-701.340) (-713.083) (-710.241) * [-705.839] (-702.001) (-706.496) (-713.092) -- 0:00:24
739500 -- (-701.269) [-708.913] (-707.527) (-704.150) * [-699.915] (-709.297) (-706.324) (-709.477) -- 0:00:24
740000 -- (-707.173) (-703.702) (-704.903) [-707.916] * [-700.317] (-702.485) (-705.140) (-703.452) -- 0:00:24
Average standard deviation of split frequencies: 0.019518
740500 -- [-702.507] (-706.114) (-710.156) (-704.030) * (-705.999) [-700.867] (-703.707) (-706.259) -- 0:00:24
741000 -- (-703.633) (-705.580) [-705.193] (-704.433) * [-703.349] (-709.092) (-707.688) (-711.678) -- 0:00:24
741500 -- (-700.437) [-701.265] (-704.401) (-703.768) * (-703.845) (-703.684) [-706.806] (-717.492) -- 0:00:24
742000 -- (-708.676) (-706.233) [-703.000] (-702.078) * (-707.525) (-708.850) (-705.438) [-708.159] -- 0:00:24
742500 -- [-704.148] (-714.832) (-708.275) (-706.397) * (-711.564) [-703.066] (-706.487) (-705.494) -- 0:00:24
743000 -- (-705.322) [-705.894] (-709.290) (-705.780) * (-706.770) (-714.130) [-705.900] (-705.887) -- 0:00:24
743500 -- (-707.758) [-706.464] (-711.541) (-707.598) * (-703.031) (-705.195) [-703.911] (-706.034) -- 0:00:24
744000 -- (-705.854) [-707.250] (-706.647) (-701.699) * (-706.561) (-704.703) (-708.661) [-706.940] -- 0:00:24
744500 -- (-706.890) (-706.751) [-703.070] (-705.113) * (-703.372) (-706.614) [-704.936] (-709.383) -- 0:00:24
745000 -- (-704.351) [-707.318] (-699.886) (-708.197) * (-703.196) (-713.368) (-705.476) [-709.586] -- 0:00:23
Average standard deviation of split frequencies: 0.019800
745500 -- (-702.784) [-704.000] (-706.221) (-705.742) * (-711.817) (-703.364) [-702.785] (-702.242) -- 0:00:23
746000 -- (-704.297) (-703.057) (-707.690) [-704.129] * (-709.345) (-708.193) [-710.069] (-701.854) -- 0:00:23
746500 -- (-707.763) (-703.491) (-707.499) [-702.233] * (-710.036) [-704.609] (-707.325) (-703.172) -- 0:00:23
747000 -- (-704.898) (-706.880) (-707.659) [-703.157] * (-711.465) [-702.493] (-706.830) (-706.165) -- 0:00:23
747500 -- (-707.270) (-705.717) (-709.626) [-700.424] * [-705.932] (-708.192) (-708.244) (-704.652) -- 0:00:23
748000 -- (-709.961) (-712.123) (-708.846) [-709.025] * (-703.362) (-706.053) [-704.879] (-709.235) -- 0:00:23
748500 -- (-707.276) (-715.098) [-705.235] (-707.470) * (-709.888) (-708.201) (-704.578) [-704.025] -- 0:00:23
749000 -- (-709.176) [-705.402] (-705.958) (-701.263) * [-706.321] (-703.275) (-709.678) (-709.491) -- 0:00:23
749500 -- (-706.887) [-703.182] (-712.122) (-705.181) * (-711.811) [-704.179] (-705.501) (-707.133) -- 0:00:23
750000 -- (-704.333) (-702.393) [-705.719] (-706.393) * (-704.364) (-711.891) (-707.467) [-702.764] -- 0:00:23
Average standard deviation of split frequencies: 0.019677
750500 -- (-705.821) (-705.451) [-707.389] (-701.697) * (-705.527) [-703.199] (-706.110) (-707.031) -- 0:00:23
751000 -- (-710.867) (-708.261) (-707.467) [-707.580] * [-706.095] (-710.018) (-708.113) (-704.761) -- 0:00:23
751500 -- (-709.192) (-701.863) (-705.329) [-704.658] * [-700.668] (-705.066) (-704.050) (-704.980) -- 0:00:23
752000 -- (-708.740) (-716.705) [-704.803] (-700.922) * [-705.027] (-703.827) (-705.398) (-714.226) -- 0:00:23
752500 -- (-709.745) (-705.383) (-703.267) [-700.456] * (-712.141) [-705.664] (-704.182) (-713.299) -- 0:00:23
753000 -- (-711.488) (-705.286) [-705.111] (-707.645) * (-706.891) (-706.937) [-704.287] (-708.476) -- 0:00:23
753500 -- (-706.717) [-703.018] (-702.932) (-702.173) * (-710.584) (-707.455) [-705.946] (-710.699) -- 0:00:23
754000 -- (-708.176) (-702.968) [-708.923] (-710.745) * (-709.466) [-707.766] (-708.790) (-708.581) -- 0:00:23
754500 -- [-704.778] (-704.957) (-710.193) (-709.540) * (-709.785) [-711.520] (-704.346) (-710.673) -- 0:00:23
755000 -- (-705.418) [-704.631] (-708.299) (-703.353) * (-708.040) (-716.708) [-708.142] (-709.942) -- 0:00:23
Average standard deviation of split frequencies: 0.018291
755500 -- (-704.857) [-705.550] (-709.345) (-709.577) * (-705.815) [-704.231] (-705.207) (-704.582) -- 0:00:22
756000 -- (-710.991) (-703.347) [-709.357] (-705.237) * [-706.271] (-703.558) (-708.861) (-704.123) -- 0:00:22
756500 -- (-705.447) (-706.980) [-708.481] (-717.543) * (-709.782) (-710.522) (-707.079) [-702.293] -- 0:00:22
757000 -- (-708.481) [-705.114] (-709.341) (-710.566) * (-712.094) (-708.695) (-709.939) [-707.553] -- 0:00:22
757500 -- (-707.995) (-704.278) (-705.630) [-702.871] * (-705.845) (-704.693) (-702.699) [-705.053] -- 0:00:22
758000 -- (-704.971) [-701.765] (-712.078) (-710.222) * (-708.775) [-703.367] (-702.376) (-704.639) -- 0:00:22
758500 -- (-708.798) (-701.147) [-704.554] (-706.046) * (-708.557) (-700.544) (-708.858) [-711.960] -- 0:00:22
759000 -- [-703.749] (-705.602) (-706.817) (-710.106) * (-706.209) [-700.631] (-711.062) (-708.197) -- 0:00:22
759500 -- [-713.171] (-705.961) (-709.937) (-705.725) * [-707.666] (-710.769) (-710.173) (-708.991) -- 0:00:22
760000 -- (-705.964) (-701.187) [-707.312] (-703.355) * (-706.284) (-705.940) (-704.475) [-705.203] -- 0:00:22
Average standard deviation of split frequencies: 0.017765
760500 -- (-711.103) [-702.117] (-707.284) (-707.320) * (-704.090) (-703.405) (-708.719) [-701.919] -- 0:00:22
761000 -- (-706.270) [-706.604] (-715.339) (-704.366) * (-712.299) (-703.340) (-719.472) [-704.967] -- 0:00:22
761500 -- (-711.724) [-704.039] (-710.565) (-707.380) * (-706.005) [-702.523] (-712.990) (-704.095) -- 0:00:22
762000 -- (-707.162) (-708.582) [-706.088] (-708.056) * [-703.529] (-706.137) (-705.221) (-708.525) -- 0:00:22
762500 -- (-706.829) (-714.186) (-717.034) [-706.147] * (-705.952) [-711.214] (-708.640) (-705.530) -- 0:00:22
763000 -- (-710.366) [-704.654] (-701.264) (-717.783) * [-701.341] (-701.912) (-708.517) (-709.537) -- 0:00:22
763500 -- (-707.636) [-707.871] (-704.851) (-714.793) * (-703.894) (-705.680) [-707.190] (-708.802) -- 0:00:22
764000 -- [-713.140] (-706.850) (-710.260) (-712.676) * (-706.411) [-705.284] (-704.914) (-705.905) -- 0:00:22
764500 -- (-708.707) (-714.934) [-704.886] (-702.693) * [-707.215] (-708.005) (-706.317) (-707.837) -- 0:00:22
765000 -- (-708.178) [-709.847] (-706.680) (-702.701) * [-700.050] (-703.186) (-705.233) (-701.933) -- 0:00:22
Average standard deviation of split frequencies: 0.016821
765500 -- (-706.982) (-716.945) [-705.313] (-705.765) * (-707.345) (-705.319) (-701.282) [-700.732] -- 0:00:22
766000 -- [-708.787] (-707.649) (-710.560) (-708.054) * [-701.523] (-709.337) (-699.128) (-704.081) -- 0:00:21
766500 -- (-708.517) (-705.958) (-703.298) [-709.765] * (-701.954) [-707.856] (-705.710) (-704.548) -- 0:00:21
767000 -- (-705.365) (-707.311) (-705.070) [-705.824] * [-704.527] (-704.413) (-708.066) (-707.524) -- 0:00:21
767500 -- [-703.582] (-711.405) (-706.307) (-707.218) * (-707.243) [-707.265] (-708.720) (-706.460) -- 0:00:21
768000 -- [-704.895] (-703.821) (-701.990) (-710.221) * (-700.733) [-701.372] (-704.204) (-703.394) -- 0:00:21
768500 -- (-702.980) (-702.896) (-703.624) [-701.184] * (-699.399) (-705.645) [-702.839] (-707.638) -- 0:00:21
769000 -- (-707.168) (-705.553) [-703.610] (-705.705) * (-708.028) (-704.967) [-703.056] (-702.375) -- 0:00:21
769500 -- [-703.634] (-706.158) (-709.847) (-708.901) * [-705.241] (-713.040) (-705.215) (-707.502) -- 0:00:21
770000 -- [-707.967] (-702.777) (-700.426) (-717.577) * [-702.493] (-711.665) (-713.980) (-710.996) -- 0:00:21
Average standard deviation of split frequencies: 0.017127
770500 -- (-706.271) (-705.237) (-701.101) [-706.784] * (-703.299) (-706.663) (-704.922) [-715.479] -- 0:00:21
771000 -- (-708.887) [-706.623] (-704.241) (-704.825) * (-705.639) (-708.441) [-704.085] (-704.575) -- 0:00:21
771500 -- (-707.482) [-702.078] (-704.292) (-707.155) * (-703.030) (-705.184) (-704.003) [-708.197] -- 0:00:21
772000 -- (-704.723) [-704.530] (-705.139) (-705.899) * (-700.791) (-704.521) (-710.699) [-705.292] -- 0:00:21
772500 -- (-703.147) (-701.284) (-704.390) [-703.801] * (-707.267) [-705.861] (-710.206) (-706.705) -- 0:00:21
773000 -- (-704.217) (-707.165) (-705.292) [-704.551] * (-702.576) (-706.704) [-703.729] (-715.214) -- 0:00:21
773500 -- (-705.791) [-703.529] (-703.237) (-707.697) * (-708.314) (-709.985) [-703.523] (-706.187) -- 0:00:21
774000 -- (-704.992) [-703.009] (-710.059) (-706.235) * [-703.962] (-709.275) (-711.801) (-711.928) -- 0:00:21
774500 -- (-704.440) [-708.374] (-702.154) (-705.967) * (-704.411) (-711.355) [-711.461] (-705.512) -- 0:00:21
775000 -- (-706.395) [-703.995] (-710.742) (-704.106) * [-704.917] (-703.308) (-704.133) (-712.567) -- 0:00:21
Average standard deviation of split frequencies: 0.017819
775500 -- [-709.373] (-704.791) (-705.117) (-705.233) * (-701.000) (-705.842) (-707.225) [-711.865] -- 0:00:21
776000 -- (-709.857) (-703.253) (-708.858) [-700.592] * (-706.946) [-710.101] (-703.489) (-707.216) -- 0:00:21
776500 -- (-706.613) (-706.084) (-707.361) [-705.978] * (-708.417) (-702.716) [-707.902] (-707.157) -- 0:00:21
777000 -- (-710.065) [-706.990] (-705.841) (-709.324) * (-705.272) [-704.493] (-704.635) (-706.707) -- 0:00:20
777500 -- (-709.415) (-705.051) [-705.057] (-706.253) * [-703.972] (-703.312) (-702.130) (-709.639) -- 0:00:20
778000 -- (-709.071) (-705.626) (-716.515) [-706.756] * (-704.302) [-703.647] (-707.307) (-711.021) -- 0:00:20
778500 -- (-706.987) [-708.349] (-707.936) (-704.827) * (-701.855) [-707.735] (-714.170) (-705.319) -- 0:00:20
779000 -- (-711.563) (-703.310) (-703.909) [-703.691] * (-711.716) (-706.740) [-702.797] (-703.253) -- 0:00:20
779500 -- (-715.128) (-707.981) (-701.347) [-704.690] * (-707.198) (-707.917) (-711.230) [-707.815] -- 0:00:20
780000 -- (-711.586) (-709.242) [-706.029] (-708.016) * (-704.795) [-706.421] (-708.346) (-706.246) -- 0:00:20
Average standard deviation of split frequencies: 0.018921
780500 -- (-715.133) (-711.206) [-707.454] (-700.481) * (-705.233) (-701.188) [-705.146] (-705.820) -- 0:00:20
781000 -- (-710.069) (-714.955) [-704.074] (-706.045) * (-705.798) (-707.627) [-701.405] (-710.749) -- 0:00:20
781500 -- (-721.006) [-704.284] (-709.777) (-703.117) * (-705.664) (-706.149) [-704.672] (-703.855) -- 0:00:20
782000 -- (-709.856) (-708.195) (-708.354) [-705.833] * (-704.216) (-700.997) (-706.223) [-707.592] -- 0:00:20
782500 -- [-708.734] (-705.695) (-706.209) (-703.596) * (-704.806) (-704.006) (-713.563) [-708.851] -- 0:00:20
783000 -- (-705.818) [-704.482] (-702.570) (-708.792) * [-700.424] (-707.349) (-705.369) (-714.997) -- 0:00:20
783500 -- (-705.184) (-709.431) (-706.431) [-705.407] * [-705.338] (-704.489) (-705.188) (-709.009) -- 0:00:20
784000 -- (-703.503) [-704.415] (-707.446) (-703.932) * (-706.369) (-707.281) (-706.318) [-703.274] -- 0:00:20
784500 -- (-707.059) (-706.718) (-711.932) [-701.047] * (-710.890) (-704.889) [-709.420] (-701.693) -- 0:00:20
785000 -- (-701.477) [-707.219] (-708.029) (-712.468) * [-714.998] (-707.080) (-704.587) (-701.476) -- 0:00:20
Average standard deviation of split frequencies: 0.018792
785500 -- (-708.381) (-703.590) [-707.578] (-703.244) * [-705.009] (-706.827) (-707.609) (-707.490) -- 0:00:20
786000 -- (-712.280) (-705.089) [-703.664] (-708.038) * (-703.875) (-711.524) [-706.684] (-708.483) -- 0:00:20
786500 -- [-701.790] (-707.056) (-703.301) (-700.807) * [-703.209] (-704.577) (-704.822) (-704.866) -- 0:00:20
787000 -- (-709.337) (-715.676) [-703.954] (-707.034) * (-706.194) [-705.276] (-704.009) (-707.070) -- 0:00:20
787500 -- (-700.735) (-711.462) [-704.507] (-705.869) * [-710.004] (-709.513) (-702.342) (-708.695) -- 0:00:19
788000 -- (-705.167) (-708.454) [-707.171] (-704.799) * (-711.173) [-711.202] (-705.081) (-702.698) -- 0:00:19
788500 -- (-710.235) [-708.810] (-704.240) (-709.145) * (-709.481) [-706.625] (-708.489) (-707.420) -- 0:00:19
789000 -- (-706.271) (-712.299) [-709.337] (-702.330) * (-703.322) (-706.032) [-703.911] (-710.145) -- 0:00:19
789500 -- (-705.711) (-701.570) (-709.757) [-710.887] * (-707.719) (-706.373) (-704.544) [-701.695] -- 0:00:19
790000 -- (-702.968) [-701.664] (-702.060) (-706.058) * (-703.389) (-711.506) (-704.511) [-708.683] -- 0:00:19
Average standard deviation of split frequencies: 0.018284
790500 -- (-708.795) [-703.740] (-709.283) (-708.036) * (-705.395) (-708.605) (-704.742) [-702.409] -- 0:00:19
791000 -- (-714.061) (-704.266) (-710.022) [-708.458] * [-705.765] (-703.691) (-704.967) (-707.569) -- 0:00:19
791500 -- [-705.828] (-707.485) (-713.290) (-710.750) * (-706.144) [-700.629] (-707.107) (-704.464) -- 0:00:19
792000 -- (-703.963) [-706.061] (-719.787) (-709.551) * (-702.449) (-702.943) [-706.007] (-703.744) -- 0:00:19
792500 -- (-704.265) (-706.524) (-708.192) [-704.007] * [-705.432] (-703.412) (-716.883) (-701.933) -- 0:00:19
793000 -- (-702.825) (-706.426) [-710.390] (-707.620) * (-707.947) (-708.240) [-705.302] (-704.124) -- 0:00:19
793500 -- [-703.576] (-706.192) (-707.973) (-711.545) * (-712.105) (-704.639) [-705.356] (-709.135) -- 0:00:19
794000 -- [-703.459] (-705.852) (-705.448) (-709.336) * (-711.001) [-705.431] (-712.746) (-699.472) -- 0:00:19
794500 -- (-703.611) (-707.246) (-705.767) [-707.517] * [-706.426] (-702.079) (-710.348) (-702.175) -- 0:00:19
795000 -- (-707.979) [-703.724] (-708.919) (-708.819) * [-705.719] (-704.089) (-706.135) (-712.194) -- 0:00:19
Average standard deviation of split frequencies: 0.018951
795500 -- (-715.472) [-699.753] (-714.490) (-707.003) * (-701.555) (-707.011) [-707.705] (-712.353) -- 0:00:19
796000 -- [-708.060] (-702.540) (-705.142) (-704.529) * (-702.883) (-711.080) [-702.386] (-710.047) -- 0:00:19
796500 -- (-707.572) (-705.710) (-709.744) [-709.012] * (-703.449) (-702.143) [-702.123] (-707.589) -- 0:00:19
797000 -- (-701.177) (-704.108) [-704.730] (-708.941) * [-703.187] (-703.702) (-704.567) (-705.432) -- 0:00:19
797500 -- (-705.039) (-705.017) [-704.084] (-702.824) * (-706.173) (-708.260) (-703.799) [-708.381] -- 0:00:19
798000 -- (-703.708) (-702.863) [-715.776] (-705.136) * (-705.838) [-701.831] (-703.344) (-708.945) -- 0:00:18
798500 -- (-712.806) (-703.657) (-703.123) [-704.070] * (-708.287) (-702.270) [-706.885] (-707.266) -- 0:00:18
799000 -- (-704.649) (-706.327) (-710.461) [-708.111] * (-705.775) [-704.603] (-703.645) (-704.600) -- 0:00:18
799500 -- (-711.414) (-705.870) (-713.849) [-703.126] * (-706.410) (-705.889) [-700.436] (-703.957) -- 0:00:18
800000 -- (-706.581) (-707.540) (-712.513) [-703.707] * (-706.146) [-712.344] (-705.102) (-705.309) -- 0:00:18
Average standard deviation of split frequencies: 0.017270
800500 -- (-707.116) [-704.729] (-712.319) (-708.651) * (-705.470) (-703.926) [-704.628] (-705.316) -- 0:00:18
801000 -- (-701.848) (-708.023) (-710.801) [-704.194] * (-715.550) (-713.016) [-702.940] (-712.075) -- 0:00:18
801500 -- (-706.234) [-707.109] (-706.022) (-714.057) * (-706.339) (-707.416) [-706.704] (-712.459) -- 0:00:18
802000 -- (-715.052) [-701.861] (-707.985) (-720.521) * (-705.049) (-706.440) (-704.624) [-702.630] -- 0:00:18
802500 -- (-707.714) (-703.924) (-706.522) [-704.151] * (-713.619) [-705.083] (-707.618) (-700.957) -- 0:00:18
803000 -- (-706.903) [-700.901] (-707.368) (-716.289) * (-709.432) (-710.332) (-704.596) [-705.198] -- 0:00:18
803500 -- (-705.249) [-699.794] (-706.918) (-704.543) * (-709.149) (-710.470) (-709.453) [-705.936] -- 0:00:18
804000 -- (-709.504) (-709.151) [-704.767] (-703.270) * (-714.055) [-708.122] (-706.872) (-707.883) -- 0:00:18
804500 -- (-705.700) (-705.798) (-700.036) [-704.323] * (-705.324) (-707.561) (-703.690) [-712.278] -- 0:00:18
805000 -- (-707.233) (-709.539) [-706.724] (-705.078) * (-710.954) (-705.350) (-702.113) [-707.112] -- 0:00:18
Average standard deviation of split frequencies: 0.018326
805500 -- (-709.411) (-704.003) (-708.172) [-703.736] * (-709.761) [-702.488] (-701.163) (-702.188) -- 0:00:18
806000 -- (-709.251) (-705.940) [-706.708] (-707.109) * (-707.473) (-705.200) [-708.263] (-707.334) -- 0:00:18
806500 -- (-707.720) (-709.881) (-708.256) [-704.034] * (-707.477) (-706.675) (-705.456) [-710.104] -- 0:00:18
807000 -- [-709.508] (-705.824) (-705.399) (-709.927) * (-711.796) [-704.282] (-703.750) (-703.037) -- 0:00:18
807500 -- (-706.687) [-703.875] (-703.357) (-705.498) * (-711.692) (-709.550) (-701.825) [-706.838] -- 0:00:18
808000 -- [-703.558] (-705.767) (-705.666) (-711.918) * (-713.244) (-707.308) [-699.394] (-709.880) -- 0:00:18
808500 -- (-710.407) (-710.555) (-705.450) [-706.127] * (-713.234) (-711.524) [-706.064] (-704.628) -- 0:00:18
809000 -- [-705.591] (-705.537) (-706.627) (-705.488) * (-703.091) (-713.938) (-706.068) [-701.631] -- 0:00:17
809500 -- (-706.611) (-704.049) [-708.343] (-702.167) * (-704.736) (-708.920) (-708.971) [-703.359] -- 0:00:17
810000 -- (-704.685) [-699.980] (-710.363) (-702.132) * (-712.422) (-704.608) [-708.257] (-705.795) -- 0:00:17
Average standard deviation of split frequencies: 0.018608
810500 -- (-707.731) [-703.779] (-708.383) (-705.161) * [-713.303] (-704.184) (-700.991) (-705.844) -- 0:00:17
811000 -- (-701.089) (-707.388) (-712.492) [-703.647] * [-709.192] (-709.626) (-702.131) (-706.287) -- 0:00:17
811500 -- [-705.096] (-699.846) (-711.404) (-703.576) * (-717.806) (-707.120) (-705.188) [-703.867] -- 0:00:17
812000 -- (-703.987) (-703.200) [-707.134] (-699.890) * (-705.930) (-704.092) (-710.043) [-704.995] -- 0:00:17
812500 -- (-703.416) (-702.103) (-709.466) [-702.708] * (-706.597) [-702.200] (-711.007) (-707.385) -- 0:00:17
813000 -- (-711.370) (-704.226) (-707.440) [-700.986] * (-707.740) (-707.871) [-706.468] (-704.084) -- 0:00:17
813500 -- [-703.950] (-706.311) (-708.520) (-704.178) * (-706.383) (-704.204) [-707.953] (-703.722) -- 0:00:17
814000 -- (-702.985) (-704.247) [-706.931] (-703.832) * [-705.751] (-707.057) (-704.286) (-703.096) -- 0:00:17
814500 -- (-705.517) (-703.419) [-703.255] (-711.607) * (-707.008) (-709.240) [-706.580] (-706.770) -- 0:00:17
815000 -- (-704.160) [-707.259] (-707.386) (-703.884) * (-702.510) [-700.490] (-704.648) (-701.105) -- 0:00:17
Average standard deviation of split frequencies: 0.018872
815500 -- [-706.165] (-705.504) (-703.773) (-701.779) * [-709.673] (-704.180) (-707.067) (-705.846) -- 0:00:17
816000 -- [-700.669] (-704.706) (-707.475) (-705.095) * [-709.614] (-708.095) (-704.252) (-704.073) -- 0:00:17
816500 -- (-709.343) (-701.503) [-705.828] (-704.681) * (-705.020) [-706.270] (-715.886) (-701.378) -- 0:00:17
817000 -- (-705.154) (-706.675) [-703.931] (-702.869) * [-704.287] (-704.119) (-717.351) (-704.007) -- 0:00:17
817500 -- (-709.471) (-701.769) (-704.136) [-700.309] * [-702.347] (-707.081) (-710.184) (-705.767) -- 0:00:17
818000 -- (-710.964) (-704.303) (-702.378) [-703.983] * (-707.410) [-708.417] (-707.443) (-708.356) -- 0:00:17
818500 -- [-711.401] (-703.133) (-713.052) (-704.186) * (-704.601) (-707.048) (-704.919) [-705.399] -- 0:00:17
819000 -- [-703.397] (-702.453) (-709.374) (-703.220) * (-705.325) (-709.133) (-710.308) [-702.182] -- 0:00:17
819500 -- [-706.311] (-705.302) (-708.358) (-703.378) * [-705.597] (-708.168) (-710.277) (-704.747) -- 0:00:16
820000 -- (-713.649) (-705.008) [-706.594] (-708.610) * (-704.906) (-704.976) [-702.339] (-701.070) -- 0:00:16
Average standard deviation of split frequencies: 0.018764
820500 -- (-698.874) (-703.953) (-704.145) [-706.537] * (-710.876) (-703.001) (-705.221) [-703.241] -- 0:00:16
821000 -- (-702.637) [-701.772] (-706.184) (-708.166) * (-701.967) (-708.708) [-709.686] (-701.890) -- 0:00:16
821500 -- (-708.339) (-705.014) (-708.196) [-705.229] * (-706.091) (-713.288) [-706.391] (-699.888) -- 0:00:16
822000 -- (-706.439) [-703.875] (-702.334) (-709.947) * [-706.765] (-709.806) (-708.632) (-700.681) -- 0:00:16
822500 -- (-708.876) [-711.563] (-711.174) (-702.640) * [-705.685] (-704.835) (-714.296) (-701.710) -- 0:00:16
823000 -- (-715.757) [-706.363] (-708.171) (-700.991) * (-712.706) (-712.754) [-707.872] (-699.603) -- 0:00:16
823500 -- (-703.466) (-713.807) (-706.165) [-704.113] * (-704.046) (-713.675) (-705.079) [-701.497] -- 0:00:16
824000 -- [-707.015] (-703.911) (-709.008) (-705.854) * (-707.525) [-710.492] (-704.031) (-705.335) -- 0:00:16
824500 -- (-710.294) [-708.098] (-706.275) (-705.807) * (-703.438) (-710.916) [-704.420] (-706.222) -- 0:00:16
825000 -- (-702.053) (-704.172) [-708.137] (-702.906) * [-707.539] (-710.342) (-705.874) (-708.194) -- 0:00:16
Average standard deviation of split frequencies: 0.017882
825500 -- (-704.615) [-705.701] (-706.450) (-708.110) * (-710.971) (-708.251) (-711.473) [-703.388] -- 0:00:16
826000 -- (-713.458) (-701.737) [-710.166] (-710.103) * (-704.576) [-711.854] (-714.623) (-703.967) -- 0:00:16
826500 -- (-700.132) (-708.465) [-706.161] (-706.435) * (-710.170) (-704.235) (-707.796) [-704.338] -- 0:00:16
827000 -- (-701.383) [-702.646] (-710.479) (-714.868) * (-706.371) (-706.572) [-704.990] (-710.222) -- 0:00:16
827500 -- (-707.721) (-707.103) (-708.173) [-711.340] * (-705.965) (-706.230) (-705.823) [-709.426] -- 0:00:16
828000 -- (-715.888) [-706.184] (-701.066) (-706.112) * [-703.874] (-707.008) (-706.111) (-707.927) -- 0:00:16
828500 -- (-708.165) [-706.077] (-706.064) (-705.859) * (-705.369) [-703.662] (-705.743) (-706.182) -- 0:00:16
829000 -- (-707.766) [-705.304] (-703.858) (-703.833) * [-703.421] (-712.095) (-711.807) (-705.676) -- 0:00:16
829500 -- (-705.175) (-707.169) (-707.619) [-708.524] * [-705.171] (-707.410) (-714.592) (-706.282) -- 0:00:16
830000 -- (-706.418) (-706.630) (-703.040) [-709.168] * (-708.116) (-707.144) [-700.439] (-707.064) -- 0:00:15
Average standard deviation of split frequencies: 0.015512
830500 -- [-700.048] (-702.413) (-710.075) (-708.288) * (-704.648) (-704.793) [-706.137] (-708.590) -- 0:00:15
831000 -- (-706.892) (-708.053) (-704.796) [-705.306] * (-704.365) (-710.438) [-708.728] (-706.102) -- 0:00:15
831500 -- [-704.167] (-704.526) (-712.882) (-707.306) * (-705.324) (-705.327) [-703.046] (-707.957) -- 0:00:15
832000 -- (-710.646) (-703.276) [-706.615] (-708.928) * (-714.990) [-703.620] (-699.896) (-708.936) -- 0:00:15
832500 -- (-706.160) (-702.649) (-703.845) [-705.394] * (-711.720) [-704.311] (-709.571) (-707.887) -- 0:00:15
833000 -- (-710.639) [-702.535] (-710.136) (-704.222) * (-702.972) (-707.902) [-701.173] (-703.913) -- 0:00:15
833500 -- (-710.107) (-705.689) (-703.685) [-707.327] * [-703.245] (-706.250) (-705.550) (-705.638) -- 0:00:15
834000 -- (-710.408) (-707.094) (-705.491) [-706.798] * [-707.014] (-705.654) (-706.506) (-704.013) -- 0:00:15
834500 -- (-716.621) (-702.340) [-701.639] (-702.339) * (-709.917) (-706.633) [-706.192] (-710.119) -- 0:00:15
835000 -- [-711.511] (-702.598) (-702.795) (-705.042) * (-711.601) [-711.695] (-709.409) (-713.373) -- 0:00:15
Average standard deviation of split frequencies: 0.015037
835500 -- (-710.201) (-705.691) (-712.473) [-706.675] * (-709.256) [-704.609] (-703.996) (-702.686) -- 0:00:15
836000 -- (-704.827) (-712.424) [-704.619] (-709.381) * (-709.599) [-703.304] (-708.504) (-712.703) -- 0:00:15
836500 -- (-708.771) (-707.135) (-705.740) [-706.948] * (-710.945) (-701.970) (-711.403) [-706.645] -- 0:00:15
837000 -- [-704.482] (-709.939) (-709.314) (-709.291) * (-710.462) [-705.177] (-704.978) (-707.211) -- 0:00:15
837500 -- [-702.336] (-710.468) (-710.526) (-706.028) * (-710.630) [-708.655] (-701.002) (-708.075) -- 0:00:15
838000 -- (-707.597) (-704.166) [-706.148] (-705.382) * [-712.800] (-706.720) (-710.871) (-703.088) -- 0:00:15
838500 -- [-704.641] (-705.029) (-702.350) (-703.565) * (-707.399) (-704.903) (-713.115) [-700.242] -- 0:00:15
839000 -- (-705.555) (-707.672) (-709.150) [-703.727] * (-702.653) (-706.752) [-702.969] (-705.461) -- 0:00:15
839500 -- (-711.531) (-703.589) [-713.810] (-703.260) * (-711.686) [-703.689] (-705.632) (-707.791) -- 0:00:15
840000 -- (-704.564) (-701.814) (-707.041) [-704.197] * (-706.187) (-700.678) (-703.819) [-709.379] -- 0:00:15
Average standard deviation of split frequencies: 0.016449
840500 -- [-706.636] (-702.216) (-712.374) (-715.814) * [-704.312] (-707.743) (-705.872) (-710.483) -- 0:00:14
841000 -- (-706.904) (-702.078) (-708.906) [-701.780] * [-707.778] (-709.496) (-703.408) (-702.537) -- 0:00:14
841500 -- (-709.978) (-701.450) [-700.926] (-707.328) * (-707.859) (-705.320) (-703.976) [-704.679] -- 0:00:14
842000 -- (-713.364) [-708.339] (-705.067) (-704.284) * (-705.447) (-722.782) [-702.714] (-706.025) -- 0:00:14
842500 -- (-709.090) (-705.946) (-703.082) [-707.585] * (-708.581) [-703.409] (-702.992) (-709.896) -- 0:00:14
843000 -- (-708.243) (-707.745) (-703.466) [-702.368] * (-708.075) [-706.819] (-701.466) (-702.824) -- 0:00:14
843500 -- (-705.202) (-702.881) [-705.457] (-707.402) * (-712.310) [-707.836] (-705.879) (-703.351) -- 0:00:14
844000 -- (-706.745) [-702.556] (-705.664) (-708.528) * (-706.649) (-711.555) [-702.738] (-703.865) -- 0:00:14
844500 -- (-703.751) (-702.944) [-712.586] (-710.319) * [-708.895] (-705.063) (-710.651) (-711.508) -- 0:00:14
845000 -- (-702.060) (-707.127) (-716.588) [-707.779] * [-704.519] (-705.329) (-714.294) (-712.501) -- 0:00:14
Average standard deviation of split frequencies: 0.015974
845500 -- (-706.035) (-705.155) (-703.022) [-702.970] * [-705.298] (-710.654) (-704.981) (-705.741) -- 0:00:14
846000 -- (-707.131) (-706.678) [-705.824] (-700.248) * (-705.332) (-706.598) (-701.300) [-704.775] -- 0:00:14
846500 -- (-711.883) (-716.524) [-702.403] (-701.527) * (-708.935) (-706.180) (-704.021) [-705.844] -- 0:00:14
847000 -- (-706.670) (-704.961) [-705.763] (-705.494) * [-711.790] (-703.469) (-701.889) (-706.055) -- 0:00:14
847500 -- [-705.342] (-704.530) (-704.168) (-708.923) * (-702.643) (-702.283) [-702.282] (-706.324) -- 0:00:14
848000 -- [-702.185] (-712.189) (-707.820) (-710.375) * (-706.741) [-706.091] (-707.583) (-704.094) -- 0:00:14
848500 -- (-705.458) [-708.664] (-703.467) (-707.853) * (-701.614) (-705.653) [-707.569] (-707.530) -- 0:00:14
849000 -- [-704.677] (-704.486) (-701.298) (-704.849) * [-704.759] (-711.891) (-704.291) (-710.911) -- 0:00:14
849500 -- (-711.090) (-705.942) [-709.740] (-706.478) * [-705.422] (-706.291) (-708.166) (-705.260) -- 0:00:14
850000 -- [-703.902] (-707.918) (-705.405) (-712.467) * (-711.284) (-705.622) (-706.533) [-711.845] -- 0:00:14
Average standard deviation of split frequencies: 0.016994
850500 -- (-709.474) (-709.696) [-711.070] (-709.769) * (-706.809) (-707.176) [-703.453] (-701.773) -- 0:00:14
851000 -- (-704.382) (-710.254) (-705.805) [-703.158] * (-707.457) [-702.991] (-703.982) (-706.494) -- 0:00:14
851500 -- (-717.352) (-703.656) (-704.501) [-701.866] * [-704.243] (-705.021) (-704.917) (-707.936) -- 0:00:13
852000 -- (-706.538) (-710.312) [-703.393] (-702.985) * [-700.147] (-699.015) (-706.041) (-707.892) -- 0:00:13
852500 -- (-710.553) [-706.494] (-704.509) (-712.760) * (-703.350) (-699.939) (-707.938) [-706.626] -- 0:00:13
853000 -- (-707.171) (-705.381) [-701.173] (-711.023) * [-703.502] (-703.553) (-704.591) (-708.526) -- 0:00:13
853500 -- (-706.597) (-705.907) (-706.206) [-704.969] * [-704.566] (-699.964) (-702.938) (-707.768) -- 0:00:13
854000 -- (-713.105) (-705.878) [-714.187] (-706.896) * (-703.230) [-701.710] (-708.554) (-708.063) -- 0:00:13
854500 -- [-703.195] (-709.712) (-706.974) (-705.219) * (-703.423) (-708.019) (-713.847) [-704.731] -- 0:00:13
855000 -- (-707.875) (-700.134) (-707.067) [-709.299] * (-705.384) (-703.233) [-704.898] (-704.050) -- 0:00:13
Average standard deviation of split frequencies: 0.016154
855500 -- (-716.967) (-705.816) [-710.548] (-714.875) * (-706.353) (-707.056) [-700.395] (-702.391) -- 0:00:13
856000 -- (-708.764) [-702.825] (-702.581) (-702.128) * [-707.505] (-704.328) (-704.718) (-699.004) -- 0:00:13
856500 -- (-705.904) [-707.941] (-703.643) (-702.090) * (-702.652) (-707.724) (-708.364) [-706.676] -- 0:00:13
857000 -- (-710.692) (-707.358) [-706.928] (-704.966) * (-712.679) (-710.460) [-707.422] (-708.115) -- 0:00:13
857500 -- [-708.667] (-712.419) (-709.021) (-702.180) * (-707.222) (-707.240) (-710.201) [-710.256] -- 0:00:13
858000 -- (-703.104) (-704.275) (-710.140) [-701.981] * (-716.783) (-715.024) (-704.222) [-708.892] -- 0:00:13
858500 -- (-704.582) (-707.082) (-707.326) [-701.972] * (-701.998) [-706.779] (-705.214) (-712.375) -- 0:00:13
859000 -- (-708.269) (-707.338) [-703.368] (-713.573) * [-703.397] (-705.446) (-710.625) (-708.075) -- 0:00:13
859500 -- [-705.671] (-707.232) (-704.058) (-706.049) * (-706.627) (-711.484) (-707.055) [-705.363] -- 0:00:13
860000 -- (-706.103) [-700.866] (-706.657) (-704.594) * (-708.715) (-707.655) [-704.864] (-703.018) -- 0:00:13
Average standard deviation of split frequencies: 0.017892
860500 -- (-700.583) (-702.837) (-707.141) [-706.027] * (-706.111) [-708.634] (-706.923) (-704.402) -- 0:00:13
861000 -- [-703.697] (-703.286) (-714.092) (-704.686) * (-707.447) (-713.388) [-702.368] (-707.744) -- 0:00:13
861500 -- (-711.443) [-707.451] (-712.715) (-703.289) * (-712.412) (-705.518) [-709.018] (-707.281) -- 0:00:13
862000 -- (-713.064) (-708.241) [-708.675] (-706.091) * (-706.445) (-706.066) [-704.387] (-708.080) -- 0:00:12
862500 -- (-711.819) [-707.761] (-708.573) (-706.429) * (-703.571) (-707.463) [-703.440] (-706.453) -- 0:00:12
863000 -- [-704.434] (-708.304) (-710.061) (-705.686) * (-715.427) [-707.660] (-700.969) (-702.720) -- 0:00:12
863500 -- (-708.943) (-704.214) (-708.950) [-706.808] * [-703.109] (-704.228) (-706.208) (-704.995) -- 0:00:12
864000 -- (-705.611) (-705.834) (-710.428) [-708.791] * (-708.925) (-705.116) [-705.964] (-710.532) -- 0:00:12
864500 -- (-702.719) [-705.458] (-703.402) (-704.697) * (-714.336) (-719.278) [-703.643] (-709.950) -- 0:00:12
865000 -- [-704.490] (-704.633) (-704.204) (-703.653) * (-707.495) (-713.088) [-705.042] (-708.624) -- 0:00:12
Average standard deviation of split frequencies: 0.017056
865500 -- (-703.901) (-709.309) [-707.805] (-708.528) * (-705.726) [-711.127] (-703.020) (-703.525) -- 0:00:12
866000 -- (-705.336) (-704.845) (-703.294) [-704.844] * (-703.627) [-706.611] (-710.156) (-709.798) -- 0:00:12
866500 -- (-704.897) [-708.650] (-709.751) (-706.921) * [-704.542] (-705.946) (-707.391) (-707.737) -- 0:00:12
867000 -- (-709.062) (-711.758) [-703.649] (-707.209) * (-709.353) [-703.243] (-706.831) (-702.808) -- 0:00:12
867500 -- (-709.127) (-707.550) [-701.147] (-706.132) * [-702.490] (-709.221) (-709.466) (-705.021) -- 0:00:12
868000 -- (-708.979) [-700.459] (-711.791) (-706.865) * (-707.264) (-702.904) [-703.266] (-710.167) -- 0:00:12
868500 -- (-702.602) [-702.986] (-709.094) (-703.081) * (-708.444) (-703.479) (-701.964) [-704.034] -- 0:00:12
869000 -- (-703.854) (-707.283) [-705.136] (-701.623) * (-708.209) (-703.890) [-706.188] (-705.803) -- 0:00:12
869500 -- [-703.797] (-702.757) (-713.882) (-707.518) * (-699.830) (-710.062) (-709.436) [-706.647] -- 0:00:12
870000 -- (-707.480) [-703.843] (-703.584) (-706.655) * (-703.134) [-708.831] (-706.841) (-706.563) -- 0:00:12
Average standard deviation of split frequencies: 0.016604
870500 -- (-704.553) (-705.905) [-704.426] (-710.113) * [-707.150] (-711.292) (-710.101) (-703.034) -- 0:00:12
871000 -- [-700.216] (-702.845) (-704.059) (-706.722) * (-706.156) (-705.432) (-703.140) [-704.818] -- 0:00:12
871500 -- (-708.022) (-704.643) (-709.532) [-702.464] * (-705.911) (-702.519) (-702.373) [-701.959] -- 0:00:12
872000 -- (-706.536) [-702.410] (-705.505) (-710.374) * [-706.267] (-705.412) (-703.609) (-703.371) -- 0:00:12
872500 -- (-704.854) (-708.041) [-705.049] (-712.857) * (-704.435) [-709.373] (-707.176) (-702.094) -- 0:00:11
873000 -- (-705.243) [-703.637] (-705.387) (-705.937) * (-707.923) (-706.970) [-703.364] (-703.176) -- 0:00:11
873500 -- [-702.815] (-704.589) (-708.460) (-704.452) * (-704.708) (-712.409) (-706.881) [-705.056] -- 0:00:11
874000 -- (-704.656) (-708.557) (-707.159) [-706.658] * [-707.710] (-707.134) (-711.479) (-708.195) -- 0:00:11
874500 -- [-704.721] (-705.291) (-703.743) (-702.235) * (-704.280) (-708.980) [-703.753] (-707.871) -- 0:00:11
875000 -- (-717.894) [-702.139] (-704.780) (-713.310) * [-705.497] (-704.641) (-706.420) (-704.845) -- 0:00:11
Average standard deviation of split frequencies: 0.016503
875500 -- (-704.219) (-705.391) [-700.254] (-706.822) * (-702.978) (-703.752) (-704.615) [-712.261] -- 0:00:11
876000 -- (-705.367) (-705.002) [-701.863] (-706.050) * [-704.458] (-703.757) (-704.499) (-703.966) -- 0:00:11
876500 -- (-710.568) (-710.805) (-713.094) [-701.342] * (-701.907) (-707.003) (-706.297) [-701.675] -- 0:00:11
877000 -- (-713.092) [-704.207] (-705.666) (-706.054) * [-705.817] (-707.071) (-705.941) (-704.150) -- 0:00:11
877500 -- (-712.779) [-705.549] (-704.939) (-702.564) * [-705.629] (-699.643) (-711.098) (-706.045) -- 0:00:11
878000 -- (-713.664) [-703.408] (-698.429) (-703.330) * (-701.320) (-704.429) (-708.901) [-702.763] -- 0:00:11
878500 -- (-703.396) (-709.277) (-710.651) [-706.706] * (-704.551) [-701.597] (-704.295) (-702.074) -- 0:00:11
879000 -- (-709.456) (-703.545) (-707.500) [-707.413] * [-702.067] (-704.176) (-705.946) (-710.036) -- 0:00:11
879500 -- (-704.035) (-714.528) [-709.873] (-701.508) * [-700.953] (-713.984) (-709.621) (-704.241) -- 0:00:11
880000 -- (-702.386) [-705.868] (-710.468) (-705.497) * (-703.553) (-704.924) (-704.044) [-708.045] -- 0:00:11
Average standard deviation of split frequencies: 0.016058
880500 -- [-700.558] (-709.584) (-712.209) (-705.683) * (-707.625) [-703.443] (-708.300) (-705.126) -- 0:00:11
881000 -- (-712.618) [-705.922] (-705.861) (-702.711) * (-709.499) (-702.156) [-710.265] (-703.952) -- 0:00:11
881500 -- (-702.086) [-705.517] (-703.206) (-713.870) * (-710.512) (-706.112) [-705.622] (-707.302) -- 0:00:11
882000 -- (-704.257) (-707.799) (-707.212) [-700.810] * [-709.402] (-710.162) (-701.162) (-706.275) -- 0:00:11
882500 -- (-704.657) (-706.918) [-707.301] (-702.932) * (-709.469) (-711.773) (-707.212) [-700.721] -- 0:00:11
883000 -- (-702.675) [-701.495] (-704.369) (-709.313) * (-711.129) [-704.797] (-702.011) (-703.804) -- 0:00:10
883500 -- [-703.776] (-711.109) (-708.685) (-710.296) * (-709.288) (-701.147) (-708.020) [-709.020] -- 0:00:10
884000 -- (-705.546) (-703.542) [-708.425] (-703.667) * (-707.755) [-704.866] (-707.264) (-704.144) -- 0:00:10
884500 -- (-710.690) [-704.881] (-704.036) (-706.850) * (-702.310) [-705.337] (-706.171) (-701.941) -- 0:00:10
885000 -- (-704.324) (-705.353) [-706.843] (-709.565) * [-707.750] (-708.097) (-700.256) (-706.030) -- 0:00:10
Average standard deviation of split frequencies: 0.015962
885500 -- (-700.140) (-709.788) (-704.990) [-705.682] * (-705.755) [-707.524] (-704.647) (-708.346) -- 0:00:10
886000 -- (-701.377) (-706.309) [-704.674] (-703.803) * (-704.147) [-709.114] (-703.655) (-708.054) -- 0:00:10
886500 -- (-700.734) [-702.722] (-705.174) (-703.272) * (-704.066) [-705.991] (-709.195) (-700.691) -- 0:00:10
887000 -- (-704.305) (-705.867) [-706.543] (-706.311) * (-704.995) [-707.942] (-702.359) (-704.415) -- 0:00:10
887500 -- (-701.718) (-705.919) [-705.878] (-708.480) * (-704.848) (-701.113) [-703.039] (-711.685) -- 0:00:10
888000 -- [-701.306] (-705.482) (-707.044) (-708.269) * (-706.723) [-704.508] (-708.010) (-705.890) -- 0:00:10
888500 -- (-701.292) (-702.097) [-705.642] (-706.039) * [-703.656] (-705.443) (-707.695) (-706.609) -- 0:00:10
889000 -- (-703.585) (-704.845) (-709.656) [-704.357] * (-707.758) (-705.528) (-704.729) [-708.155] -- 0:00:10
889500 -- (-705.387) [-702.997] (-712.962) (-708.178) * (-710.286) [-704.482] (-705.376) (-707.868) -- 0:00:10
890000 -- [-703.108] (-711.806) (-705.748) (-705.306) * (-703.280) [-703.950] (-708.232) (-704.360) -- 0:00:10
Average standard deviation of split frequencies: 0.016937
890500 -- (-702.797) (-702.685) (-708.361) [-701.447] * (-706.822) [-701.973] (-702.975) (-709.495) -- 0:00:10
891000 -- (-705.038) (-706.149) (-712.392) [-707.917] * [-707.279] (-701.369) (-705.362) (-701.125) -- 0:00:10
891500 -- [-703.826] (-701.460) (-699.887) (-705.116) * [-704.102] (-705.273) (-709.317) (-705.984) -- 0:00:10
892000 -- (-704.552) (-706.883) [-701.000] (-704.162) * (-703.820) [-701.280] (-704.077) (-702.937) -- 0:00:10
892500 -- (-707.902) (-713.524) [-700.708] (-705.498) * (-706.417) (-705.333) (-703.453) [-702.035] -- 0:00:10
893000 -- (-707.271) (-703.463) (-702.721) [-705.534] * (-708.559) (-704.190) [-701.437] (-708.201) -- 0:00:10
893500 -- (-706.140) (-701.740) (-708.527) [-705.325] * (-706.211) (-707.223) [-701.194] (-703.112) -- 0:00:10
894000 -- (-712.200) (-706.573) [-702.544] (-720.134) * (-705.787) (-709.568) (-705.230) [-707.720] -- 0:00:09
894500 -- (-703.302) [-704.044] (-702.843) (-712.023) * (-711.198) (-703.372) (-701.697) [-707.614] -- 0:00:09
895000 -- [-706.866] (-708.426) (-709.452) (-709.754) * (-704.991) (-706.865) [-701.120] (-704.213) -- 0:00:09
Average standard deviation of split frequencies: 0.016485
895500 -- (-701.953) (-708.447) (-703.202) [-707.392] * (-711.539) (-705.744) [-705.152] (-707.463) -- 0:00:09
896000 -- [-705.909] (-709.204) (-704.944) (-709.991) * [-707.780] (-702.085) (-703.631) (-713.180) -- 0:00:09
896500 -- (-704.349) [-703.940] (-707.356) (-714.622) * (-712.882) (-705.881) [-702.930] (-708.050) -- 0:00:09
897000 -- (-703.154) (-702.142) [-702.279] (-711.838) * (-702.871) (-703.282) [-701.543] (-708.245) -- 0:00:09
897500 -- (-711.607) [-706.040] (-710.908) (-704.060) * (-711.157) (-708.242) [-710.011] (-708.313) -- 0:00:09
898000 -- (-704.394) [-703.166] (-712.078) (-706.479) * (-708.263) (-704.059) (-704.332) [-702.831] -- 0:00:09
898500 -- (-713.649) (-704.260) [-710.114] (-701.817) * (-702.844) (-706.801) (-708.792) [-708.293] -- 0:00:09
899000 -- [-708.875] (-703.845) (-701.896) (-703.653) * (-710.735) [-707.806] (-706.689) (-708.711) -- 0:00:09
899500 -- (-701.591) [-708.115] (-704.990) (-706.346) * (-709.535) (-707.092) [-704.786] (-708.568) -- 0:00:09
900000 -- [-709.980] (-711.788) (-703.302) (-706.275) * (-709.133) [-706.942] (-702.210) (-712.282) -- 0:00:09
Average standard deviation of split frequencies: 0.016749
900500 -- (-711.175) (-707.493) [-699.864] (-705.938) * [-702.221] (-706.330) (-705.680) (-704.650) -- 0:00:09
901000 -- (-704.579) (-704.804) (-707.650) [-704.723] * (-707.319) [-706.324] (-712.692) (-710.157) -- 0:00:09
901500 -- (-701.728) [-709.963] (-705.728) (-704.787) * [-706.557] (-705.398) (-706.475) (-713.299) -- 0:00:09
902000 -- (-709.893) (-702.681) [-705.629] (-706.581) * (-707.979) (-708.972) [-703.164] (-707.273) -- 0:00:09
902500 -- [-704.707] (-704.242) (-708.920) (-704.695) * [-703.264] (-703.581) (-705.434) (-701.669) -- 0:00:09
903000 -- (-716.474) (-702.173) (-706.639) [-703.854] * [-705.387] (-714.792) (-704.475) (-703.347) -- 0:00:09
903500 -- (-710.793) [-702.572] (-706.871) (-701.674) * [-708.409] (-702.111) (-701.705) (-706.434) -- 0:00:09
904000 -- (-710.263) (-703.527) [-706.772] (-704.340) * (-709.683) (-705.279) [-707.018] (-706.279) -- 0:00:09
904500 -- (-705.825) (-709.113) (-718.896) [-702.947] * (-706.073) (-705.912) (-709.156) [-708.936] -- 0:00:08
905000 -- (-713.228) [-706.695] (-709.195) (-708.033) * [-707.711] (-707.356) (-706.263) (-707.439) -- 0:00:08
Average standard deviation of split frequencies: 0.017344
905500 -- (-705.523) [-708.117] (-706.544) (-703.580) * (-713.672) (-710.077) [-702.941] (-711.297) -- 0:00:08
906000 -- (-704.850) (-709.839) (-717.906) [-710.317] * [-704.527] (-710.385) (-703.557) (-705.530) -- 0:00:08
906500 -- (-707.923) [-702.788] (-705.205) (-705.057) * (-705.821) (-708.801) (-707.828) [-704.436] -- 0:00:08
907000 -- (-701.364) [-704.702] (-712.170) (-703.649) * [-704.776] (-707.605) (-709.398) (-704.021) -- 0:00:08
907500 -- [-705.476] (-715.248) (-704.950) (-705.173) * (-709.832) [-703.627] (-705.508) (-704.877) -- 0:00:08
908000 -- (-704.029) (-713.245) (-706.427) [-705.663] * (-703.915) (-705.002) [-705.351] (-707.365) -- 0:00:08
908500 -- (-710.693) (-713.173) (-705.484) [-704.591] * (-707.422) [-702.619] (-707.638) (-712.904) -- 0:00:08
909000 -- [-708.904] (-706.881) (-705.162) (-705.871) * (-702.492) (-704.892) [-709.985] (-708.014) -- 0:00:08
909500 -- (-712.117) [-704.434] (-709.040) (-709.242) * (-704.458) (-708.818) [-704.611] (-706.719) -- 0:00:08
910000 -- (-716.241) (-706.741) (-710.817) [-707.235] * (-706.766) (-706.513) (-705.059) [-704.713] -- 0:00:08
Average standard deviation of split frequencies: 0.017600
910500 -- (-708.881) [-704.634] (-708.210) (-701.201) * [-707.048] (-708.484) (-710.946) (-705.499) -- 0:00:08
911000 -- (-704.809) [-707.706] (-707.595) (-703.782) * (-703.197) [-708.549] (-706.085) (-705.607) -- 0:00:08
911500 -- (-711.673) (-717.881) [-715.315] (-704.390) * (-709.317) [-705.168] (-711.711) (-710.112) -- 0:00:08
912000 -- (-707.680) [-707.248] (-711.976) (-713.480) * (-707.483) (-705.281) (-712.611) [-706.991] -- 0:00:08
912500 -- (-703.462) [-707.728] (-709.897) (-707.858) * (-708.139) (-710.694) [-704.719] (-703.838) -- 0:00:08
913000 -- (-703.894) (-707.492) [-709.508] (-705.005) * (-708.469) (-704.474) (-706.604) [-703.079] -- 0:00:08
913500 -- (-710.703) (-708.403) (-704.915) [-710.927] * (-707.819) [-703.437] (-702.733) (-700.189) -- 0:00:08
914000 -- (-704.469) [-706.248] (-707.183) (-713.225) * (-712.285) (-715.298) (-703.830) [-707.749] -- 0:00:08
914500 -- (-701.812) (-702.613) (-707.700) [-703.680] * [-716.935] (-705.676) (-710.943) (-707.347) -- 0:00:08
915000 -- [-705.112] (-707.878) (-704.389) (-708.008) * (-708.209) [-704.061] (-700.389) (-711.249) -- 0:00:07
Average standard deviation of split frequencies: 0.016811
915500 -- (-715.119) [-702.825] (-709.272) (-707.121) * (-709.698) [-705.354] (-703.639) (-704.871) -- 0:00:07
916000 -- (-710.582) (-706.437) (-709.284) [-706.335] * (-712.257) (-706.529) [-704.574] (-710.818) -- 0:00:07
916500 -- [-700.749] (-713.298) (-711.100) (-706.913) * (-704.414) (-703.554) [-703.051] (-708.194) -- 0:00:07
917000 -- [-704.510] (-704.665) (-704.557) (-703.212) * (-701.105) (-716.500) (-710.398) [-699.900] -- 0:00:07
917500 -- (-710.658) [-704.814] (-708.682) (-701.352) * (-705.036) [-709.397] (-709.738) (-708.573) -- 0:00:07
918000 -- (-707.620) [-706.876] (-708.260) (-706.668) * (-707.152) (-714.003) [-704.715] (-705.568) -- 0:00:07
918500 -- (-700.640) [-709.908] (-708.287) (-705.018) * (-708.284) (-701.618) [-705.724] (-706.139) -- 0:00:07
919000 -- [-704.525] (-698.137) (-705.857) (-703.258) * (-712.745) [-708.745] (-713.233) (-709.323) -- 0:00:07
919500 -- (-702.127) [-699.620] (-709.723) (-707.152) * (-705.587) [-705.096] (-708.742) (-707.296) -- 0:00:07
920000 -- (-711.479) (-705.744) [-703.738] (-711.325) * [-702.896] (-707.648) (-704.390) (-702.913) -- 0:00:07
Average standard deviation of split frequencies: 0.017409
920500 -- (-708.832) (-706.245) [-706.421] (-711.491) * (-712.591) (-708.178) (-706.193) [-708.875] -- 0:00:07
921000 -- [-710.387] (-701.742) (-701.759) (-709.277) * (-702.781) (-706.584) (-706.494) [-705.248] -- 0:00:07
921500 -- (-707.718) (-716.072) [-701.817] (-703.004) * (-707.420) (-704.699) [-705.379] (-702.447) -- 0:00:07
922000 -- (-707.179) (-704.254) [-701.368] (-703.461) * (-704.507) (-710.338) (-710.467) [-703.677] -- 0:00:07
922500 -- [-701.894] (-703.882) (-712.537) (-704.471) * (-704.887) [-706.977] (-700.821) (-703.129) -- 0:00:07
923000 -- (-704.178) [-700.983] (-713.277) (-708.006) * [-701.799] (-706.686) (-701.706) (-703.730) -- 0:00:07
923500 -- [-703.456] (-707.661) (-711.338) (-707.987) * (-708.744) [-702.766] (-703.523) (-700.126) -- 0:00:07
924000 -- (-704.979) [-704.862] (-707.583) (-708.952) * [-701.257] (-705.042) (-703.403) (-713.399) -- 0:00:07
924500 -- (-702.868) [-703.588] (-708.441) (-707.022) * (-705.330) [-703.873] (-701.774) (-708.582) -- 0:00:07
925000 -- (-706.816) (-708.176) (-712.422) [-703.705] * [-712.352] (-701.311) (-700.479) (-702.593) -- 0:00:07
Average standard deviation of split frequencies: 0.016969
925500 -- (-713.755) (-706.738) (-711.752) [-705.954] * (-707.507) (-705.831) [-702.783] (-709.282) -- 0:00:07
926000 -- (-712.669) [-706.546] (-710.894) (-704.118) * (-707.662) [-707.428] (-700.771) (-704.746) -- 0:00:06
926500 -- (-710.640) (-703.764) (-710.477) [-710.679] * (-708.013) [-702.837] (-707.031) (-704.963) -- 0:00:06
927000 -- (-705.694) (-702.361) (-715.062) [-711.039] * (-705.763) [-705.721] (-707.771) (-706.752) -- 0:00:06
927500 -- (-705.246) [-705.436] (-710.816) (-707.850) * [-705.026] (-704.804) (-709.138) (-702.560) -- 0:00:06
928000 -- (-702.628) [-701.694] (-710.349) (-712.100) * (-704.249) [-704.727] (-708.489) (-708.336) -- 0:00:06
928500 -- (-706.027) (-705.517) (-712.958) [-703.796] * [-707.569] (-707.075) (-706.145) (-700.638) -- 0:00:06
929000 -- (-702.243) (-706.144) [-705.946] (-707.830) * [-708.895] (-709.850) (-711.556) (-705.994) -- 0:00:06
929500 -- (-704.703) [-704.081] (-709.895) (-703.974) * (-704.896) [-705.189] (-711.743) (-704.237) -- 0:00:06
930000 -- (-702.277) [-705.331] (-708.955) (-703.740) * (-703.545) [-706.309] (-709.014) (-704.629) -- 0:00:06
Average standard deviation of split frequencies: 0.018573
930500 -- (-709.412) (-706.595) [-708.330] (-705.491) * (-705.542) (-702.581) (-708.494) [-704.549] -- 0:00:06
931000 -- (-706.636) [-703.415] (-702.477) (-702.991) * (-705.487) (-711.474) (-704.234) [-704.705] -- 0:00:06
931500 -- (-704.843) [-701.840] (-704.239) (-708.326) * (-707.101) (-707.096) (-712.224) [-705.474] -- 0:00:06
932000 -- (-710.922) (-706.305) (-702.596) [-704.823] * (-706.179) (-705.367) (-709.580) [-702.490] -- 0:00:06
932500 -- (-703.813) (-707.069) (-706.408) [-709.469] * (-704.664) [-703.713] (-706.982) (-702.176) -- 0:00:06
933000 -- [-703.498] (-708.479) (-710.153) (-708.604) * (-701.738) [-703.980] (-712.159) (-707.949) -- 0:00:06
933500 -- (-705.774) (-702.634) (-707.964) [-703.954] * (-706.056) (-705.897) [-704.226] (-704.659) -- 0:00:06
934000 -- (-702.379) (-700.451) [-701.486] (-708.699) * [-703.258] (-704.467) (-708.824) (-704.220) -- 0:00:06
934500 -- (-711.375) (-701.458) [-704.133] (-713.274) * (-705.536) (-711.086) (-706.485) [-706.136] -- 0:00:06
935000 -- (-716.932) [-704.339] (-702.986) (-707.207) * (-702.139) [-706.114] (-710.835) (-710.151) -- 0:00:06
Average standard deviation of split frequencies: 0.018467
935500 -- (-714.805) [-708.938] (-708.806) (-704.522) * (-703.072) (-710.033) [-702.352] (-711.596) -- 0:00:06
936000 -- (-715.390) [-706.561] (-706.601) (-702.644) * [-703.796] (-705.266) (-700.908) (-709.022) -- 0:00:06
936500 -- (-712.441) (-705.314) (-703.633) [-706.911] * (-707.273) (-706.560) (-704.653) [-708.757] -- 0:00:05
937000 -- (-709.272) (-706.316) (-710.275) [-704.724] * (-709.128) (-703.454) [-704.484] (-709.583) -- 0:00:05
937500 -- (-706.400) (-703.095) (-709.791) [-706.303] * (-707.944) (-714.599) [-708.681] (-706.661) -- 0:00:05
938000 -- (-711.189) (-708.234) [-706.751] (-704.332) * (-705.876) (-705.966) (-705.567) [-704.965] -- 0:00:05
938500 -- (-705.446) (-702.906) [-707.031] (-703.643) * [-704.203] (-705.207) (-703.795) (-709.583) -- 0:00:05
939000 -- (-704.329) (-699.190) (-706.512) [-705.549] * (-702.277) (-706.211) (-718.548) [-706.785] -- 0:00:05
939500 -- (-703.802) (-707.754) (-712.718) [-701.364] * (-703.460) (-705.872) (-707.956) [-712.935] -- 0:00:05
940000 -- (-708.158) [-702.272] (-703.527) (-710.585) * (-702.648) (-706.529) (-706.046) [-703.967] -- 0:00:05
Average standard deviation of split frequencies: 0.016705
940500 -- (-707.898) (-704.735) [-703.599] (-710.221) * (-708.351) (-709.286) (-707.583) [-706.315] -- 0:00:05
941000 -- [-702.354] (-704.906) (-706.840) (-705.010) * (-710.207) (-707.435) (-703.795) [-703.424] -- 0:00:05
941500 -- (-704.429) (-702.827) (-701.289) [-705.824] * (-702.060) (-713.334) (-708.933) [-705.814] -- 0:00:05
942000 -- [-700.047] (-706.870) (-699.356) (-709.139) * (-710.914) (-711.327) (-706.535) [-702.954] -- 0:00:05
942500 -- [-704.789] (-708.778) (-704.277) (-702.059) * (-709.019) (-706.005) (-709.477) [-703.244] -- 0:00:05
943000 -- [-707.947] (-710.370) (-704.878) (-708.275) * (-712.462) [-704.542] (-705.247) (-706.756) -- 0:00:05
943500 -- (-706.721) (-704.718) [-708.096] (-719.128) * (-711.547) [-704.610] (-705.989) (-703.173) -- 0:00:05
944000 -- [-703.790] (-707.858) (-708.018) (-704.785) * (-712.115) (-708.108) (-702.335) [-706.411] -- 0:00:05
944500 -- (-712.803) (-709.585) [-704.781] (-704.665) * (-705.485) (-708.111) (-700.092) [-709.135] -- 0:00:05
945000 -- (-702.194) [-702.267] (-704.809) (-705.672) * (-702.434) [-702.010] (-707.627) (-707.153) -- 0:00:05
Average standard deviation of split frequencies: 0.017939
945500 -- (-711.149) [-702.853] (-712.833) (-708.583) * (-711.705) (-706.670) (-708.791) [-700.892] -- 0:00:05
946000 -- (-707.099) [-704.284] (-704.315) (-705.925) * (-706.993) (-702.595) (-706.484) [-709.731] -- 0:00:05
946500 -- (-710.938) [-704.335] (-704.334) (-707.539) * (-705.887) [-698.890] (-708.477) (-714.924) -- 0:00:05
947000 -- (-701.872) [-704.819] (-706.178) (-713.676) * (-706.475) (-704.865) (-710.977) [-704.675] -- 0:00:04
947500 -- (-709.916) (-708.435) [-708.071] (-707.189) * (-711.132) [-700.374] (-708.038) (-707.235) -- 0:00:04
948000 -- [-702.883] (-704.596) (-706.506) (-708.674) * [-706.125] (-700.741) (-712.703) (-704.878) -- 0:00:04
948500 -- (-709.191) [-705.141] (-702.868) (-706.726) * (-703.240) [-708.757] (-715.696) (-712.569) -- 0:00:04
949000 -- (-708.832) (-701.787) (-703.366) [-710.654] * (-703.467) [-702.217] (-703.524) (-709.561) -- 0:00:04
949500 -- [-708.366] (-712.887) (-706.508) (-704.798) * (-704.498) (-705.140) (-714.367) [-704.798] -- 0:00:04
950000 -- (-705.284) [-702.812] (-707.079) (-702.622) * (-701.809) (-706.973) [-706.172] (-702.551) -- 0:00:04
Average standard deviation of split frequencies: 0.017851
950500 -- (-705.810) [-701.003] (-707.247) (-706.406) * [-702.711] (-709.339) (-706.732) (-709.915) -- 0:00:04
951000 -- (-711.064) (-702.483) (-707.809) [-707.604] * [-702.070] (-700.946) (-704.256) (-711.020) -- 0:00:04
951500 -- [-709.537] (-704.955) (-707.100) (-701.850) * [-709.641] (-703.189) (-709.482) (-707.528) -- 0:00:04
952000 -- [-709.005] (-703.121) (-703.205) (-706.831) * (-702.404) [-704.355] (-706.655) (-704.551) -- 0:00:04
952500 -- (-703.775) (-703.528) (-709.696) [-699.099] * [-710.852] (-710.863) (-705.487) (-700.470) -- 0:00:04
953000 -- (-705.658) [-703.391] (-710.941) (-706.091) * (-707.765) [-704.321] (-709.308) (-703.177) -- 0:00:04
953500 -- (-707.560) [-702.653] (-708.612) (-704.586) * (-708.802) (-700.854) (-707.237) [-707.023] -- 0:00:04
954000 -- [-705.454] (-710.543) (-710.306) (-704.524) * (-719.077) [-707.045] (-703.282) (-702.626) -- 0:00:04
954500 -- (-705.574) (-709.968) [-702.866] (-706.157) * (-709.346) [-703.497] (-705.723) (-706.616) -- 0:00:04
955000 -- (-711.178) (-709.373) (-707.764) [-706.313] * (-710.589) (-707.129) [-704.582] (-706.148) -- 0:00:04
Average standard deviation of split frequencies: 0.017423
955500 -- (-709.367) (-704.907) (-713.324) [-705.227] * (-710.064) [-703.087] (-703.567) (-711.786) -- 0:00:04
956000 -- (-707.482) [-707.009] (-702.924) (-704.616) * (-706.224) (-705.998) (-705.478) [-705.445] -- 0:00:04
956500 -- (-708.713) [-707.505] (-703.321) (-707.459) * [-703.191] (-705.606) (-706.969) (-703.962) -- 0:00:04
957000 -- (-705.993) (-706.077) (-710.706) [-709.852] * (-704.717) (-703.491) (-707.209) [-706.929] -- 0:00:04
957500 -- [-703.460] (-705.498) (-703.163) (-701.611) * [-705.932] (-703.317) (-703.816) (-715.292) -- 0:00:03
958000 -- (-705.961) (-706.752) (-703.385) [-701.697] * [-703.865] (-711.220) (-702.904) (-711.401) -- 0:00:03
958500 -- (-709.671) (-710.616) (-702.222) [-701.207] * (-709.692) (-703.307) (-705.392) [-705.213] -- 0:00:03
959000 -- (-706.537) [-705.157] (-707.061) (-706.346) * (-710.699) [-705.374] (-710.155) (-711.285) -- 0:00:03
959500 -- (-710.325) [-709.486] (-706.731) (-710.486) * (-704.757) (-708.796) [-701.018] (-712.098) -- 0:00:03
960000 -- (-704.195) (-708.051) (-713.493) [-710.295] * (-705.876) [-705.591] (-703.166) (-709.486) -- 0:00:03
Average standard deviation of split frequencies: 0.015703
960500 -- (-703.297) (-708.781) [-703.818] (-702.236) * (-711.706) [-707.275] (-709.820) (-708.827) -- 0:00:03
961000 -- (-706.497) [-700.097] (-710.975) (-707.431) * [-710.534] (-704.822) (-714.855) (-707.361) -- 0:00:03
961500 -- (-706.309) [-703.267] (-708.420) (-704.985) * (-710.512) (-709.898) (-707.528) [-703.212] -- 0:00:03
962000 -- (-718.032) (-708.183) (-704.063) [-707.847] * (-703.097) (-704.058) (-717.440) [-706.679] -- 0:00:03
962500 -- (-707.137) (-705.748) (-706.906) [-702.243] * (-706.934) (-704.537) [-706.723] (-708.216) -- 0:00:03
963000 -- (-704.680) (-709.259) [-712.059] (-708.932) * [-711.259] (-705.564) (-707.374) (-705.704) -- 0:00:03
963500 -- (-707.195) (-705.386) [-704.073] (-706.896) * (-709.623) (-702.814) (-705.801) [-707.699] -- 0:00:03
964000 -- (-704.230) (-709.050) [-710.597] (-704.319) * (-705.447) (-709.736) (-704.229) [-709.815] -- 0:00:03
964500 -- (-706.733) [-715.656] (-709.250) (-705.325) * (-703.883) (-707.224) [-703.920] (-712.782) -- 0:00:03
965000 -- (-709.957) [-699.935] (-714.332) (-704.211) * [-707.686] (-709.468) (-707.032) (-710.774) -- 0:00:03
Average standard deviation of split frequencies: 0.015941
965500 -- (-701.405) (-703.938) (-711.822) [-700.614] * (-710.774) (-705.143) (-707.864) [-708.369] -- 0:00:03
966000 -- [-704.020] (-708.484) (-706.139) (-701.775) * [-709.158] (-708.339) (-704.188) (-708.986) -- 0:00:03
966500 -- (-707.708) [-705.764] (-701.954) (-708.352) * [-709.679] (-705.226) (-704.198) (-712.596) -- 0:00:03
967000 -- [-705.726] (-708.778) (-702.752) (-704.121) * [-703.988] (-708.920) (-704.993) (-705.937) -- 0:00:03
967500 -- (-709.863) (-705.844) [-703.725] (-708.382) * (-705.949) (-706.560) [-702.900] (-708.797) -- 0:00:03
968000 -- (-707.977) (-704.239) (-704.658) [-704.327] * (-709.454) (-703.327) (-707.871) [-707.704] -- 0:00:03
968500 -- (-707.337) (-707.775) [-703.549] (-703.465) * (-708.078) (-707.395) [-705.724] (-703.199) -- 0:00:02
969000 -- (-705.729) [-707.915] (-704.921) (-705.054) * (-705.305) (-712.364) (-718.256) [-705.055] -- 0:00:02
969500 -- (-709.712) [-704.136] (-707.442) (-706.924) * (-707.466) (-708.819) (-707.884) [-708.700] -- 0:00:02
970000 -- (-713.533) (-704.672) [-704.802] (-707.290) * [-699.416] (-717.859) (-710.552) (-708.088) -- 0:00:02
Average standard deviation of split frequencies: 0.015217
970500 -- (-708.623) [-705.330] (-707.886) (-709.224) * (-709.434) [-711.383] (-703.852) (-709.415) -- 0:00:02
971000 -- (-710.701) (-705.363) [-704.638] (-710.539) * (-708.184) (-703.907) [-705.402] (-707.522) -- 0:00:02
971500 -- (-708.773) [-705.309] (-700.880) (-713.356) * (-712.076) [-705.657] (-707.979) (-705.513) -- 0:00:02
972000 -- (-707.727) [-704.883] (-706.136) (-707.869) * [-706.291] (-702.612) (-704.310) (-712.663) -- 0:00:02
972500 -- (-705.076) [-706.431] (-703.831) (-705.103) * [-704.575] (-706.811) (-700.632) (-704.653) -- 0:00:02
973000 -- (-704.781) (-705.951) [-703.057] (-709.108) * (-703.447) (-705.627) (-708.746) [-705.888] -- 0:00:02
973500 -- [-704.374] (-711.254) (-707.244) (-709.671) * [-705.087] (-706.974) (-707.746) (-708.554) -- 0:00:02
974000 -- [-713.573] (-702.640) (-707.089) (-702.906) * [-705.409] (-705.512) (-705.426) (-706.136) -- 0:00:02
974500 -- (-708.416) [-707.261] (-703.465) (-703.936) * [-702.454] (-701.372) (-713.250) (-699.510) -- 0:00:02
975000 -- (-710.193) (-706.414) (-710.111) [-705.419] * (-708.480) [-702.018] (-705.892) (-706.245) -- 0:00:02
Average standard deviation of split frequencies: 0.014812
975500 -- [-706.659] (-707.791) (-711.054) (-705.397) * (-717.840) (-708.299) [-704.253] (-707.508) -- 0:00:02
976000 -- (-711.319) (-703.654) (-704.820) [-702.480] * (-715.341) (-708.033) [-707.610] (-708.286) -- 0:00:02
976500 -- (-705.756) (-704.516) (-701.697) [-704.840] * (-701.757) (-708.824) [-705.253] (-712.224) -- 0:00:02
977000 -- (-706.504) (-711.518) (-703.159) [-705.587] * (-704.346) [-710.101] (-708.567) (-703.151) -- 0:00:02
977500 -- (-710.494) [-706.877] (-703.581) (-711.068) * [-701.738] (-711.978) (-710.559) (-705.529) -- 0:00:02
978000 -- (-702.629) (-702.355) [-707.603] (-707.806) * (-703.378) (-707.919) [-709.617] (-715.463) -- 0:00:02
978500 -- (-702.848) (-710.549) [-703.773] (-712.137) * (-704.157) [-706.578] (-703.649) (-714.322) -- 0:00:02
979000 -- (-705.585) (-712.276) [-705.686] (-701.849) * (-706.989) (-710.157) (-702.240) [-702.051] -- 0:00:01
979500 -- (-701.780) (-711.482) (-706.055) [-708.103] * (-706.513) (-707.559) [-705.242] (-707.932) -- 0:00:01
980000 -- (-703.340) [-710.240] (-704.989) (-704.991) * (-706.259) [-704.621] (-709.650) (-710.378) -- 0:00:01
Average standard deviation of split frequencies: 0.016344
980500 -- (-712.759) (-704.493) [-704.703] (-709.924) * [-705.565] (-708.590) (-709.071) (-709.510) -- 0:00:01
981000 -- (-701.879) (-706.865) [-706.924] (-702.946) * (-709.803) (-704.880) [-704.688] (-711.877) -- 0:00:01
981500 -- (-705.081) [-702.869] (-711.990) (-704.754) * [-707.974] (-705.678) (-718.202) (-704.312) -- 0:00:01
982000 -- (-703.926) (-706.733) [-702.475] (-718.279) * (-704.372) [-701.003] (-705.690) (-708.468) -- 0:00:01
982500 -- (-706.575) (-705.386) (-704.642) [-708.601] * (-704.806) (-703.728) (-710.624) [-702.243] -- 0:00:01
983000 -- (-710.377) (-707.443) (-702.433) [-705.895] * (-711.159) [-700.602] (-715.014) (-710.089) -- 0:00:01
983500 -- (-710.789) (-705.469) [-705.341] (-707.260) * (-702.503) (-701.617) (-707.640) [-708.549] -- 0:00:01
984000 -- (-709.613) (-705.862) (-713.402) [-708.992] * (-705.009) (-704.479) (-704.121) [-699.153] -- 0:00:01
984500 -- (-714.309) [-701.282] (-702.772) (-711.760) * (-705.544) (-706.127) (-703.794) [-701.510] -- 0:00:01
985000 -- (-709.480) (-702.105) (-703.421) [-711.690] * (-708.912) (-706.997) [-703.282] (-703.317) -- 0:00:01
Average standard deviation of split frequencies: 0.015937
985500 -- (-704.993) [-707.328] (-705.287) (-713.265) * [-703.304] (-707.077) (-706.601) (-704.745) -- 0:00:01
986000 -- (-706.282) (-703.397) [-705.128] (-706.619) * (-707.996) [-706.072] (-703.831) (-702.896) -- 0:00:01
986500 -- [-704.067] (-704.448) (-707.285) (-706.798) * [-700.014] (-702.413) (-703.862) (-707.141) -- 0:00:01
987000 -- (-702.845) (-705.763) (-707.594) [-701.190] * [-703.495] (-702.971) (-711.540) (-704.700) -- 0:00:01
987500 -- (-702.695) (-707.226) [-703.237] (-705.248) * (-706.635) (-706.525) [-702.798] (-709.344) -- 0:00:01
988000 -- (-703.542) (-708.062) [-703.094] (-708.631) * (-706.053) [-704.271] (-703.226) (-703.340) -- 0:00:01
988500 -- (-708.591) (-706.779) [-699.785] (-706.653) * (-704.889) (-701.584) [-705.089] (-707.304) -- 0:00:01
989000 -- (-711.008) [-706.848] (-703.346) (-702.732) * [-707.506] (-704.391) (-705.441) (-720.868) -- 0:00:01
989500 -- [-702.717] (-701.553) (-713.056) (-709.781) * (-703.949) [-707.860] (-709.208) (-708.755) -- 0:00:00
990000 -- (-702.930) [-707.264] (-706.754) (-717.085) * (-704.403) (-705.715) (-705.574) [-705.765] -- 0:00:00
Average standard deviation of split frequencies: 0.016179
990500 -- [-706.431] (-705.430) (-704.536) (-719.717) * (-710.697) [-708.620] (-703.053) (-710.341) -- 0:00:00
991000 -- (-703.321) [-709.651] (-706.966) (-714.132) * (-713.658) (-713.195) (-702.837) [-706.256] -- 0:00:00
991500 -- [-706.381] (-704.578) (-711.970) (-707.974) * (-709.555) (-713.289) (-712.908) [-707.341] -- 0:00:00
992000 -- (-708.272) (-709.119) (-704.750) [-708.165] * (-708.746) (-717.272) [-703.823] (-705.198) -- 0:00:00
992500 -- (-704.992) [-706.985] (-703.155) (-709.632) * [-703.715] (-707.291) (-706.985) (-709.290) -- 0:00:00
993000 -- (-708.631) (-705.907) (-702.231) [-709.939] * (-704.154) [-708.507] (-707.698) (-709.281) -- 0:00:00
993500 -- (-709.234) [-703.491] (-707.853) (-700.141) * [-704.534] (-707.691) (-713.075) (-707.797) -- 0:00:00
994000 -- (-701.575) (-706.757) [-710.610] (-704.744) * [-706.013] (-701.799) (-707.157) (-707.045) -- 0:00:00
994500 -- (-718.212) [-703.489] (-703.304) (-708.956) * (-708.279) [-703.023] (-709.502) (-707.694) -- 0:00:00
995000 -- (-712.926) (-704.604) (-702.875) [-709.193] * [-708.395] (-704.096) (-702.306) (-707.914) -- 0:00:00
Average standard deviation of split frequencies: 0.015146
995500 -- (-704.951) (-706.242) (-700.808) [-707.136] * (-707.296) [-704.018] (-707.511) (-705.512) -- 0:00:00
996000 -- (-710.828) [-704.826] (-702.619) (-706.952) * (-711.365) (-705.944) (-708.396) [-705.749] -- 0:00:00
996500 -- [-704.424] (-701.298) (-704.280) (-713.125) * [-710.324] (-713.345) (-709.367) (-707.227) -- 0:00:00
997000 -- (-706.221) (-709.244) [-708.437] (-706.380) * (-704.488) (-709.452) [-702.715] (-706.053) -- 0:00:00
997500 -- [-707.419] (-706.434) (-710.283) (-713.447) * (-707.958) (-706.964) (-708.164) [-703.129] -- 0:00:00
998000 -- [-705.875] (-711.930) (-705.225) (-706.517) * [-706.998] (-708.919) (-713.807) (-708.958) -- 0:00:00
998500 -- [-701.972] (-715.740) (-706.133) (-703.266) * (-706.736) (-706.372) (-707.319) [-711.212] -- 0:00:00
999000 -- [-705.979] (-717.929) (-705.788) (-710.769) * (-708.576) (-706.939) (-711.977) [-705.015] -- 0:00:00
999500 -- [-705.756] (-717.121) (-705.356) (-709.501) * [-707.695] (-711.414) (-702.136) (-703.124) -- 0:00:00
1000000 -- (-708.445) [-711.388] (-708.017) (-709.305) * (-703.352) [-703.918] (-704.263) (-701.353) -- 0:00:00
Average standard deviation of split frequencies: 0.016017
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -708.445495 -- 12.898220
Chain 1 -- -708.445495 -- 12.898220
Chain 2 -- -711.387538 -- 13.662006
Chain 2 -- -711.387536 -- 13.662006
Chain 3 -- -708.016904 -- 13.048941
Chain 3 -- -708.016903 -- 13.048941
Chain 4 -- -709.305477 -- 11.122683
Chain 4 -- -709.305477 -- 11.122683
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -703.351557 -- 11.701639
Chain 1 -- -703.351557 -- 11.701639
Chain 2 -- -703.917515 -- 12.312830
Chain 2 -- -703.917515 -- 12.312830
Chain 3 -- -704.262675 -- 7.381429
Chain 3 -- -704.262675 -- 7.381429
Chain 4 -- -701.352663 -- 6.300438
Chain 4 -- -701.352663 -- 6.300438
Analysis completed in 1 mins 34 seconds
Analysis used 93.65 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -697.21
Likelihood of best state for "cold" chain of run 2 was -697.25
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
65.7 % ( 57 %) Dirichlet(Revmat{all})
82.7 % ( 71 %) Slider(Revmat{all})
32.6 % ( 19 %) Dirichlet(Pi{all})
33.0 % ( 27 %) Slider(Pi{all})
60.2 % ( 32 %) Multiplier(Alpha{1,2})
47.2 % ( 21 %) Multiplier(Alpha{3})
56.3 % ( 26 %) Slider(Pinvar{all})
58.4 % ( 44 %) NNI(Tau{all},V{all})
45.8 % ( 29 %) ParsSPR(Tau{all},V{all})
26.6 % ( 25 %) Multiplier(V{all})
44.4 % ( 42 %) Nodeslider(V{all})
27.2 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
66.0 % ( 59 %) Dirichlet(Revmat{all})
83.6 % ( 67 %) Slider(Revmat{all})
32.8 % ( 26 %) Dirichlet(Pi{all})
33.4 % ( 31 %) Slider(Pi{all})
60.3 % ( 18 %) Multiplier(Alpha{1,2})
47.3 % ( 15 %) Multiplier(Alpha{3})
55.7 % ( 31 %) Slider(Pinvar{all})
58.3 % ( 71 %) NNI(Tau{all},V{all})
45.6 % ( 41 %) ParsSPR(Tau{all},V{all})
26.6 % ( 23 %) Multiplier(V{all})
44.5 % ( 45 %) Nodeslider(V{all})
27.2 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 167017 0.85 0.73
3 | 165814 167288 0.86
4 | 167006 166371 166504
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 167236 0.85 0.73
3 | 166843 167073 0.87
4 | 165988 166496 166364
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -703.72
| 2 2 |
| 1 |
| 1 2 |
| 2 1 1 2 1 112 |
|2 1 2 1 1 1 |
| 1 2 2 1 11 2 2 1 11 |
| 1 2 * *2 12 22 2212 1 2 2 |
| 1 1 1 1 1 2 1 1 * * 1 1 2 2 22 * 2 |
| 1 1 2 22 1 222 1 1 2 11 2 2 |
| 2 1 2 2 2 1 2 1 1 2 11 |
|1 2 1 1 2 2 1 2|
| 2 22 12 1 1|
| 2 1 1 2 |
| 2 |
| 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -707.03
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.58 -711.18
2 -702.61 -713.04
--------------------------------------
TOTAL -702.59 -712.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.353545 0.011869 0.173850 0.567344 0.337267 1231.73 1314.19 1.000
r(A<->C){all} 0.134583 0.004993 0.017026 0.274149 0.124185 670.55 718.75 1.001
r(A<->G){all} 0.232416 0.008162 0.062889 0.400781 0.222796 564.92 604.17 1.003
r(A<->T){all} 0.077586 0.002577 0.000307 0.176311 0.066528 459.26 575.83 1.001
r(C<->G){all} 0.073809 0.003194 0.000047 0.183551 0.060621 626.64 656.34 1.000
r(C<->T){all} 0.436022 0.010450 0.247585 0.643137 0.432490 590.03 630.17 1.001
r(G<->T){all} 0.045584 0.001442 0.000028 0.118370 0.035980 655.93 790.78 1.000
pi(A){all} 0.255807 0.000489 0.213427 0.300346 0.255303 1251.73 1326.22 1.000
pi(C){all} 0.228101 0.000440 0.186222 0.266959 0.227672 1400.61 1450.81 1.000
pi(G){all} 0.242306 0.000475 0.199529 0.282988 0.242173 723.41 1112.20 1.000
pi(T){all} 0.273785 0.000535 0.225896 0.316271 0.273308 1337.89 1385.41 1.000
alpha{1,2} 0.056572 0.001991 0.000136 0.135732 0.048303 1397.36 1449.18 1.000
alpha{3} 1.548881 0.498851 0.445427 2.952872 1.443142 1486.27 1493.64 1.000
pinvar{all} 0.574638 0.010121 0.378423 0.751864 0.587031 1299.45 1346.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .*.*
6 -- .**.
7 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1469 0.489340 0.024026 0.472352 0.506329 2
6 1022 0.340440 0.009422 0.333777 0.347102 2
7 511 0.170220 0.014604 0.159893 0.180546 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/Acp53C14a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.039925 0.000346 0.007696 0.077182 0.036778 1.001 2
length{all}[2] 0.009002 0.000060 0.000007 0.024356 0.006978 1.001 2
length{all}[3] 0.017319 0.000102 0.000615 0.036563 0.015263 1.000 2
length{all}[4] 0.276421 0.010172 0.115546 0.477227 0.259147 1.000 2
length{all}[5] 0.009653 0.000060 0.000015 0.024448 0.007865 1.003 2
length{all}[6] 0.014108 0.000180 0.000026 0.039459 0.009990 0.999 2
length{all}[7] 0.007940 0.000062 0.000003 0.023488 0.005118 0.998 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.016017
Maximum standard deviation of split frequencies = 0.024026
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/---------- C1 (1)
|
|-- C2 (2)
+
|---- C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
|------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 363
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
75 patterns at 121 / 121 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
73200 bytes for conP
10200 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4); MP score: 43
0.069008 0.012992 0.031920 0.266293 0.300000 1.300000
ntime & nrate & np: 4 2 6
Bounds (np=6):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 6
lnL0 = -731.892533
Iterating by ming2
Initial: fx= 731.892533
x= 0.06901 0.01299 0.03192 0.26629 0.30000 1.30000
1 h-m-p 0.0000 0.0023 64.5087 +++CCCYC 728.467530 4 0.0015 22 | 0/6
2 h-m-p 0.0002 0.0099 468.5757 +YYCCCC 718.695593 5 0.0012 40 | 0/6
3 h-m-p 0.0002 0.0008 270.2319 +YYCYYCCC 711.311231 7 0.0007 60 | 0/6
4 h-m-p 0.0005 0.0024 63.4446 CYCCC 710.275142 4 0.0008 76 | 0/6
5 h-m-p 0.0011 0.0103 48.5161 +YCCCC 708.171234 4 0.0031 93 | 0/6
6 h-m-p 0.0028 0.0172 54.0002 +YYYCCYCCC 690.293709 8 0.0147 116 | 0/6
7 h-m-p 0.1571 0.7853 0.2100 CYCCCC 689.284741 5 0.2404 134 | 0/6
8 h-m-p 0.0721 1.4371 0.6998 YCCCC 687.354266 4 0.1198 156 | 0/6
9 h-m-p 0.2927 1.4635 0.0832 YCYCCC 686.680278 5 0.7363 179 | 0/6
10 h-m-p 0.6972 3.4860 0.0720 YCYCCC 685.561953 5 1.6429 202 | 0/6
11 h-m-p 1.6000 8.0000 0.0608 YC 684.941237 1 3.9941 218 | 0/6
12 h-m-p 1.5167 7.5837 0.1029 CCCC 684.751873 3 1.6488 239 | 0/6
13 h-m-p 1.1187 8.0000 0.1517 CYC 684.564439 2 1.2614 257 | 0/6
14 h-m-p 1.6000 8.0000 0.0719 CC 684.508815 1 1.6201 274 | 0/6
15 h-m-p 1.6000 8.0000 0.0262 CC 684.504075 1 1.4740 291 | 0/6
16 h-m-p 1.6000 8.0000 0.0008 YC 684.504012 1 1.1579 307 | 0/6
17 h-m-p 1.6000 8.0000 0.0002 C 684.504011 0 1.4891 322 | 0/6
18 h-m-p 1.6000 8.0000 0.0000 Y 684.504011 0 1.2041 337 | 0/6
19 h-m-p 1.6000 8.0000 0.0000 Y 684.504011 0 1.2075 352 | 0/6
20 h-m-p 1.6000 8.0000 0.0000 +C 684.504011 0 6.5600 368 | 0/6
21 h-m-p 1.2468 8.0000 0.0000 --Y 684.504011 0 0.0195 385
Out..
lnL = -684.504011
386 lfun, 386 eigenQcodon, 1544 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 43
0.069008 0.012992 0.031920 0.266293 2.095038 0.852877 0.192890
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.358157
np = 7
lnL0 = -686.903488
Iterating by ming2
Initial: fx= 686.903488
x= 0.06901 0.01299 0.03192 0.26629 2.09504 0.85288 0.19289
1 h-m-p 0.0000 0.0033 35.0784 +++CCC 686.577532 2 0.0006 19 | 0/7
2 h-m-p 0.0003 0.0030 74.7700 +YYCCCCC 684.966631 6 0.0013 40 | 0/7
3 h-m-p 0.0001 0.0007 189.7017 CCYC 684.636797 3 0.0001 55 | 0/7
4 h-m-p 0.0017 0.0086 12.1943 YCCC 684.580134 3 0.0009 70 | 0/7
5 h-m-p 0.0033 0.0242 3.2412 YCC 684.544965 2 0.0068 83 | 0/7
6 h-m-p 0.0063 0.0317 1.9787 YCC 684.536591 2 0.0047 96 | 0/7
7 h-m-p 0.0378 4.6054 0.2457 ++YC 684.370033 1 0.4912 109 | 0/7
8 h-m-p 0.8575 5.2896 0.1407 YYC 684.338497 2 0.7041 128 | 0/7
9 h-m-p 1.6000 8.0000 0.0102 YC 684.335356 1 1.1731 146 | 0/7
10 h-m-p 1.6000 8.0000 0.0040 YC 684.335208 1 0.9841 164 | 0/7
11 h-m-p 1.6000 8.0000 0.0020 Y 684.335204 0 0.6963 181 | 0/7
12 h-m-p 1.6000 8.0000 0.0001 Y 684.335203 0 0.9758 198 | 0/7
13 h-m-p 1.6000 8.0000 0.0000 Y 684.335203 0 0.8540 215 | 0/7
14 h-m-p 1.6000 8.0000 0.0000 C 684.335203 0 1.3248 232 | 0/7
15 h-m-p 1.6000 8.0000 0.0000 -C 684.335203 0 0.1000 250 | 0/7
16 h-m-p 0.1177 8.0000 0.0000 C 684.335203 0 0.1177 267 | 0/7
17 h-m-p 0.1227 8.0000 0.0000 -Y 684.335203 0 0.0077 285
Out..
lnL = -684.335203
286 lfun, 858 eigenQcodon, 2288 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 43
initial w for M2:NSpselection reset.
0.069008 0.012992 0.031920 0.266293 2.131243 0.983017 0.492243 0.386608 2.618112
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.658872
np = 9
lnL0 = -701.168940
Iterating by ming2
Initial: fx= 701.168940
x= 0.06901 0.01299 0.03192 0.26629 2.13124 0.98302 0.49224 0.38661 2.61811
1 h-m-p 0.0000 0.0065 29.9090 ++YCCC 701.057916 3 0.0003 21 | 0/9
2 h-m-p 0.0003 0.0062 28.3035 +CCCC 700.706693 3 0.0014 40 | 0/9
3 h-m-p 0.0005 0.0063 80.0617 YCYC 700.139582 3 0.0011 56 | 0/9
4 h-m-p 0.0008 0.0039 94.8928 ++ 695.312621 m 0.0039 68 | 1/9
5 h-m-p 0.0094 0.1960 23.3857 +YCCC 693.515784 3 0.0250 86 | 1/9
6 h-m-p 0.0780 0.3899 2.3044 YCYCCC 689.957323 5 0.1993 106 | 1/9
7 h-m-p 0.0779 0.3894 4.4637 YCCCCC 687.796077 5 0.1556 127 | 1/9
8 h-m-p 0.1924 0.9618 0.9357 +CCC 685.735454 2 0.6747 144 | 0/9
9 h-m-p 0.0006 0.0032 86.1992 ++ 685.131816 m 0.0032 164 | 1/9
10 h-m-p 0.2759 4.3938 0.6679 +YYCCC 684.753010 4 0.9011 183 | 1/9
11 h-m-p 1.6000 8.0000 0.1842 YYC 684.600792 2 1.3425 205 | 1/9
12 h-m-p 1.0332 8.0000 0.2393 YCCC 684.452305 3 1.5409 230 | 1/9
13 h-m-p 1.5811 8.0000 0.2332 CYC 684.368592 2 1.5052 253 | 1/9
14 h-m-p 1.6000 8.0000 0.0802 CCC 684.345008 2 1.3655 277 | 1/9
15 h-m-p 1.0518 8.0000 0.1041 CCC 684.335774 2 1.5826 301 | 1/9
16 h-m-p 1.6000 8.0000 0.0233 YC 684.335245 1 1.1867 322 | 1/9
17 h-m-p 1.6000 8.0000 0.0089 Y 684.335206 0 1.1824 342 | 1/9
18 h-m-p 1.6000 8.0000 0.0016 Y 684.335204 0 1.2014 362 | 1/9
19 h-m-p 1.6000 8.0000 0.0003 Y 684.335203 0 0.9731 382 | 1/9
20 h-m-p 1.6000 8.0000 0.0000 Y 684.335203 0 1.0464 402 | 1/9
21 h-m-p 1.6000 8.0000 0.0000 Y 684.335203 0 0.4000 422 | 1/9
22 h-m-p 0.6262 8.0000 0.0000 -------------C 684.335203 0 0.0000 455
Out..
lnL = -684.335203
456 lfun, 1824 eigenQcodon, 5472 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -692.158138 S = -656.568966 -28.735857
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 75 patterns 0:03
did 20 / 75 patterns 0:03
did 30 / 75 patterns 0:03
did 40 / 75 patterns 0:03
did 50 / 75 patterns 0:03
did 60 / 75 patterns 0:03
did 70 / 75 patterns 0:03
did 75 / 75 patterns 0:03
Time used: 0:03
Model 3: discrete
TREE # 1
(1, 2, 3, 4); MP score: 43
0.069008 0.012992 0.031920 0.266293 2.131243 0.186220 0.034312 0.071706 0.167375 0.255949
ntime & nrate & np: 4 4 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 11.886059
np = 10
lnL0 = -684.565891
Iterating by ming2
Initial: fx= 684.565891
x= 0.06901 0.01299 0.03192 0.26629 2.13124 0.18622 0.03431 0.07171 0.16738 0.25595
1 h-m-p 0.0000 0.0029 22.3978 ++CYC 684.515912 2 0.0002 20 | 0/10
2 h-m-p 0.0003 0.0037 13.5449 CCC 684.486745 2 0.0004 37 | 0/10
3 h-m-p 0.0004 0.0125 13.6573 +CCC 684.419814 2 0.0014 55 | 0/10
4 h-m-p 0.0021 0.0121 9.0573 YCC 684.394880 2 0.0011 71 | 0/10
5 h-m-p 0.0027 0.0167 3.6944 YCCC 684.362681 3 0.0064 89 | 0/10
6 h-m-p 0.0053 0.0265 1.8497 ++ 684.306659 m 0.0265 102 | 0/10
7 h-m-p 0.0000 0.0000 0.2320
h-m-p: 1.55538154e-18 7.77690770e-18 2.31965959e-01 684.306659
.. | 1/10
8 h-m-p 0.0000 0.0116 2.0678 ++YC 684.305977 1 0.0003 138 | 1/10
9 h-m-p 0.0002 0.1174 2.9669 ++CC 684.297234 1 0.0040 155 | 1/10
10 h-m-p 0.0009 0.0280 13.7482 YC 684.293533 1 0.0004 169 | 1/10
11 h-m-p 0.0040 0.0724 1.3443 YC 684.293123 1 0.0007 183 | 1/10
12 h-m-p 0.0034 1.0829 0.2836 +YC 684.292209 1 0.0251 198 | 1/10
13 h-m-p 0.0035 0.1303 2.0224 ++YCCC 684.279471 3 0.0397 227 | 1/10
14 h-m-p 1.6000 8.0000 0.0121 YC 684.278782 1 1.0259 241 | 1/10
15 h-m-p 1.6000 8.0000 0.0062 C 684.278726 0 2.1100 263 | 1/10
16 h-m-p 0.4790 8.0000 0.0273 +YC 684.278097 1 4.6556 287 | 1/10
17 h-m-p 0.8185 8.0000 0.1553 YC 684.277856 1 0.4334 310 | 1/10
18 h-m-p 1.0479 8.0000 0.0642 YC 684.276632 1 2.4614 333 | 0/10
19 h-m-p 1.0633 8.0000 0.1487 ---YC 684.276586 1 0.0072 359 | 0/10
20 h-m-p 0.0128 1.9590 0.0842 ++++ 684.275745 m 1.9590 384 | 1/10
21 h-m-p 1.6000 8.0000 0.0924 C 684.274745 0 0.4000 407 | 1/10
22 h-m-p 0.3067 8.0000 0.1205 +YYC 684.273692 2 1.0332 432 | 1/10
23 h-m-p 1.6000 8.0000 0.0197 CY 684.273261 1 1.7174 456 | 1/10
24 h-m-p 0.2927 8.0000 0.1158 CCC 684.273018 2 0.5482 482 | 1/10
25 h-m-p 1.6000 8.0000 0.0153 YC 684.272887 1 1.1751 505 | 1/10
26 h-m-p 1.6000 8.0000 0.0109 C 684.272863 0 1.5886 527 | 1/10
27 h-m-p 1.6000 8.0000 0.0022 Y 684.272861 0 0.7816 549 | 1/10
28 h-m-p 0.7534 8.0000 0.0023 C 684.272861 0 0.9760 571 | 1/10
29 h-m-p 1.6000 8.0000 0.0003 C 684.272861 0 2.1713 593 | 1/10
30 h-m-p 1.6000 8.0000 0.0001 Y 684.272861 0 1.1331 615 | 1/10
31 h-m-p 1.6000 8.0000 0.0000 C 684.272861 0 1.6000 637 | 1/10
32 h-m-p 1.6000 8.0000 0.0000 --------Y 684.272861 0 0.0000 667
Out..
lnL = -684.272861
668 lfun, 2672 eigenQcodon, 8016 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 43
0.069008 0.012992 0.031920 0.266293 2.115591 0.991876 1.073080
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.482134
np = 7
lnL0 = -691.060215
Iterating by ming2
Initial: fx= 691.060215
x= 0.06901 0.01299 0.03192 0.26629 2.11559 0.99188 1.07308
1 h-m-p 0.0000 0.0031 23.1961 ++CCC 691.003567 2 0.0002 18 | 0/7
2 h-m-p 0.0003 0.0038 16.4581 YCCC 690.945655 3 0.0006 33 | 0/7
3 h-m-p 0.0003 0.0501 29.4037 +YCCC 690.555437 3 0.0029 49 | 0/7
4 h-m-p 0.0012 0.0116 73.0092 +YYYCC 689.103360 4 0.0041 65 | 0/7
5 h-m-p 0.0015 0.0073 127.1427 YCYCCC 685.680468 5 0.0042 84 | 0/7
6 h-m-p 0.2949 1.7459 1.7983 CCCC 684.987387 3 0.3094 100 | 0/7
7 h-m-p 0.7413 3.7067 0.3446 YYC 684.369309 2 0.7413 112 | 0/7
8 h-m-p 0.6931 3.4653 0.2147 YYCC 684.309054 3 0.5080 133 | 0/7
9 h-m-p 1.6000 8.0000 0.0177 YC 684.300096 1 0.9445 151 | 0/7
10 h-m-p 0.7542 8.0000 0.0222 CC 684.299438 1 0.8748 170 | 0/7
11 h-m-p 1.1747 8.0000 0.0165 +YC 684.298217 1 3.9911 189 | 0/7
12 h-m-p 0.9510 8.0000 0.0695 ++ 684.288368 m 8.0000 206 | 0/7
13 h-m-p 1.6000 8.0000 0.1809 CCC 684.286153 2 1.4033 227 | 0/7
14 h-m-p 1.6000 8.0000 0.0659 C 684.285917 0 1.6000 244 | 0/7
15 h-m-p 1.6000 8.0000 0.0097 Y 684.285912 0 1.1578 261 | 0/7
16 h-m-p 1.6000 8.0000 0.0014 Y 684.285912 0 1.2025 278 | 0/7
17 h-m-p 1.6000 8.0000 0.0000 C 684.285912 0 1.5802 295 | 0/7
18 h-m-p 1.6000 8.0000 0.0000 C 684.285912 0 1.4091 312 | 0/7
19 h-m-p 1.6000 8.0000 0.0000 Y 684.285912 0 0.4000 329 | 0/7
20 h-m-p 0.6314 8.0000 0.0000 -Y 684.285912 0 0.0069 347
Out..
lnL = -684.285912
348 lfun, 3828 eigenQcodon, 13920 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 43
initial w for M8:NSbetaw>1 reset.
0.069008 0.012992 0.031920 0.266293 2.117994 0.900000 1.005788 1.981222 2.001362
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.295142
np = 9
lnL0 = -690.913109
Iterating by ming2
Initial: fx= 690.913109
x= 0.06901 0.01299 0.03192 0.26629 2.11799 0.90000 1.00579 1.98122 2.00136
1 h-m-p 0.0000 0.0028 44.4167 +++YYCCC 690.174336 4 0.0010 23 | 0/9
2 h-m-p 0.0001 0.0006 113.7408 ++ 687.937846 m 0.0006 35 | 1/9
3 h-m-p 0.0013 0.0171 16.9448 YCCC 687.670738 3 0.0028 52 | 1/9
4 h-m-p 0.0005 0.0025 44.6117 CCCC 687.539310 3 0.0005 70 | 1/9
5 h-m-p 0.0005 0.0099 44.2009 ++YCYCCC 685.633555 5 0.0069 93 | 1/9
6 h-m-p 0.0162 0.0811 8.8497 CYCYCC 684.536659 5 0.0329 114 | 1/9
7 h-m-p 0.4266 2.1330 0.6426 CCC 684.371130 2 0.3328 130 | 1/9
8 h-m-p 0.8248 8.0000 0.2593 YC 684.295987 1 0.5982 151 | 1/9
9 h-m-p 1.6000 8.0000 0.0738 C 684.293155 0 0.3798 171 | 1/9
10 h-m-p 1.3148 8.0000 0.0213 CC 684.292638 1 1.5326 193 | 1/9
11 h-m-p 0.9538 8.0000 0.0343 +CC 684.291090 1 4.1971 216 | 1/9
12 h-m-p 1.4689 8.0000 0.0979 +YC 684.286900 1 4.3798 238 | 1/9
13 h-m-p 1.6000 8.0000 0.0835 CC 684.286012 1 1.4323 260 | 1/9
14 h-m-p 1.6000 8.0000 0.0312 YC 684.285966 1 1.1075 281 | 1/9
15 h-m-p 1.6000 8.0000 0.0095 Y 684.285964 0 1.2789 301 | 1/9
16 h-m-p 1.6000 8.0000 0.0007 Y 684.285964 0 1.1186 321 | 1/9
17 h-m-p 1.6000 8.0000 0.0000 ++ 684.285964 m 8.0000 341 | 1/9
18 h-m-p 0.0814 8.0000 0.0023 ++C 684.285964 0 2.0600 363 | 1/9
19 h-m-p 1.6000 8.0000 0.0022 ++ 684.285962 m 8.0000 383 | 1/9
20 h-m-p 0.0245 1.1023 0.7042 +++ 684.285929 m 1.1023 404 | 2/9
21 h-m-p 1.0676 8.0000 0.0138 C 684.285920 0 1.0072 424 | 2/9
22 h-m-p 1.6000 8.0000 0.0010 Y 684.285920 0 1.0153 443 | 2/9
23 h-m-p 1.6000 8.0000 0.0000 --Y 684.285920 0 0.0250 464
Out..
lnL = -684.285920
465 lfun, 5580 eigenQcodon, 20460 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -691.175524 S = -656.592849 -28.184733
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 75 patterns 0:16
did 20 / 75 patterns 0:17
did 30 / 75 patterns 0:17
did 40 / 75 patterns 0:17
did 50 / 75 patterns 0:17
did 60 / 75 patterns 0:17
did 70 / 75 patterns 0:17
did 75 / 75 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=121
D_melanogaster_Acp53C14a-PB MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
D_sechellia_Acp53C14a-PB MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
D_simulans_Acp53C14a-PB MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
D_erecta_Acp53C14a-PB MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS
******::******:.::********************************
D_melanogaster_Acp53C14a-PB ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
D_sechellia_Acp53C14a-PB ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
D_simulans_Acp53C14a-PB ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
D_erecta_Acp53C14a-PB VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT
:*** ***:*******:****************.****************
D_melanogaster_Acp53C14a-PB TGVGLIRPIIAKFDSLRCFDE
D_sechellia_Acp53C14a-PB TGVGLIRPIIAKFDSLRCFDE
D_simulans_Acp53C14a-PB TGVGLIRPIIAKFDSLRCFDE
D_erecta_Acp53C14a-PB TGVGLIRPIIAKFDSLRCFEE
*******************:*
>D_melanogaster_Acp53C14a-PB ATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTATGCCA AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGAACTCT ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCGAAAAT CAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG GCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCTTTACC ACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGCTTGAG GTGCTTTGATGAG >D_sechellia_Acp53C14a-PB ATGCATTTGATTAAGATCACCTTGTTACTGAGCTTTTTGGCTTTATGCCA AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC GATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT ATAACGGCCATAAGCCTCCTATCCGATTGCGTTGACTTTCAGCCGAAACT CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG GCAAGAAGGCGATATACGATCGACCGGAATGCCTCGTCCAAACCTTTACC ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG GTGCTTTGATGAG >D_simulans_Acp53C14a-PB ATGCATTTGATTAAGATCGCCTTGTTACTGAGCTTTTTGGCTTTATGCCA AAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTATCTGC GTTGTTTGGAAGTGGTGACTGATGCCGGTGCCCTGATGATCGAGAATTCT ATAACGGCCATAAGCCTTCTATCCGATTGCGTTGACTTTCAGCCGAAACT CAAACTAACTGGTAGTATTCTCAGATTTATTAGGGTGGCCCATCAGTTTG GCAAGAAGGCGATATACGATCGGCCGGAATGCCTCGTACAAACCTTTACC ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGATAGCTTGAG GTGCTTTGATGAG >D_erecta_Acp53C14a-PB ATGCATTTGATTAAGATTGCCTTTTTACTGAGCTTTTTGGCTGTAAGCCA TAGGTCGCAAGTTCAAGCCGCAATAAGTTCGGAACTCGACCACTATCTGC GGTGTTTGGAAGTGGTGACTGATGCCGGCGCCCTGATGATCGAAAACTCC GTAACGGCCATAAGGCTCCTATCGGAATGCGTTGACTTTCAGCCCAAAAT CAAACTAACTGGCAGTATTCTAAGATTTATCAGGGTGGCCCATCAATTCG CCAAGAAGGCGATATACGATCGACCGGAATGCCTTGTCCAAACCTTTACC ACCGGAGTCGGACTGATCAGACCGATTATAGCCAAGTTTGACAGCCTGAG GTGCTTTGAGGAG
>D_melanogaster_Acp53C14a-PB MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT TGVGLIRPIIAKFDSLRCFDE >D_sechellia_Acp53C14a-PB MHLIKITLLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT TGVGLIRPIIAKFDSLRCFDE >D_simulans_Acp53C14a-PB MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS ITAISLLSDCVDFQPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT TGVGLIRPIIAKFDSLRCFDE >D_erecta_Acp53C14a-PB MHLIKIAFLLSFLAVSHRSQVQAAISSELDHYLRCLEVVTDAGALMIENS VTAIRLLSECVDFQPKIKLTGSILRFIRVAHQFAKKAIYDRPECLVQTFT TGVGLIRPIIAKFDSLRCFEE
#NEXUS
[ID: 4687896055]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_Acp53C14a-PB
D_sechellia_Acp53C14a-PB
D_simulans_Acp53C14a-PB
D_erecta_Acp53C14a-PB
;
end;
begin trees;
translate
1 D_melanogaster_Acp53C14a-PB,
2 D_sechellia_Acp53C14a-PB,
3 D_simulans_Acp53C14a-PB,
4 D_erecta_Acp53C14a-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03677795,2:0.006978356,3:0.01526317,4:0.2591469);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03677795,2:0.006978356,3:0.01526317,4:0.2591469);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.58 -711.18
2 -702.61 -713.04
--------------------------------------
TOTAL -702.59 -712.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.353545 0.011869 0.173850 0.567344 0.337267 1231.73 1314.19 1.000
r(A<->C){all} 0.134583 0.004993 0.017026 0.274149 0.124185 670.55 718.75 1.001
r(A<->G){all} 0.232416 0.008162 0.062889 0.400781 0.222796 564.92 604.17 1.003
r(A<->T){all} 0.077586 0.002577 0.000307 0.176311 0.066528 459.26 575.83 1.001
r(C<->G){all} 0.073809 0.003194 0.000047 0.183551 0.060621 626.64 656.34 1.000
r(C<->T){all} 0.436022 0.010450 0.247585 0.643137 0.432490 590.03 630.17 1.001
r(G<->T){all} 0.045584 0.001442 0.000028 0.118370 0.035980 655.93 790.78 1.000
pi(A){all} 0.255807 0.000489 0.213427 0.300346 0.255303 1251.73 1326.22 1.000
pi(C){all} 0.228101 0.000440 0.186222 0.266959 0.227672 1400.61 1450.81 1.000
pi(G){all} 0.242306 0.000475 0.199529 0.282988 0.242173 723.41 1112.20 1.000
pi(T){all} 0.273785 0.000535 0.225896 0.316271 0.273308 1337.89 1385.41 1.000
alpha{1,2} 0.056572 0.001991 0.000136 0.135732 0.048303 1397.36 1449.18 1.000
alpha{3} 1.548881 0.498851 0.445427 2.952872 1.443142 1486.27 1493.64 1.000
pinvar{all} 0.574638 0.010121 0.378423 0.751864 0.587031 1299.45 1346.50 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/Acp53D_melanogaster_Acp53C14a-PB4a-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 121
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 7 7 7 7 | Ser TCT 1 1 1 0 | Tyr TAT 1 1 1 1 | Cys TGT 2 1 1 1
TTC 0 0 0 1 | TCC 1 1 1 1 | TAC 1 1 1 1 | TGC 3 4 4 3
Leu TTA 2 2 2 1 | TCA 0 0 0 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 5 5 5 3 | TCG 2 2 2 3 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 1 1 | Pro CCT 0 0 0 0 | His CAT 2 2 2 3 | Arg CGT 0 0 1 0
CTC 4 5 4 2 | CCC 0 0 0 1 | CAC 1 1 1 1 | CGC 0 0 0 0
CTA 4 2 2 3 | CCA 0 0 0 0 | Gln CAA 4 4 4 4 | CGA 2 2 0 1
CTG 2 4 4 5 | CCG 3 3 3 2 | CAG 2 2 2 1 | CGG 0 0 1 1
------------------------------------------------------------------------------------------------------
Ile ATT 5 4 4 4 | Thr ACT 2 2 2 2 | Asn AAT 0 1 1 0 | Ser AGT 1 2 2 2
ATC 3 3 3 4 | ACC 3 4 3 3 | AAC 1 0 0 1 | AGC 4 3 3 3
ATA 5 5 5 4 | ACA 0 0 0 0 | Lys AAA 2 2 2 2 | Arg AGA 2 2 2 2
Met ATG 2 2 2 2 | ACG 1 1 1 1 | AAG 5 5 5 4 | AGG 2 2 2 4
------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 | Ala GCT 1 1 1 1 | Asp GAT 7 6 6 2 | Gly GGT 2 2 2 0
GTC 1 2 1 2 | GCC 8 7 8 8 | GAC 0 1 1 3 | GGC 1 1 1 2
GTA 1 0 1 2 | GCA 0 0 0 1 | Glu GAA 3 3 3 5 | GGA 2 2 2 2
GTG 3 3 3 3 | GCG 1 1 1 1 | GAG 2 2 2 2 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Acp53C14a-PB
position 1: T:0.20661 C:0.19835 A:0.31405 G:0.28099
position 2: T:0.38017 C:0.19008 A:0.25620 G:0.17355
position 3: T:0.27273 C:0.25620 A:0.22314 G:0.24793
Average T:0.28650 C:0.21488 A:0.26446 G:0.23416
#2: D_sechellia_Acp53C14a-PB
position 1: T:0.20661 C:0.20661 A:0.31405 G:0.27273
position 2: T:0.38017 C:0.19008 A:0.25620 G:0.17355
position 3: T:0.26446 C:0.27273 A:0.19835 G:0.26446
Average T:0.28375 C:0.22314 A:0.25620 G:0.23691
#3: D_simulans_Acp53C14a-PB
position 1: T:0.20661 C:0.20661 A:0.30579 G:0.28099
position 2: T:0.38017 C:0.19008 A:0.25620 G:0.17355
position 3: T:0.28099 C:0.25620 A:0.19008 G:0.27273
Average T:0.28926 C:0.21763 A:0.25069 G:0.24242
#4: D_erecta_Acp53C14a-PB
position 1: T:0.18182 C:0.20661 A:0.31405 G:0.29752
position 2: T:0.38017 C:0.19835 A:0.24793 G:0.17355
position 3: T:0.21488 C:0.29752 A:0.22314 G:0.26446
Average T:0.25895 C:0.23416 A:0.26171 G:0.24518
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 28 | Ser S TCT 3 | Tyr Y TAT 4 | Cys C TGT 5
TTC 1 | TCC 4 | TAC 4 | TGC 14
Leu L TTA 7 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 9 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 2 | Pro P CCT 0 | His H CAT 9 | Arg R CGT 1
CTC 15 | CCC 1 | CAC 4 | CGC 0
CTA 11 | CCA 0 | Gln Q CAA 16 | CGA 5
CTG 15 | CCG 11 | CAG 7 | CGG 2
------------------------------------------------------------------------------
Ile I ATT 17 | Thr T ACT 8 | Asn N AAT 2 | Ser S AGT 7
ATC 13 | ACC 13 | AAC 2 | AGC 13
ATA 19 | ACA 0 | Lys K AAA 8 | Arg R AGA 8
Met M ATG 8 | ACG 4 | AAG 19 | AGG 10
------------------------------------------------------------------------------
Val V GTT 8 | Ala A GCT 4 | Asp D GAT 21 | Gly G GGT 6
GTC 6 | GCC 31 | GAC 5 | GGC 5
GTA 4 | GCA 1 | Glu E GAA 14 | GGA 8
GTG 12 | GCG 4 | GAG 8 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20041 C:0.20455 A:0.31198 G:0.28306
position 2: T:0.38017 C:0.19215 A:0.25413 G:0.17355
position 3: T:0.25826 C:0.27066 A:0.20868 G:0.26240
Average T:0.27961 C:0.22245 A:0.25826 G:0.23967
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Acp53C14a-PB
D_sechellia_Acp53C14a-PB 0.0722 (0.0072 0.1002)
D_simulans_Acp53C14a-PB 0.0282 (0.0036 0.1279) 0.0744 (0.0036 0.0485)
D_erecta_Acp53C14a-PB 0.1059 (0.0370 0.3493) 0.1822 (0.0446 0.2450) 0.1378 (0.0408 0.2960)
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4); MP score: 43
lnL(ntime: 4 np: 6): -684.504011 +0.000000
5..1 5..2 5..3 5..4
0.071753 0.015518 0.028194 0.287851 2.095038 0.143412
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40332
(1: 0.071753, 2: 0.015518, 3: 0.028194, 4: 0.287851);
(D_melanogaster_Acp53C14a-PB: 0.071753, D_sechellia_Acp53C14a-PB: 0.015518, D_simulans_Acp53C14a-PB: 0.028194, D_erecta_Acp53C14a-PB: 0.287851);
Detailed output identifying parameters
kappa (ts/tv) = 2.09504
omega (dN/dS) = 0.14341
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.072 263.2 99.8 0.1434 0.0091 0.0631 2.4 6.3
5..2 0.016 263.2 99.8 0.1434 0.0020 0.0137 0.5 1.4
5..3 0.028 263.2 99.8 0.1434 0.0036 0.0248 0.9 2.5
5..4 0.288 263.2 99.8 0.1434 0.0363 0.2532 9.6 25.3
tree length for dN: 0.0509
tree length for dS: 0.3548
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 43
lnL(ntime: 4 np: 7): -684.335203 +0.000000
5..1 5..2 5..3 5..4
0.072064 0.015527 0.028226 0.290867 2.131243 0.958331 0.112473
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40668
(1: 0.072064, 2: 0.015527, 3: 0.028226, 4: 0.290867);
(D_melanogaster_Acp53C14a-PB: 0.072064, D_sechellia_Acp53C14a-PB: 0.015527, D_simulans_Acp53C14a-PB: 0.028226, D_erecta_Acp53C14a-PB: 0.290867);
Detailed output identifying parameters
kappa (ts/tv) = 2.13124
dN/dS (w) for site classes (K=2)
p: 0.95833 0.04167
w: 0.11247 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.072 263.0 100.0 0.1495 0.0094 0.0626 2.5 6.3
5..2 0.016 263.0 100.0 0.1495 0.0020 0.0135 0.5 1.3
5..3 0.028 263.0 100.0 0.1495 0.0037 0.0245 1.0 2.5
5..4 0.291 263.0 100.0 0.1495 0.0378 0.2526 9.9 25.3
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 43
lnL(ntime: 4 np: 9): -684.335203 +0.000000
5..1 5..2 5..3 5..4
0.072064 0.015527 0.028226 0.290867 2.131243 0.958331 0.018559 0.112473 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40668
(1: 0.072064, 2: 0.015527, 3: 0.028226, 4: 0.290867);
(D_melanogaster_Acp53C14a-PB: 0.072064, D_sechellia_Acp53C14a-PB: 0.015527, D_simulans_Acp53C14a-PB: 0.028226, D_erecta_Acp53C14a-PB: 0.290867);
Detailed output identifying parameters
kappa (ts/tv) = 2.13124
dN/dS (w) for site classes (K=3)
p: 0.95833 0.01856 0.02311
w: 0.11247 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.072 263.0 100.0 0.1495 0.0094 0.0626 2.5 6.3
5..2 0.016 263.0 100.0 0.1495 0.0020 0.0135 0.5 1.3
5..3 0.028 263.0 100.0 0.1495 0.0037 0.0245 1.0 2.5
5..4 0.291 263.0 100.0 0.1495 0.0378 0.2526 9.9 25.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp53C14a-PB)
Pr(w>1) post mean +- SE for w
67 I 0.541 2.099 +- 2.032
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.658 0.332 0.009 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.458 0.199 0.105 0.065 0.046 0.035 0.028 0.024 0.021 0.019
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.026
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.023 0.247
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.005 0.035 0.150 0.508
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 43
lnL(ntime: 4 np: 10): -684.272861 +0.000000
5..1 5..2 5..3 5..4
0.071982 0.015548 0.028240 0.290533 2.115591 0.505709 0.163135 0.000001 0.298148 0.298149
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40630
(1: 0.071982, 2: 0.015548, 3: 0.028240, 4: 0.290533);
(D_melanogaster_Acp53C14a-PB: 0.071982, D_sechellia_Acp53C14a-PB: 0.015548, D_simulans_Acp53C14a-PB: 0.028240, D_erecta_Acp53C14a-PB: 0.290533);
Detailed output identifying parameters
kappa (ts/tv) = 2.11559
dN/dS (w) for site classes (K=3)
p: 0.50571 0.16314 0.33116
w: 0.00000 0.29815 0.29815
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.072 263.1 99.9 0.1474 0.0093 0.0628 2.4 6.3
5..2 0.016 263.1 99.9 0.1474 0.0020 0.0136 0.5 1.4
5..3 0.028 263.1 99.9 0.1474 0.0036 0.0246 1.0 2.5
5..4 0.291 263.1 99.9 0.1474 0.0374 0.2535 9.8 25.3
Naive Empirical Bayes (NEB) analysis
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 43
lnL(ntime: 4 np: 7): -684.285912 +0.000000
5..1 5..2 5..3 5..4
0.071996 0.015542 0.028236 0.290564 2.117994 0.563435 3.170407
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40634
(1: 0.071996, 2: 0.015542, 3: 0.028236, 4: 0.290564);
(D_melanogaster_Acp53C14a-PB: 0.071996, D_sechellia_Acp53C14a-PB: 0.015542, D_simulans_Acp53C14a-PB: 0.028236, D_erecta_Acp53C14a-PB: 0.290564);
Detailed output identifying parameters
kappa (ts/tv) = 2.11799
Parameters in M7 (beta):
p = 0.56343 q = 3.17041
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00135 0.00960 0.02425 0.04537 0.07373 0.11087 0.15964 0.22566 0.32234 0.50208
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.072 263.1 99.9 0.1475 0.0093 0.0628 2.4 6.3
5..2 0.016 263.1 99.9 0.1475 0.0020 0.0136 0.5 1.4
5..3 0.028 263.1 99.9 0.1475 0.0036 0.0246 1.0 2.5
5..4 0.291 263.1 99.9 0.1475 0.0374 0.2534 9.8 25.3
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 43
lnL(ntime: 4 np: 9): -684.285920 +0.000000
5..1 5..2 5..3 5..4
0.071996 0.015542 0.028236 0.290564 2.117997 0.999990 0.563509 3.171017 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40634
(1: 0.071996, 2: 0.015542, 3: 0.028236, 4: 0.290564);
(D_melanogaster_Acp53C14a-PB: 0.071996, D_sechellia_Acp53C14a-PB: 0.015542, D_simulans_Acp53C14a-PB: 0.028236, D_erecta_Acp53C14a-PB: 0.290564);
Detailed output identifying parameters
kappa (ts/tv) = 2.11800
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.56351 q = 3.17102
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00135 0.00960 0.02425 0.04537 0.07373 0.11087 0.15963 0.22565 0.32232 0.50203 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.072 263.1 99.9 0.1475 0.0093 0.0628 2.4 6.3
5..2 0.016 263.1 99.9 0.1475 0.0020 0.0136 0.5 1.4
5..3 0.028 263.1 99.9 0.1475 0.0036 0.0246 1.0 2.5
5..4 0.291 263.1 99.9 0.1475 0.0374 0.2534 9.8 25.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp53C14a-PB)
Pr(w>1) post mean +- SE for w
67 I 0.660 1.915 +- 1.723
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.036 0.964
p : 0.755 0.214 0.028 0.003 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.003 0.032 0.070 0.099 0.120 0.139 0.158 0.178 0.200
ws: 0.562 0.213 0.091 0.046 0.028 0.019 0.014 0.011 0.009 0.007
Time used: 0:18
Model 1: NearlyNeutral -684.335203 Model 2: PositiveSelection -684.335203 Model 0: one-ratio -684.504011 Model 3: discrete -684.272861 Model 7: beta -684.285912 Model 8: beta&w>1 -684.28592 Model 0 vs 1 0.33761600000002545 Model 2 vs 1 0.0 Model 8 vs 7 1.5999999959603883E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
