--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:26:34 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2687/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2309.73         -2313.86
2      -2309.77         -2314.29
--------------------------------------
TOTAL    -2309.75         -2314.10
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.870048    0.085869    0.389238    1.509173    0.835368   1501.00   1501.00    1.000
r(A<->C){all}   0.159280    0.019632    0.000019    0.451803    0.119606    161.43    200.49    1.001
r(A<->G){all}   0.164155    0.020408    0.000090    0.453334    0.124595    224.33    248.75    1.001
r(A<->T){all}   0.158852    0.017640    0.000037    0.427373    0.126183    225.83    283.41    1.001
r(C<->G){all}   0.177415    0.020351    0.000014    0.459975    0.144568    279.08    317.10    1.000
r(C<->T){all}   0.195732    0.020865    0.000015    0.471133    0.167918    143.93    180.43    1.003
r(G<->T){all}   0.144566    0.015208    0.000036    0.386730    0.112464    203.83    212.25    1.000
pi(A){all}      0.158954    0.000078    0.141849    0.175619    0.158722   1116.45   1251.15    1.000
pi(C){all}      0.276266    0.000119    0.255173    0.297503    0.276027   1086.67   1116.13    1.001
pi(G){all}      0.321219    0.000129    0.299335    0.343817    0.321165   1286.01   1310.54    1.000
pi(T){all}      0.243560    0.000112    0.222628    0.263173    0.243495   1228.33   1248.52    1.000
alpha{1,2}      0.265906    0.119707    0.000584    0.925225    0.163439   1432.60   1438.92    1.000
alpha{3}        0.391998    0.209718    0.000119    1.302781    0.229272   1267.68   1284.36    1.000
pinvar{all}     0.997986    0.000003    0.994975    0.999979    0.998414   1129.68   1203.90    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2254.417803
Model 2: PositiveSelection	-2254.019109
Model 0: one-ratio	-2254.019109
Model 7: beta	-2254.417801
Model 8: beta&w>1	-2254.019251


Model 0 vs 1	0.7973879999999554

Model 2 vs 1	0.7973879999999554

Model 8 vs 7	0.797099999999773
>C1
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C2
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C3
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C4
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C5
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPARLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C6
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=564 

C1              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C2              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C3              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C4              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C5              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C6              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
                **************************************************

C1              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C2              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C3              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C4              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C5              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C6              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
                **************************************************

C1              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C2              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C3              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C4              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C5              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C6              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
                **************************************************

C1              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C2              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C3              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C4              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C5              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C6              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
                **************************************************

C1              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C2              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C3              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C4              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C5              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C6              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
                **************************************************

C1              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C2              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C3              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C4              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C5              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C6              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
                **************************************************

C1              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C2              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C3              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C4              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C5              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C6              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
                **************************************************

C1              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C2              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C3              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C4              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C5              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C6              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
                **************************************************

C1              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C2              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C3              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C4              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C5              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C6              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
                **************************************************

C1              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C2              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C3              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C4              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C5              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPARLGGR
C6              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
                ********************************************.*****

C1              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C2              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C3              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C4              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C5              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C6              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
                **************************************************

C1              PSGPMHHPHAPSSI
C2              PSGPMHHPHAPSSI
C3              PSGPMHHPHAPSSI
C4              PSGPMHHPHAPSSI
C5              PSGPMHHPHAPSSI
C6              PSGPMHHPHAPSSI
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  564 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  564 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16920]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [16920]--->[16920]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.577 Mb, Max= 31.175 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C2              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C3              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C4              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C5              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
C6              VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
                **************************************************

C1              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C2              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C3              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C4              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C5              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
C6              ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
                **************************************************

C1              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C2              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C3              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C4              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C5              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
C6              NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
                **************************************************

C1              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C2              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C3              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C4              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C5              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
C6              AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
                **************************************************

C1              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C2              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C3              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C4              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C5              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
C6              LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
                **************************************************

C1              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C2              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C3              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C4              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C5              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
C6              GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
                **************************************************

C1              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C2              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C3              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C4              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C5              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
C6              AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
                **************************************************

C1              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C2              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C3              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C4              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C5              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
C6              RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
                **************************************************

C1              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C2              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C3              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C4              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C5              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
C6              LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
                **************************************************

C1              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C2              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C3              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C4              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
C5              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPARLGGR
C6              YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
                ********************************************.*****

C1              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C2              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C3              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C4              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C5              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
C6              VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
                **************************************************

C1              PSGPMHHPHAPSSI
C2              PSGPMHHPHAPSSI
C3              PSGPMHHPHAPSSI
C4              PSGPMHHPHAPSSI
C5              PSGPMHHPHAPSSI
C6              PSGPMHHPHAPSSI
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 99.82 C1	 C5	 99.82
TOP	    4    0	 99.82 C5	 C1	 99.82
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 99.82 C2	 C5	 99.82
TOP	    4    1	 99.82 C5	 C2	 99.82
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.82 C3	 C5	 99.82
TOP	    4    2	 99.82 C5	 C3	 99.82
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 99.82 C4	 C5	 99.82
TOP	    4    3	 99.82 C5	 C4	 99.82
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 99.82 C5	 C6	 99.82
TOP	    5    4	 99.82 C6	 C5	 99.82
AVG	 0	 C1	  *	 99.96
AVG	 1	 C2	  *	 99.96
AVG	 2	 C3	  *	 99.96
AVG	 3	 C4	  *	 99.96
AVG	 4	 C5	  *	 99.82
AVG	 5	 C6	  *	 99.96
TOT	 TOT	  *	 99.94
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
C2              GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
C3              GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
C4              GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
C5              GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
C6              GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
                **************************************************

C1              CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
C2              CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
C3              CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
C4              CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
C5              CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
C6              CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
                **************************************************

C1              ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
C2              ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
C3              ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
C4              ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
C5              ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
C6              ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
                **************************************************

C1              GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
C2              GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
C3              GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
C4              GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
C5              GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
C6              GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
                **************************************************

C1              TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
C2              TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
C3              TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
C4              TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
C5              TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
C6              TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
                **************************************************

C1              TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
C2              TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
C3              TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
C4              TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
C5              TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
C6              TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
                **************************************************

C1              AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
C2              AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
C3              AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
C4              AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
C5              AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
C6              AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
                **************************************************

C1              CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
C2              CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
C3              CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
C4              CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
C5              CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
C6              CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
                **************************************************

C1              TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
C2              TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
C3              TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
C4              TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
C5              TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
C6              TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
                **************************************************

C1              GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
C2              GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
C3              GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
C4              GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
C5              GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
C6              GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
                **************************************************

C1              ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
C2              ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
C3              ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
C4              ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
C5              ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
C6              ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
                **************************************************

C1              TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
C2              TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
C3              TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
C4              TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
C5              TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
C6              TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
                **************************************************

C1              CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
C2              CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
C3              CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
C4              CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
C5              CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
C6              CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
                **************************************************

C1              CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
C2              CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
C3              CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
C4              CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
C5              CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
C6              CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
                **************************************************

C1              TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
C2              TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
C3              TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
C4              TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
C5              TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
C6              TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
                **************************************************

C1              GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
C2              GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
C3              GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
C4              GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
C5              GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
C6              GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
                **************************************************

C1              CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
C2              CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
C3              CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
C4              CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
C5              CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
C6              CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
                **************************************************

C1              TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
C2              TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
C3              TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
C4              TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
C5              TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
C6              TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
                **************************************************

C1              GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
C2              GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
C3              GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
C4              GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
C5              GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
C6              GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
                **************************************************

C1              ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
C2              ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
C3              ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
C4              ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
C5              ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
C6              ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
                **************************************************

C1              GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
C2              GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
C3              GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
C4              GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
C5              GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
C6              GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
                **************************************************

C1              CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
C2              CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
C3              CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
C4              CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
C5              CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
C6              CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
                **************************************************

C1              CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
C2              CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
C3              CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
C4              CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
C5              CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
C6              CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
                **************************************************

C1              TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
C2              TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
C3              TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
C4              TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
C5              TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
C6              TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
                **************************************************

C1              CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
C2              CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
C3              CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
C4              CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
C5              CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
C6              CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
                **************************************************

C1              GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
C2              GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
C3              GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
C4              GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
C5              GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
C6              GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
                **************************************************

C1              TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
C2              TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
C3              TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
C4              TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
C5              TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
C6              TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
                **************************************************

C1              TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
C2              TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
C3              TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
C4              TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
C5              TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
C6              TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
                **************************************************

C1              GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
C2              GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
C3              GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
C4              GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
C5              GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
C6              GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
                **************************************************

C1              TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
C2              TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
C3              TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
C4              TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
C5              TTCGTCAAATTTATCGGCCTGACGAAGATCCAGCGCGACTGGGTGGACGG
C6              TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
                ********************************* ****************

C1              GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
C2              GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
C3              GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
C4              GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
C5              GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
C6              GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
                **************************************************

C1              CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
C2              CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
C3              CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
C4              CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
C5              CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
C6              CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
                **************************************************

C1              CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
C2              CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
C3              CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
C4              CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
C5              CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
C6              CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
                **************************************************

C1              CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
C2              CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
C3              CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
C4              CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
C5              CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
C6              CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
                ******************************************



>C1
GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
>C2
GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
>C3
GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
>C4
GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
>C5
GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
TTCGTCAAATTTATCGGCCTGACGAAGATCCAGCGCGACTGGGTGGACGG
GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
>C6
GTGATCAACGCTCAGACGCACAGTACCACTATCTCGCCGCGGCCGTTGGC
CGCTGATCGCCAGAGCGCCGATAACCGTGATTGCCCCAGCCGCACAGACT
ATTTGGGCGCCGCCCTAGCAGATGCGATCGGTGGACCGGTAGGTTGCCAT
GCGCTGATCGGCCGTAGTTGGCTGATGACACCGCTCCGGGTGATGTTTCT
TATCGGGCTGGTATTCTTGGCGCTCGGCTGGTCAACGAAGGCGGCCTGCT
TGCAAACCACCGGAACGGGGCCGGGCGGTCAGCGGGTCCCCAATTGGGAT
AACCAGCGCGCATATTACGAGTTGTGCTATTCTGACATAGTGCCGCTCTA
CGGCACAGAGTTGTTGAGCCAAGGTAAGTTTCCGTACAAATCCAGTTGGA
TCGAAACCGACAGTAGCGGCACACCGCGGACCCGCTATGACGGTCGGCTG
GCGGTGCGGTACATGGAGTATCCGGTGTTAACCGGTATTTATCAGTATGT
ATCGATGGCGGTGGCCAAGAGCTACACGGCTTTAAGCGAGCCCGTCAGCC
TACCGGCGGTCGCCGAGGTGGTGATGTTCTTCGACGTTGTTGCATTCGGG
CTGGCATTGGCCTGGTTAGCGACTATCTGGGCCACCGCCGGGCTGGCGGG
CCTCCGGATTTGGGATGCAGCCTTGGTCGCCGCATCCCCGCTGGTGATTT
TTCAGGTGTTCACCAACTTCGACGCGTTGGCCATAGCATTCGCGACTGGT
GGATTGCTAGCGTGGTCGCGGTGCAGACCGATATCTGCTGGTGTGCTGAT
CGGGTTAGGTGCCGCGGCCAAGCTCTATCCGCTGCTGTTTTTGGTCCCGT
TGTTTGTGTTGGGCGTCCGCACCGGACGCCTCGGGGGTGTGGCTTGCGCC
GCGGTGACCGCGGCAACAACCTGGTTGTTGGTGAATCTTCCTGTGCTATT
ACTTTTCCCACGCGGCTGGTCGGAGTTTTTCCGGTTTAACACTCGCCGTG
GGGACGACATGGACTCGTTGTATAACGTCGTGAAATCGCTTACTGGCTGG
CGCGGTTTCGATACCAAGCTGGGTTTCTGCGAGCTACCCCTGGTTCTAAA
CACCGTAGTAACGGTGTTGTTCGCATTGTGTTGTGCAGCAGTAGCTTATA
TTGCGCTGACTGCTGCACAACGGCCACGAGTGGTTCAGTTAGCGTTTTTG
CTGGTGGCGGTATTTTTGTTGACCAACAAGGTCTGGAGCCCCCAGTTCTC
GCTGTGGCTGGTGCCGCTGGCAGTGTTGGCCTTGCCGCACCGCCGGGTGC
TGCTGGCGTGGATGACGATCGATGCTCTGGTGTGGGTGCCGCGGATGTAT
TACCTTTACGGCAATCCGAGCCGTTCGCTCCCGGAGCAGTGGTTCACCGC
GACGGTGCTGTTGCGCGATATTGCGGTCGTGGCGCTGTGCGCGCTGGTGA
TTCGTCAAATTTATCGGCCTGACGAAGATCCAGTGCGACTGGGTGGACGG
GTGGATGATCCGGCGGGCGGACCTTTCGACCGCGCCCCGTACGCCCCGCC
CAGCTGGCTGCCGGACTGGCTGCATCCAGCTGGGATGCGGCGGGTAGTCA
CGTTGGCAGCATCATCAGTGACTGAAACCGAGCTGGCCGCCGCTGCAACG
CCTTCTGGCCCCATGCACCATCCCCATGCACCATCTAGTATA
>C1
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C2
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C3
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C4
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C5
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPARLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI
>C6
VINAQTHSTTISPRPLAADRQSADNRDCPSRTDYLGAALADAIGGPVGCH
ALIGRSWLMTPLRVMFLIGLVFLALGWSTKAACLQTTGTGPGGQRVPNWD
NQRAYYELCYSDIVPLYGTELLSQGKFPYKSSWIETDSSGTPRTRYDGRL
AVRYMEYPVLTGIYQYVSMAVAKSYTALSEPVSLPAVAEVVMFFDVVAFG
LALAWLATIWATAGLAGLRIWDAALVAASPLVIFQVFTNFDALAIAFATG
GLLAWSRCRPISAGVLIGLGAAAKLYPLLFLVPLFVLGVRTGRLGGVACA
AVTAATTWLLVNLPVLLLFPRGWSEFFRFNTRRGDDMDSLYNVVKSLTGW
RGFDTKLGFCELPLVLNTVVTVLFALCCAAVAYIALTAAQRPRVVQLAFL
LVAVFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTIDALVWVPRMY
YLYGNPSRSLPEQWFTATVLLRDIAVVALCALVIRQIYRPDEDPVRLGGR
VDDPAGGPFDRAPYAPPSWLPDWLHPAGMRRVVTLAASSVTETELAAAAT
PSGPMHHPHAPSSI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1692 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579782290
      Setting output file names to "/data/10res/ML2687/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 731630418
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9127375065
      Seed = 705482298
      Swapseed = 1579782290
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3790.179965 -- -24.965149
         Chain 2 -- -3790.179965 -- -24.965149
         Chain 3 -- -3790.178196 -- -24.965149
         Chain 4 -- -3790.179745 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3790.178196 -- -24.965149
         Chain 2 -- -3790.179324 -- -24.965149
         Chain 3 -- -3790.178416 -- -24.965149
         Chain 4 -- -3790.179745 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3790.180] (-3790.180) (-3790.178) (-3790.180) * [-3790.178] (-3790.179) (-3790.178) (-3790.180) 
        500 -- (-2331.850) (-2359.185) [-2316.697] (-2351.130) * (-2348.371) [-2330.085] (-2312.633) (-2350.235) -- 0:00:00
       1000 -- [-2308.218] (-2341.984) (-2316.708) (-2324.906) * (-2324.236) (-2315.771) (-2314.981) [-2315.805] -- 0:16:39
       1500 -- [-2318.797] (-2335.111) (-2317.847) (-2312.248) * [-2316.098] (-2316.091) (-2319.678) (-2319.127) -- 0:11:05
       2000 -- (-2318.520) (-2323.639) [-2313.550] (-2316.162) * [-2318.475] (-2314.939) (-2318.307) (-2322.266) -- 0:08:19
       2500 -- [-2319.467] (-2320.911) (-2326.549) (-2314.805) * [-2317.258] (-2312.529) (-2311.511) (-2318.584) -- 0:06:39
       3000 -- [-2315.931] (-2315.079) (-2322.696) (-2314.657) * (-2312.785) [-2313.359] (-2318.893) (-2321.081) -- 0:05:32
       3500 -- [-2317.401] (-2313.724) (-2313.799) (-2316.241) * (-2325.322) (-2313.573) [-2318.586] (-2311.409) -- 0:04:44
       4000 -- [-2313.262] (-2316.187) (-2313.866) (-2320.187) * (-2312.653) [-2316.233] (-2316.124) (-2319.216) -- 0:04:09
       4500 -- (-2311.487) (-2309.809) (-2320.578) [-2310.955] * (-2312.406) (-2319.289) [-2311.850] (-2312.073) -- 0:03:41
       5000 -- (-2313.506) (-2308.353) (-2320.307) [-2311.939] * (-2318.423) [-2310.573] (-2309.117) (-2312.864) -- 0:03:19

      Average standard deviation of split frequencies: 0.121422

       5500 -- (-2315.338) [-2310.132] (-2321.216) (-2315.058) * [-2316.423] (-2320.137) (-2315.686) (-2314.577) -- 0:03:00
       6000 -- (-2316.778) (-2316.160) [-2310.952] (-2313.840) * [-2318.613] (-2312.268) (-2315.673) (-2317.000) -- 0:02:45
       6500 -- (-2312.455) (-2311.584) (-2312.149) [-2314.174] * [-2310.107] (-2311.732) (-2315.001) (-2320.621) -- 0:02:32
       7000 -- (-2314.475) (-2322.213) (-2319.507) [-2318.218] * (-2324.166) (-2315.688) [-2309.868] (-2309.402) -- 0:02:21
       7500 -- [-2317.668] (-2315.715) (-2319.855) (-2319.180) * (-2317.339) [-2319.331] (-2314.677) (-2320.156) -- 0:02:12
       8000 -- [-2317.084] (-2312.551) (-2321.446) (-2317.209) * (-2316.815) [-2311.514] (-2313.072) (-2325.375) -- 0:02:04
       8500 -- (-2316.090) [-2315.249] (-2320.232) (-2312.899) * (-2315.009) (-2310.514) (-2311.298) [-2310.253] -- 0:01:56
       9000 -- (-2311.185) [-2310.942] (-2312.757) (-2315.068) * (-2310.032) (-2312.994) (-2323.182) [-2315.662] -- 0:01:50
       9500 -- [-2312.459] (-2319.704) (-2319.286) (-2311.292) * (-2312.445) (-2311.847) [-2308.817] (-2316.715) -- 0:01:44
      10000 -- [-2311.355] (-2311.649) (-2325.613) (-2308.827) * (-2322.978) (-2315.694) [-2312.419] (-2321.022) -- 0:01:39

      Average standard deviation of split frequencies: 0.095017

      10500 -- (-2310.907) [-2322.041] (-2320.034) (-2313.606) * (-2309.384) [-2315.183] (-2313.428) (-2320.899) -- 0:01:34
      11000 -- [-2312.766] (-2317.148) (-2315.280) (-2318.333) * (-2312.653) [-2312.986] (-2318.317) (-2318.750) -- 0:01:29
      11500 -- (-2316.840) [-2315.698] (-2315.462) (-2314.510) * [-2319.265] (-2314.942) (-2312.614) (-2328.982) -- 0:01:25
      12000 -- [-2313.767] (-2312.422) (-2318.860) (-2315.937) * (-2315.935) [-2313.805] (-2315.559) (-2313.945) -- 0:01:22
      12500 -- [-2312.133] (-2313.821) (-2318.604) (-2312.718) * (-2313.338) (-2314.061) (-2310.315) [-2310.637] -- 0:01:19
      13000 -- (-2317.079) (-2317.812) (-2311.218) [-2311.750] * (-2317.913) [-2311.518] (-2311.344) (-2311.804) -- 0:01:15
      13500 -- (-2319.174) (-2310.844) (-2315.559) [-2311.366] * [-2311.056] (-2316.691) (-2313.324) (-2317.450) -- 0:01:13
      14000 -- (-2308.814) (-2315.894) [-2313.774] (-2316.126) * (-2316.620) [-2319.242] (-2316.497) (-2310.753) -- 0:02:20
      14500 -- [-2314.938] (-2317.809) (-2316.865) (-2312.777) * (-2321.069) (-2312.891) [-2308.450] (-2310.453) -- 0:02:15
      15000 -- [-2311.294] (-2318.490) (-2313.510) (-2315.089) * (-2325.743) (-2313.166) (-2309.977) [-2308.587] -- 0:02:11

      Average standard deviation of split frequencies: 0.062943

      15500 -- (-2321.697) (-2314.149) (-2320.356) [-2314.322] * [-2312.697] (-2312.823) (-2312.778) (-2309.141) -- 0:02:07
      16000 -- [-2311.966] (-2314.253) (-2314.247) (-2311.690) * (-2315.773) (-2315.314) (-2310.806) [-2309.759] -- 0:02:03
      16500 -- [-2315.162] (-2316.299) (-2313.730) (-2311.985) * (-2318.593) [-2313.899] (-2319.506) (-2309.328) -- 0:01:59
      17000 -- (-2321.188) [-2311.491] (-2313.017) (-2311.830) * (-2319.996) (-2316.369) [-2311.571] (-2312.471) -- 0:01:55
      17500 -- (-2317.348) (-2325.041) (-2316.269) [-2312.114] * (-2317.565) [-2314.020] (-2308.862) (-2308.837) -- 0:01:52
      18000 -- (-2315.100) [-2312.760] (-2320.380) (-2314.813) * [-2314.979] (-2314.930) (-2306.497) (-2309.954) -- 0:01:49
      18500 -- (-2314.710) (-2318.221) [-2317.971] (-2313.478) * (-2317.022) [-2310.138] (-2314.353) (-2310.885) -- 0:01:46
      19000 -- [-2312.543] (-2316.609) (-2313.458) (-2318.838) * [-2316.166] (-2315.967) (-2309.078) (-2309.949) -- 0:01:43
      19500 -- [-2308.265] (-2324.835) (-2314.559) (-2314.927) * [-2311.758] (-2318.151) (-2310.961) (-2312.406) -- 0:01:40
      20000 -- [-2311.963] (-2315.455) (-2316.775) (-2316.310) * (-2323.817) (-2312.358) (-2308.544) [-2314.281] -- 0:01:38

      Average standard deviation of split frequencies: 0.059037

      20500 -- [-2310.154] (-2311.481) (-2316.340) (-2318.046) * (-2314.595) [-2318.303] (-2309.567) (-2316.234) -- 0:01:35
      21000 -- (-2313.939) [-2312.906] (-2313.098) (-2324.387) * (-2318.998) (-2318.931) [-2309.797] (-2310.458) -- 0:01:33
      21500 -- [-2314.050] (-2315.950) (-2315.358) (-2314.645) * [-2319.059] (-2315.042) (-2311.056) (-2312.034) -- 0:01:31
      22000 -- (-2319.513) (-2317.011) (-2312.811) [-2316.118] * (-2322.800) (-2319.839) (-2308.315) [-2308.890] -- 0:01:28
      22500 -- (-2317.411) (-2320.356) (-2312.042) [-2315.847] * (-2318.571) (-2322.670) [-2308.626] (-2307.570) -- 0:01:26
      23000 -- (-2315.973) (-2315.413) (-2322.377) [-2314.037] * [-2311.967] (-2317.841) (-2313.955) (-2312.180) -- 0:01:24
      23500 -- (-2312.197) [-2316.004] (-2315.588) (-2313.905) * (-2316.484) (-2323.319) (-2312.480) [-2310.795] -- 0:01:23
      24000 -- (-2317.099) (-2319.529) (-2314.596) [-2311.111] * (-2319.491) [-2315.981] (-2311.439) (-2308.786) -- 0:01:21
      24500 -- (-2314.463) (-2312.937) [-2310.652] (-2312.399) * [-2317.526] (-2315.608) (-2309.180) (-2310.936) -- 0:01:19
      25000 -- (-2319.904) (-2311.915) [-2318.278] (-2312.425) * (-2315.742) (-2313.677) [-2312.178] (-2311.944) -- 0:01:18

      Average standard deviation of split frequencies: 0.052028

      25500 -- [-2315.673] (-2309.976) (-2311.235) (-2314.342) * (-2311.352) (-2323.763) [-2310.762] (-2310.023) -- 0:01:16
      26000 -- (-2318.190) (-2318.735) (-2316.088) [-2316.735] * (-2313.082) [-2316.535] (-2309.173) (-2309.748) -- 0:01:14
      26500 -- (-2319.075) (-2313.908) [-2310.984] (-2316.851) * [-2313.304] (-2318.934) (-2311.384) (-2310.616) -- 0:01:13
      27000 -- (-2317.846) (-2311.959) (-2316.098) [-2321.217] * (-2311.914) (-2309.893) [-2310.767] (-2313.806) -- 0:01:12
      27500 -- (-2324.185) [-2310.947] (-2311.269) (-2316.124) * (-2310.468) [-2312.470] (-2312.584) (-2312.522) -- 0:01:46
      28000 -- (-2317.213) (-2316.894) (-2315.538) [-2317.338] * (-2312.337) [-2314.014] (-2310.636) (-2312.003) -- 0:01:44
      28500 -- [-2316.855] (-2314.652) (-2312.893) (-2316.951) * (-2310.677) (-2311.061) (-2316.132) [-2312.188] -- 0:01:42
      29000 -- (-2312.666) (-2316.977) [-2309.503] (-2321.734) * [-2309.756] (-2311.859) (-2309.646) (-2311.687) -- 0:01:40
      29500 -- (-2310.766) (-2309.223) [-2316.775] (-2324.925) * (-2311.581) (-2318.892) (-2312.319) [-2314.215] -- 0:01:38
      30000 -- (-2315.997) (-2310.048) (-2327.290) [-2319.027] * (-2314.914) [-2314.734] (-2310.068) (-2314.210) -- 0:01:37

      Average standard deviation of split frequencies: 0.040260

      30500 -- (-2314.047) (-2312.590) [-2320.011] (-2314.013) * [-2312.293] (-2316.332) (-2314.437) (-2310.736) -- 0:01:35
      31000 -- [-2314.128] (-2315.659) (-2312.978) (-2318.763) * (-2310.863) (-2311.298) (-2311.771) [-2310.609] -- 0:01:33
      31500 -- [-2312.072] (-2314.686) (-2316.734) (-2314.271) * (-2314.784) [-2308.629] (-2314.892) (-2309.692) -- 0:01:32
      32000 -- (-2320.559) (-2315.333) (-2309.587) [-2317.276] * (-2314.865) [-2312.865] (-2311.716) (-2309.389) -- 0:01:30
      32500 -- (-2307.318) [-2315.362] (-2322.709) (-2314.008) * (-2315.542) (-2316.643) [-2309.833] (-2313.674) -- 0:01:29
      33000 -- (-2308.622) (-2314.099) (-2319.190) [-2309.899] * (-2318.143) (-2317.450) (-2309.950) [-2313.118] -- 0:01:27
      33500 -- (-2311.392) (-2312.230) (-2328.981) [-2312.355] * (-2318.224) [-2313.486] (-2309.892) (-2310.384) -- 0:01:26
      34000 -- [-2314.017] (-2317.356) (-2316.234) (-2312.913) * (-2315.045) (-2315.438) (-2308.756) [-2313.139] -- 0:01:25
      34500 -- (-2313.986) [-2318.932] (-2314.854) (-2310.801) * (-2315.058) (-2316.900) [-2310.506] (-2320.531) -- 0:01:23
      35000 -- (-2310.835) [-2314.675] (-2327.033) (-2318.531) * (-2318.108) [-2319.757] (-2308.571) (-2316.923) -- 0:01:22

      Average standard deviation of split frequencies: 0.032009

      35500 -- (-2311.059) [-2314.076] (-2319.787) (-2318.072) * (-2315.286) (-2311.666) (-2309.432) [-2309.507] -- 0:01:21
      36000 -- (-2308.771) (-2312.468) (-2312.279) [-2315.151] * (-2309.818) (-2316.133) [-2308.644] (-2313.480) -- 0:01:20
      36500 -- (-2308.587) [-2314.717] (-2315.606) (-2310.744) * [-2308.012] (-2321.352) (-2309.274) (-2314.062) -- 0:01:19
      37000 -- (-2309.559) (-2315.210) [-2317.432] (-2316.096) * (-2311.623) [-2312.678] (-2309.401) (-2314.779) -- 0:01:18
      37500 -- (-2310.411) (-2309.082) [-2315.347] (-2319.733) * (-2311.066) [-2316.492] (-2309.273) (-2314.620) -- 0:01:17
      38000 -- (-2310.086) (-2316.570) [-2319.648] (-2315.941) * (-2309.259) (-2309.765) (-2311.558) [-2312.332] -- 0:01:15
      38500 -- (-2311.776) (-2321.646) [-2312.427] (-2316.457) * (-2308.744) (-2310.124) [-2310.527] (-2311.337) -- 0:01:14
      39000 -- [-2308.842] (-2309.698) (-2312.900) (-2318.181) * (-2310.457) (-2315.563) (-2311.182) [-2313.382] -- 0:01:13
      39500 -- (-2313.931) (-2311.580) [-2311.207] (-2314.257) * (-2309.747) [-2315.758] (-2314.650) (-2310.536) -- 0:01:12
      40000 -- (-2314.404) (-2310.779) (-2316.063) [-2315.822] * (-2311.034) [-2310.575] (-2309.307) (-2310.035) -- 0:01:12

      Average standard deviation of split frequencies: 0.031556

      40500 -- (-2312.859) (-2323.705) (-2312.684) [-2313.590] * (-2311.183) (-2315.230) (-2309.012) [-2313.352] -- 0:01:11
      41000 -- (-2308.541) (-2314.499) (-2327.098) [-2316.875] * (-2309.602) (-2314.040) [-2309.920] (-2309.646) -- 0:01:33
      41500 -- (-2311.336) (-2314.992) [-2312.714] (-2316.334) * (-2311.887) (-2313.720) [-2312.916] (-2312.186) -- 0:01:32
      42000 -- [-2312.923] (-2315.818) (-2320.098) (-2316.537) * (-2310.783) (-2318.605) [-2309.949] (-2311.369) -- 0:01:31
      42500 -- (-2311.751) (-2314.440) (-2313.766) [-2312.252] * [-2309.165] (-2311.567) (-2309.846) (-2311.220) -- 0:01:30
      43000 -- (-2312.652) [-2315.328] (-2309.881) (-2312.571) * (-2307.794) (-2324.255) (-2308.601) [-2311.439] -- 0:01:29
      43500 -- (-2312.626) (-2310.984) (-2324.500) [-2315.724] * [-2310.184] (-2322.680) (-2310.097) (-2311.962) -- 0:01:27
      44000 -- (-2311.877) (-2314.892) [-2311.623] (-2315.844) * (-2308.303) (-2316.810) [-2311.369] (-2312.575) -- 0:01:26
      44500 -- (-2312.852) (-2315.182) [-2308.976] (-2323.503) * (-2312.014) (-2317.406) [-2310.412] (-2314.891) -- 0:01:25
      45000 -- (-2311.102) (-2309.257) [-2313.016] (-2313.260) * (-2311.284) [-2323.506] (-2310.991) (-2310.527) -- 0:01:24

      Average standard deviation of split frequencies: 0.025620

      45500 -- [-2309.813] (-2314.663) (-2315.237) (-2319.823) * (-2310.945) (-2317.088) [-2309.586] (-2310.672) -- 0:01:23
      46000 -- (-2312.577) [-2310.871] (-2314.402) (-2316.471) * (-2311.151) [-2316.438] (-2308.513) (-2311.713) -- 0:01:22
      46500 -- (-2312.576) (-2313.491) (-2313.765) [-2311.382] * [-2310.776] (-2311.268) (-2309.294) (-2312.175) -- 0:01:22
      47000 -- (-2310.986) [-2319.953] (-2312.833) (-2323.799) * [-2310.409] (-2315.655) (-2310.507) (-2312.606) -- 0:01:21
      47500 -- (-2311.860) (-2317.117) [-2314.465] (-2317.548) * (-2309.437) (-2317.274) (-2310.151) [-2311.445] -- 0:01:20
      48000 -- (-2311.399) (-2309.424) (-2311.387) [-2315.288] * (-2311.322) (-2324.556) (-2311.082) [-2308.158] -- 0:01:19
      48500 -- (-2311.412) (-2311.458) (-2312.480) [-2314.479] * (-2313.706) [-2312.201] (-2310.359) (-2312.144) -- 0:01:18
      49000 -- (-2311.164) (-2310.896) (-2308.719) [-2313.216] * (-2310.469) (-2315.708) [-2310.916] (-2311.902) -- 0:01:17
      49500 -- (-2311.309) (-2308.840) (-2308.122) [-2313.373] * (-2308.323) (-2312.326) [-2312.978] (-2311.280) -- 0:01:16
      50000 -- (-2312.859) (-2310.283) (-2308.784) [-2311.191] * (-2308.883) [-2312.030] (-2310.563) (-2310.655) -- 0:01:16

      Average standard deviation of split frequencies: 0.026982

      50500 -- (-2308.656) (-2309.333) [-2307.595] (-2313.625) * (-2309.818) [-2309.924] (-2314.835) (-2310.786) -- 0:01:15
      51000 -- (-2311.953) (-2311.069) [-2309.748] (-2314.257) * (-2309.474) (-2319.141) (-2314.003) [-2311.786] -- 0:01:14
      51500 -- (-2310.472) (-2313.262) [-2311.921] (-2312.670) * (-2307.205) (-2314.665) (-2313.878) [-2311.703] -- 0:01:13
      52000 -- [-2309.281] (-2310.219) (-2309.405) (-2314.527) * (-2310.920) [-2314.357] (-2313.068) (-2312.428) -- 0:01:12
      52500 -- (-2309.513) (-2310.075) (-2313.289) [-2313.928] * (-2314.437) [-2311.760] (-2312.493) (-2312.395) -- 0:01:12
      53000 -- (-2308.792) (-2311.330) (-2309.229) [-2317.900] * (-2314.938) [-2316.226] (-2309.944) (-2313.539) -- 0:01:11
      53500 -- (-2308.199) [-2308.728] (-2314.805) (-2313.677) * (-2308.276) [-2321.191] (-2310.106) (-2310.987) -- 0:01:10
      54000 -- (-2308.075) (-2312.339) [-2309.971] (-2312.877) * (-2308.506) (-2310.685) (-2311.090) [-2308.814] -- 0:01:10
      54500 -- (-2312.514) (-2310.181) (-2310.620) [-2316.663] * (-2309.449) [-2309.447] (-2309.873) (-2310.577) -- 0:01:09
      55000 -- [-2312.222] (-2311.415) (-2310.483) (-2318.568) * (-2307.554) (-2317.705) [-2308.100] (-2310.362) -- 0:01:25

      Average standard deviation of split frequencies: 0.025721

      55500 -- (-2308.939) (-2314.251) (-2312.067) [-2313.637] * (-2309.273) (-2317.737) [-2310.594] (-2311.257) -- 0:01:25
      56000 -- (-2308.944) (-2311.858) [-2309.689] (-2327.274) * (-2310.485) (-2321.057) [-2310.971] (-2310.159) -- 0:01:24
      56500 -- (-2312.930) [-2311.845] (-2310.465) (-2326.919) * (-2308.647) [-2316.179] (-2311.551) (-2310.336) -- 0:01:23
      57000 -- (-2309.826) (-2310.495) (-2309.427) [-2315.730] * (-2308.795) [-2311.731] (-2308.134) (-2313.062) -- 0:01:22
      57500 -- (-2310.409) (-2311.158) (-2308.567) [-2317.238] * (-2311.657) (-2313.144) [-2308.306] (-2316.238) -- 0:01:21
      58000 -- (-2309.247) (-2310.573) [-2310.358] (-2310.233) * (-2307.284) [-2314.638] (-2310.395) (-2310.782) -- 0:01:21
      58500 -- (-2309.900) (-2308.953) (-2310.378) [-2316.635] * (-2307.299) (-2322.852) [-2311.769] (-2313.668) -- 0:01:20
      59000 -- (-2308.696) [-2309.969] (-2310.117) (-2310.743) * (-2310.687) [-2313.410] (-2308.877) (-2309.657) -- 0:01:19
      59500 -- (-2310.014) (-2311.053) (-2308.022) [-2311.136] * (-2310.398) (-2320.631) [-2311.341] (-2308.645) -- 0:01:19
      60000 -- (-2312.353) (-2310.053) (-2307.685) [-2312.315] * (-2310.095) (-2315.044) [-2312.667] (-2307.843) -- 0:01:18

      Average standard deviation of split frequencies: 0.019815

      60500 -- (-2311.554) (-2313.236) (-2308.511) [-2315.966] * (-2309.557) [-2314.479] (-2307.782) (-2310.668) -- 0:01:17
      61000 -- (-2311.110) (-2309.867) (-2315.047) [-2313.946] * (-2307.689) (-2332.690) [-2308.813] (-2314.902) -- 0:01:16
      61500 -- (-2308.764) [-2308.435] (-2317.025) (-2314.779) * (-2311.152) (-2317.007) [-2317.287] (-2315.312) -- 0:01:16
      62000 -- [-2310.452] (-2312.288) (-2312.244) (-2311.068) * (-2311.400) (-2320.710) [-2312.684] (-2312.362) -- 0:01:15
      62500 -- (-2309.011) (-2312.083) [-2309.116] (-2324.822) * (-2311.719) [-2310.862] (-2308.258) (-2311.790) -- 0:01:15
      63000 -- (-2309.694) (-2312.387) (-2310.139) [-2314.065] * (-2307.195) (-2315.300) [-2308.403] (-2312.426) -- 0:01:14
      63500 -- (-2309.139) (-2314.016) [-2310.010] (-2314.173) * (-2310.446) [-2313.127] (-2308.342) (-2313.057) -- 0:01:13
      64000 -- (-2308.987) (-2308.608) (-2311.683) [-2310.585] * (-2312.771) [-2312.062] (-2313.933) (-2320.102) -- 0:01:13
      64500 -- [-2309.880] (-2314.047) (-2307.459) (-2314.049) * (-2309.542) [-2314.000] (-2311.940) (-2309.560) -- 0:01:12
      65000 -- (-2311.227) (-2315.036) (-2308.910) [-2317.884] * (-2312.560) [-2320.887] (-2312.184) (-2308.724) -- 0:01:11

      Average standard deviation of split frequencies: 0.019727

      65500 -- (-2313.356) [-2311.005] (-2313.717) (-2315.711) * (-2311.821) [-2321.631] (-2309.125) (-2309.804) -- 0:01:11
      66000 -- (-2312.229) (-2310.545) [-2312.977] (-2318.294) * (-2309.171) [-2311.374] (-2310.796) (-2312.199) -- 0:01:10
      66500 -- (-2311.370) (-2313.798) (-2310.578) [-2323.511] * (-2308.550) [-2313.960] (-2310.743) (-2308.357) -- 0:01:10
      67000 -- (-2311.484) (-2309.360) (-2310.867) [-2314.920] * (-2309.178) [-2313.950] (-2310.762) (-2309.502) -- 0:01:09
      67500 -- (-2313.239) [-2311.247] (-2316.998) (-2317.875) * (-2311.004) (-2325.263) (-2309.415) [-2310.469] -- 0:01:09
      68000 -- (-2311.955) [-2309.287] (-2311.057) (-2317.079) * (-2313.747) (-2317.850) [-2310.543] (-2308.657) -- 0:01:08
      68500 -- (-2311.592) [-2309.450] (-2313.205) (-2314.707) * (-2314.246) [-2312.827] (-2308.883) (-2308.060) -- 0:01:07
      69000 -- (-2311.383) (-2316.533) (-2311.185) [-2327.508] * (-2311.138) [-2328.747] (-2311.435) (-2309.329) -- 0:01:20
      69500 -- [-2310.665] (-2307.963) (-2318.220) (-2318.847) * (-2308.991) [-2311.188] (-2312.482) (-2311.101) -- 0:01:20
      70000 -- (-2314.837) (-2308.281) (-2307.717) [-2315.716] * (-2309.997) [-2312.394] (-2317.415) (-2317.102) -- 0:01:19

      Average standard deviation of split frequencies: 0.018678

      70500 -- (-2314.052) (-2311.144) [-2311.658] (-2313.119) * [-2311.676] (-2317.678) (-2310.006) (-2311.388) -- 0:01:19
      71000 -- (-2314.419) [-2310.091] (-2312.198) (-2319.457) * (-2312.788) [-2309.942] (-2310.106) (-2311.194) -- 0:01:18
      71500 -- (-2315.162) (-2311.791) [-2309.852] (-2317.183) * (-2311.798) [-2313.093] (-2309.472) (-2309.305) -- 0:01:17
      72000 -- (-2311.401) (-2309.688) [-2308.122] (-2311.392) * (-2309.692) [-2314.662] (-2312.277) (-2309.581) -- 0:01:17
      72500 -- (-2311.758) (-2308.782) (-2311.768) [-2317.092] * (-2312.190) [-2320.203] (-2309.617) (-2309.437) -- 0:01:16
      73000 -- (-2311.415) (-2310.155) (-2312.220) [-2319.591] * (-2312.812) (-2318.577) [-2311.141] (-2311.999) -- 0:01:16
      73500 -- (-2310.073) (-2312.273) (-2309.532) [-2319.168] * (-2313.165) [-2314.195] (-2307.529) (-2311.737) -- 0:01:15
      74000 -- [-2312.216] (-2309.861) (-2311.433) (-2317.710) * (-2313.105) (-2316.707) [-2310.646] (-2311.158) -- 0:01:15
      74500 -- (-2310.312) (-2311.991) [-2314.471] (-2312.802) * (-2311.731) [-2312.194] (-2313.414) (-2311.094) -- 0:01:14
      75000 -- (-2312.267) [-2310.986] (-2314.967) (-2316.122) * (-2317.351) [-2315.743] (-2309.852) (-2307.826) -- 0:01:14

      Average standard deviation of split frequencies: 0.020469

      75500 -- (-2312.070) (-2310.369) [-2310.523] (-2315.263) * (-2310.403) [-2315.821] (-2308.800) (-2311.562) -- 0:01:13
      76000 -- (-2314.947) (-2311.253) [-2307.929] (-2316.803) * (-2309.881) (-2313.504) (-2310.496) [-2308.770] -- 0:01:12
      76500 -- (-2313.104) (-2311.467) (-2307.633) [-2314.294] * (-2311.194) [-2315.007] (-2309.972) (-2309.840) -- 0:01:12
      77000 -- [-2309.456] (-2311.189) (-2311.413) (-2316.051) * (-2308.711) [-2319.357] (-2309.284) (-2310.586) -- 0:01:11
      77500 -- [-2311.015] (-2309.237) (-2309.218) (-2315.321) * (-2313.365) (-2312.546) (-2309.923) [-2310.709] -- 0:01:11
      78000 -- (-2309.204) (-2309.630) [-2312.790] (-2314.309) * (-2308.845) [-2309.989] (-2309.404) (-2313.616) -- 0:01:10
      78500 -- (-2312.521) (-2310.065) (-2312.468) [-2315.636] * (-2309.535) (-2311.887) [-2311.681] (-2312.504) -- 0:01:10
      79000 -- (-2309.292) (-2315.452) [-2311.437] (-2313.733) * (-2310.521) (-2311.020) [-2311.259] (-2311.598) -- 0:01:09
      79500 -- (-2310.205) [-2311.014] (-2309.268) (-2313.086) * (-2309.399) [-2309.601] (-2311.282) (-2312.970) -- 0:01:09
      80000 -- [-2309.801] (-2310.114) (-2309.494) (-2312.319) * (-2312.922) [-2308.399] (-2312.011) (-2312.515) -- 0:01:09

      Average standard deviation of split frequencies: 0.020161

      80500 -- (-2309.327) (-2310.098) [-2308.730] (-2312.928) * [-2308.948] (-2312.707) (-2314.482) (-2312.124) -- 0:01:08
      81000 -- (-2309.806) [-2311.175] (-2309.485) (-2315.522) * (-2313.283) (-2310.841) (-2314.351) [-2316.080] -- 0:01:08
      81500 -- (-2310.388) (-2310.222) (-2307.926) [-2315.068] * (-2311.551) (-2310.099) [-2311.971] (-2318.738) -- 0:01:07
      82000 -- (-2309.598) [-2307.880] (-2309.084) (-2317.283) * [-2308.991] (-2308.639) (-2310.448) (-2311.748) -- 0:01:07
      82500 -- [-2310.136] (-2310.509) (-2309.189) (-2319.495) * (-2310.669) (-2310.037) (-2311.512) [-2310.914] -- 0:01:17
      83000 -- (-2309.744) (-2311.648) (-2312.565) [-2315.963] * (-2308.706) [-2308.168] (-2311.579) (-2310.685) -- 0:01:17
      83500 -- (-2312.107) (-2314.395) [-2308.708] (-2317.409) * (-2310.482) [-2308.685] (-2314.527) (-2313.588) -- 0:01:16
      84000 -- (-2311.595) (-2313.343) [-2313.243] (-2314.298) * [-2309.176] (-2309.027) (-2311.641) (-2310.286) -- 0:01:16
      84500 -- (-2309.305) (-2311.243) [-2312.351] (-2315.495) * [-2310.505] (-2311.034) (-2312.638) (-2313.291) -- 0:01:15
      85000 -- (-2310.352) (-2312.673) [-2314.956] (-2334.966) * [-2311.528] (-2313.690) (-2311.567) (-2315.661) -- 0:01:15

      Average standard deviation of split frequencies: 0.021926

      85500 -- [-2311.613] (-2311.891) (-2309.339) (-2313.267) * (-2314.343) (-2310.525) (-2312.336) [-2309.078] -- 0:01:14
      86000 -- [-2308.330] (-2309.741) (-2310.328) (-2314.223) * (-2312.974) (-2309.492) (-2310.664) [-2309.110] -- 0:01:14
      86500 -- [-2308.874] (-2310.631) (-2309.017) (-2328.682) * (-2312.443) [-2312.040] (-2312.264) (-2314.697) -- 0:01:13
      87000 -- (-2307.901) (-2312.424) (-2316.133) [-2318.896] * (-2312.059) (-2313.347) [-2313.046] (-2316.710) -- 0:01:13
      87500 -- (-2310.913) (-2319.863) (-2313.785) [-2313.502] * (-2311.591) (-2310.556) [-2310.286] (-2312.376) -- 0:01:13
      88000 -- (-2309.900) (-2311.399) [-2311.274] (-2315.819) * (-2311.214) (-2311.024) (-2311.646) [-2311.435] -- 0:01:12
      88500 -- (-2312.507) (-2312.284) [-2308.648] (-2321.003) * [-2312.022] (-2309.009) (-2309.435) (-2311.360) -- 0:01:12
      89000 -- (-2310.837) [-2313.207] (-2309.515) (-2314.149) * (-2311.548) (-2314.486) [-2309.806] (-2310.594) -- 0:01:11
      89500 -- (-2309.473) (-2310.295) (-2308.509) [-2312.094] * (-2310.670) (-2312.065) [-2309.499] (-2315.051) -- 0:01:11
      90000 -- (-2310.284) (-2312.626) (-2310.282) [-2319.507] * (-2311.312) (-2308.050) [-2310.141] (-2311.190) -- 0:01:10

      Average standard deviation of split frequencies: 0.022713

      90500 -- (-2310.666) (-2315.360) (-2312.067) [-2314.592] * (-2312.060) [-2308.375] (-2311.505) (-2310.728) -- 0:01:10
      91000 -- (-2313.467) (-2313.149) (-2310.072) [-2312.977] * [-2311.224] (-2308.557) (-2313.553) (-2317.352) -- 0:01:09
      91500 -- (-2312.721) [-2312.255] (-2312.825) (-2321.594) * (-2308.530) (-2307.770) [-2310.315] (-2316.901) -- 0:01:09
      92000 -- (-2311.158) (-2312.400) (-2313.066) [-2313.866] * (-2312.478) [-2309.707] (-2309.714) (-2314.714) -- 0:01:09
      92500 -- (-2312.588) (-2310.949) (-2311.928) [-2313.995] * (-2311.977) (-2309.089) [-2310.104] (-2310.415) -- 0:01:08
      93000 -- (-2311.323) (-2310.951) (-2313.266) [-2314.768] * [-2310.499] (-2311.786) (-2309.925) (-2310.707) -- 0:01:08
      93500 -- (-2312.200) (-2311.128) (-2309.108) [-2318.997] * (-2310.143) (-2312.437) [-2308.544] (-2316.767) -- 0:01:07
      94000 -- (-2310.486) (-2309.292) (-2312.513) [-2311.044] * (-2311.177) (-2307.810) [-2309.710] (-2310.240) -- 0:01:07
      94500 -- [-2313.831] (-2312.621) (-2310.650) (-2321.521) * [-2311.587] (-2309.424) (-2311.682) (-2311.049) -- 0:01:07
      95000 -- (-2314.566) [-2310.272] (-2310.938) (-2316.556) * [-2311.047] (-2310.139) (-2311.233) (-2312.393) -- 0:01:06

      Average standard deviation of split frequencies: 0.024552

      95500 -- (-2311.386) (-2308.865) (-2312.779) [-2315.299] * (-2310.176) (-2309.353) (-2309.098) [-2312.224] -- 0:01:06
      96000 -- (-2312.237) (-2311.495) (-2310.964) [-2313.366] * (-2311.729) (-2309.326) [-2309.299] (-2312.036) -- 0:01:15
      96500 -- (-2308.353) (-2314.766) (-2311.729) [-2311.566] * (-2309.215) (-2311.210) [-2313.493] (-2311.629) -- 0:01:14
      97000 -- [-2311.575] (-2311.335) (-2310.904) (-2313.396) * (-2310.721) (-2309.235) (-2313.663) [-2311.893] -- 0:01:14
      97500 -- [-2311.048] (-2309.665) (-2310.525) (-2315.618) * (-2311.996) (-2315.867) (-2316.725) [-2312.084] -- 0:01:14
      98000 -- (-2310.905) [-2310.893] (-2311.433) (-2326.133) * (-2311.927) [-2310.540] (-2309.026) (-2309.290) -- 0:01:13
      98500 -- (-2310.137) (-2311.123) (-2313.368) [-2320.612] * (-2312.789) (-2310.206) [-2310.070] (-2310.854) -- 0:01:13
      99000 -- (-2310.744) (-2311.765) [-2310.018] (-2315.853) * (-2311.335) (-2309.356) (-2309.965) [-2310.443] -- 0:01:12
      99500 -- [-2310.422] (-2310.366) (-2309.554) (-2323.845) * (-2313.472) [-2311.691] (-2312.844) (-2309.768) -- 0:01:12
      100000 -- [-2313.703] (-2311.646) (-2311.451) (-2318.713) * [-2312.053] (-2311.529) (-2311.513) (-2314.055) -- 0:01:12

      Average standard deviation of split frequencies: 0.021689

      100500 -- [-2310.720] (-2310.110) (-2310.545) (-2324.276) * (-2314.233) (-2308.575) [-2311.422] (-2313.900) -- 0:01:11
      101000 -- (-2309.962) [-2312.081] (-2309.688) (-2311.634) * [-2308.680] (-2310.816) (-2310.599) (-2311.000) -- 0:01:11
      101500 -- (-2310.770) (-2312.519) [-2307.856] (-2315.769) * (-2311.386) (-2312.033) [-2309.537] (-2310.601) -- 0:01:10
      102000 -- (-2311.986) (-2310.254) (-2308.423) [-2319.751] * (-2312.337) [-2312.869] (-2310.479) (-2311.063) -- 0:01:10
      102500 -- [-2309.206] (-2313.464) (-2308.239) (-2322.761) * (-2314.026) [-2309.873] (-2309.905) (-2312.360) -- 0:01:10
      103000 -- (-2311.144) [-2312.123] (-2311.133) (-2323.302) * (-2312.469) [-2309.124] (-2314.544) (-2311.458) -- 0:01:09
      103500 -- [-2313.402] (-2312.410) (-2308.378) (-2313.603) * (-2309.131) (-2309.279) (-2315.573) [-2313.268] -- 0:01:09
      104000 -- (-2313.961) (-2314.670) (-2309.565) [-2317.173] * [-2310.251] (-2312.002) (-2312.317) (-2312.690) -- 0:01:08
      104500 -- (-2319.002) (-2312.971) [-2310.717] (-2319.335) * (-2311.351) (-2310.669) [-2310.334] (-2312.607) -- 0:01:08
      105000 -- [-2313.570] (-2312.722) (-2311.391) (-2323.237) * (-2315.439) [-2307.285] (-2309.022) (-2309.171) -- 0:01:08

      Average standard deviation of split frequencies: 0.022236

      105500 -- (-2310.093) [-2310.370] (-2310.919) (-2315.067) * (-2307.293) (-2311.422) (-2311.552) [-2311.360] -- 0:01:07
      106000 -- (-2310.186) [-2311.994] (-2311.960) (-2316.754) * [-2310.359] (-2313.494) (-2312.210) (-2310.166) -- 0:01:07
      106500 -- [-2307.767] (-2313.843) (-2310.366) (-2311.141) * (-2311.435) [-2310.977] (-2311.386) (-2309.350) -- 0:01:07
      107000 -- (-2307.621) (-2314.083) (-2310.836) [-2320.327] * (-2310.282) [-2308.118] (-2311.030) (-2308.600) -- 0:01:06
      107500 -- (-2310.313) (-2313.011) (-2308.954) [-2319.673] * (-2310.581) (-2308.780) (-2310.937) [-2310.672] -- 0:01:06
      108000 -- [-2309.954] (-2311.760) (-2309.169) (-2315.908) * (-2311.902) (-2310.681) [-2311.570] (-2310.490) -- 0:01:06
      108500 -- (-2311.222) (-2311.272) (-2310.880) [-2318.727] * (-2313.300) (-2308.382) (-2311.128) [-2312.473] -- 0:01:05
      109000 -- (-2309.437) (-2312.479) (-2310.593) [-2317.795] * (-2313.904) (-2310.847) (-2312.795) [-2309.225] -- 0:01:05
      109500 -- (-2311.333) [-2311.773] (-2311.118) (-2315.219) * [-2311.434] (-2309.213) (-2314.195) (-2310.571) -- 0:01:05
      110000 -- (-2310.763) [-2315.368] (-2311.036) (-2322.602) * (-2313.486) (-2308.583) (-2313.108) [-2308.336] -- 0:01:12

      Average standard deviation of split frequencies: 0.026006

      110500 -- (-2313.811) (-2313.406) (-2311.131) [-2314.633] * (-2311.347) (-2316.206) [-2312.399] (-2308.142) -- 0:01:12
      111000 -- (-2310.940) (-2310.039) (-2309.675) [-2312.770] * (-2312.730) (-2309.270) [-2314.863] (-2311.636) -- 0:01:12
      111500 -- (-2310.906) (-2312.265) [-2307.847] (-2319.430) * (-2311.419) [-2310.385] (-2311.266) (-2313.220) -- 0:01:11
      112000 -- (-2311.001) (-2311.686) [-2309.531] (-2314.286) * [-2310.334] (-2312.311) (-2312.046) (-2313.298) -- 0:01:11
      112500 -- (-2312.786) (-2310.243) [-2310.078] (-2324.762) * (-2310.953) [-2311.293] (-2312.027) (-2311.760) -- 0:01:11
      113000 -- (-2317.302) (-2313.104) (-2311.710) [-2314.483] * (-2310.820) (-2311.171) [-2311.581] (-2315.714) -- 0:01:10
      113500 -- (-2318.389) (-2313.161) (-2310.472) [-2311.965] * [-2310.654] (-2312.843) (-2306.943) (-2313.496) -- 0:01:10
      114000 -- (-2315.403) (-2312.701) (-2309.309) [-2315.627] * (-2313.078) (-2312.646) [-2312.490] (-2312.138) -- 0:01:09
      114500 -- (-2311.169) (-2313.047) [-2309.352] (-2320.704) * (-2314.533) (-2311.324) (-2308.979) [-2309.558] -- 0:01:09
      115000 -- (-2309.751) (-2309.523) [-2309.016] (-2312.443) * (-2314.163) (-2313.539) [-2310.417] (-2309.839) -- 0:01:09

      Average standard deviation of split frequencies: 0.025025

      115500 -- (-2311.953) [-2309.381] (-2311.903) (-2313.655) * (-2312.628) (-2314.736) [-2310.757] (-2310.564) -- 0:01:08
      116000 -- (-2310.857) [-2309.335] (-2309.534) (-2310.651) * (-2313.163) (-2309.968) (-2309.113) [-2308.719] -- 0:01:08
      116500 -- [-2310.954] (-2308.929) (-2309.540) (-2311.597) * (-2314.525) (-2309.763) [-2308.755] (-2309.003) -- 0:01:08
      117000 -- [-2310.991] (-2312.720) (-2308.941) (-2311.330) * [-2311.973] (-2309.922) (-2309.081) (-2312.564) -- 0:01:07
      117500 -- (-2309.265) [-2312.487] (-2312.202) (-2309.645) * (-2316.016) (-2308.022) (-2310.806) [-2311.375] -- 0:01:07
      118000 -- [-2309.353] (-2314.863) (-2318.254) (-2310.576) * (-2312.766) (-2310.491) (-2312.237) [-2308.596] -- 0:01:07
      118500 -- [-2311.192] (-2316.094) (-2312.836) (-2310.300) * (-2317.863) (-2313.931) (-2313.448) [-2308.017] -- 0:01:06
      119000 -- (-2310.945) (-2315.355) [-2311.282] (-2312.490) * (-2312.182) [-2309.979] (-2314.344) (-2308.487) -- 0:01:06
      119500 -- (-2311.974) (-2309.006) (-2309.855) [-2310.201] * [-2311.681] (-2308.787) (-2309.790) (-2308.990) -- 0:01:06
      120000 -- (-2315.600) [-2312.549] (-2308.908) (-2311.718) * (-2313.895) (-2310.421) (-2309.163) [-2310.716] -- 0:01:06

      Average standard deviation of split frequencies: 0.024468

      120500 -- (-2313.833) [-2313.007] (-2311.236) (-2315.949) * (-2314.003) (-2310.372) (-2311.004) [-2309.130] -- 0:01:05
      121000 -- (-2314.602) (-2312.745) (-2313.472) [-2315.513] * (-2309.578) (-2310.936) [-2309.555] (-2313.628) -- 0:01:05
      121500 -- (-2314.976) (-2313.243) [-2309.481] (-2309.434) * [-2308.859] (-2311.825) (-2311.606) (-2311.863) -- 0:01:05
      122000 -- (-2318.698) [-2311.593] (-2308.428) (-2310.364) * [-2308.620] (-2311.941) (-2309.540) (-2311.668) -- 0:01:04
      122500 -- (-2313.373) (-2310.727) (-2312.918) [-2311.031] * (-2309.577) [-2312.296] (-2311.865) (-2309.334) -- 0:01:04
      123000 -- (-2310.847) (-2311.440) [-2307.501] (-2309.603) * (-2309.550) (-2312.391) [-2313.945] (-2309.317) -- 0:01:04
      123500 -- (-2312.202) (-2312.787) [-2309.942] (-2310.019) * (-2309.470) (-2311.773) (-2315.730) [-2308.767] -- 0:01:03
      124000 -- (-2317.968) (-2309.850) [-2312.316] (-2311.769) * (-2310.553) (-2311.580) (-2313.530) [-2312.278] -- 0:01:10
      124500 -- [-2313.804] (-2314.272) (-2309.245) (-2312.196) * (-2313.643) (-2310.400) (-2312.611) [-2312.431] -- 0:01:10
      125000 -- [-2312.517] (-2310.377) (-2311.303) (-2316.452) * (-2311.073) (-2312.013) (-2312.537) [-2309.857] -- 0:01:10

      Average standard deviation of split frequencies: 0.025815

      125500 -- (-2311.523) (-2315.355) (-2310.071) [-2311.848] * [-2311.368] (-2309.598) (-2308.687) (-2310.249) -- 0:01:09
      126000 -- (-2313.299) (-2312.100) (-2311.822) [-2308.483] * (-2311.990) [-2311.038] (-2311.158) (-2313.314) -- 0:01:09
      126500 -- (-2317.915) (-2311.540) (-2313.087) [-2308.684] * [-2310.322] (-2311.411) (-2309.777) (-2311.424) -- 0:01:09
      127000 -- (-2313.818) (-2311.991) [-2311.936] (-2308.633) * [-2310.430] (-2313.873) (-2310.075) (-2311.153) -- 0:01:08
      127500 -- (-2313.215) (-2319.489) (-2310.883) [-2310.874] * (-2311.490) (-2315.896) (-2309.401) [-2310.132] -- 0:01:08
      128000 -- (-2311.363) (-2313.606) (-2310.385) [-2312.318] * (-2311.243) (-2311.017) [-2309.778] (-2311.511) -- 0:01:08
      128500 -- (-2312.864) (-2309.940) (-2308.653) [-2310.026] * [-2311.875] (-2313.528) (-2309.015) (-2310.992) -- 0:01:07
      129000 -- (-2317.069) (-2312.082) (-2310.322) [-2310.333] * (-2313.586) [-2313.355] (-2311.360) (-2312.970) -- 0:01:07
      129500 -- (-2312.314) [-2309.818] (-2311.396) (-2310.561) * (-2312.622) (-2311.425) [-2310.361] (-2311.360) -- 0:01:07
      130000 -- (-2310.881) (-2311.741) [-2308.140] (-2310.442) * (-2310.988) (-2312.330) (-2314.180) [-2310.867] -- 0:01:06

      Average standard deviation of split frequencies: 0.024893

      130500 -- [-2312.114] (-2311.083) (-2311.296) (-2315.393) * [-2311.320] (-2315.706) (-2314.366) (-2310.860) -- 0:01:06
      131000 -- [-2311.121] (-2309.126) (-2309.738) (-2313.642) * (-2312.581) [-2316.007] (-2311.085) (-2311.860) -- 0:01:06
      131500 -- (-2311.604) (-2311.089) [-2309.212] (-2312.757) * (-2314.887) (-2321.105) (-2308.147) [-2310.919] -- 0:01:06
      132000 -- (-2310.780) (-2309.906) [-2310.492] (-2312.118) * (-2312.783) (-2312.944) (-2313.131) [-2310.212] -- 0:01:05
      132500 -- [-2310.282] (-2310.052) (-2312.656) (-2313.579) * (-2314.061) [-2313.608] (-2315.461) (-2310.160) -- 0:01:05
      133000 -- (-2314.900) [-2312.087] (-2311.014) (-2311.267) * [-2309.901] (-2316.233) (-2312.803) (-2313.796) -- 0:01:05
      133500 -- (-2313.569) [-2310.868] (-2313.998) (-2310.948) * [-2310.378] (-2319.164) (-2311.426) (-2312.056) -- 0:01:04
      134000 -- (-2311.464) (-2310.917) [-2309.180] (-2315.253) * [-2312.020] (-2312.652) (-2307.409) (-2315.241) -- 0:01:04
      134500 -- (-2312.081) (-2312.794) [-2310.655] (-2315.291) * [-2309.217] (-2312.303) (-2309.255) (-2314.320) -- 0:01:04
      135000 -- (-2311.138) (-2311.569) (-2313.059) [-2314.513] * [-2308.216] (-2310.228) (-2307.529) (-2309.238) -- 0:01:04

      Average standard deviation of split frequencies: 0.022074

      135500 -- [-2310.763] (-2311.824) (-2312.899) (-2310.275) * (-2309.885) (-2311.923) [-2312.431] (-2310.643) -- 0:01:03
      136000 -- (-2314.438) [-2310.201] (-2312.925) (-2312.255) * (-2310.025) [-2313.110] (-2311.198) (-2312.148) -- 0:01:03
      136500 -- (-2313.681) [-2311.195] (-2312.366) (-2310.114) * [-2310.415] (-2313.505) (-2312.552) (-2312.913) -- 0:01:03
      137000 -- (-2310.496) (-2312.107) (-2311.914) [-2307.421] * [-2311.578] (-2313.393) (-2309.448) (-2312.353) -- 0:01:02
      137500 -- [-2311.016] (-2310.716) (-2310.739) (-2311.367) * [-2309.311] (-2311.289) (-2309.678) (-2313.368) -- 0:01:02
      138000 -- (-2311.366) (-2310.745) (-2312.936) [-2310.335] * (-2310.725) (-2309.519) (-2309.564) [-2308.001] -- 0:01:08
      138500 -- [-2312.651] (-2311.736) (-2309.154) (-2314.554) * [-2309.404] (-2314.466) (-2311.189) (-2310.325) -- 0:01:08
      139000 -- (-2309.637) (-2311.864) (-2311.279) [-2311.832] * (-2313.172) (-2309.643) [-2310.353] (-2313.715) -- 0:01:08
      139500 -- (-2310.277) (-2309.930) (-2309.222) [-2309.474] * (-2314.742) (-2311.045) [-2311.038] (-2312.585) -- 0:01:07
      140000 -- (-2310.128) (-2308.788) (-2311.466) [-2311.285] * (-2312.799) (-2311.499) (-2310.692) [-2312.277] -- 0:01:07

      Average standard deviation of split frequencies: 0.022714

      140500 -- (-2310.853) [-2309.635] (-2310.902) (-2311.580) * (-2311.140) (-2309.538) [-2308.670] (-2310.982) -- 0:01:07
      141000 -- (-2310.468) (-2311.469) [-2310.557] (-2311.308) * (-2315.797) (-2312.766) [-2308.243] (-2308.387) -- 0:01:07
      141500 -- (-2310.389) (-2313.209) [-2312.180] (-2311.493) * (-2313.506) (-2309.503) [-2310.646] (-2308.972) -- 0:01:06
      142000 -- (-2310.496) (-2310.607) (-2312.671) [-2312.534] * (-2311.405) [-2309.912] (-2310.190) (-2314.823) -- 0:01:06
      142500 -- (-2310.673) (-2312.701) (-2310.662) [-2309.033] * (-2312.952) (-2310.883) [-2311.046] (-2313.218) -- 0:01:06
      143000 -- [-2311.584] (-2312.134) (-2309.944) (-2314.608) * (-2314.003) (-2309.411) (-2310.811) [-2312.301] -- 0:01:05
      143500 -- [-2310.858] (-2310.751) (-2311.419) (-2311.164) * (-2314.105) [-2308.966] (-2311.381) (-2311.218) -- 0:01:05
      144000 -- (-2312.223) (-2311.686) [-2307.785] (-2312.837) * (-2311.654) (-2310.118) [-2310.353] (-2312.755) -- 0:01:05
      144500 -- (-2312.570) (-2310.122) (-2310.403) [-2313.064] * (-2311.314) (-2308.557) (-2313.393) [-2309.741] -- 0:01:05
      145000 -- (-2313.884) (-2311.345) (-2309.481) [-2312.629] * (-2310.853) [-2309.124] (-2309.511) (-2311.122) -- 0:01:04

      Average standard deviation of split frequencies: 0.022763

      145500 -- (-2314.570) (-2310.960) (-2311.253) [-2310.767] * [-2311.877] (-2310.655) (-2314.039) (-2309.429) -- 0:01:04
      146000 -- (-2310.524) [-2311.926] (-2311.513) (-2314.982) * (-2313.380) [-2310.703] (-2312.049) (-2312.994) -- 0:01:04
      146500 -- (-2310.196) (-2311.443) [-2311.532] (-2309.382) * (-2314.872) [-2310.066] (-2309.116) (-2313.324) -- 0:01:04
      147000 -- (-2309.918) (-2311.215) (-2310.490) [-2310.311] * [-2312.667] (-2310.654) (-2311.933) (-2312.339) -- 0:01:03
      147500 -- (-2312.730) (-2312.537) [-2314.399] (-2309.857) * (-2311.718) [-2309.917] (-2313.955) (-2311.905) -- 0:01:03
      148000 -- (-2309.889) [-2311.436] (-2311.176) (-2309.094) * (-2312.646) (-2311.438) [-2310.513] (-2312.753) -- 0:01:03
      148500 -- (-2310.108) (-2312.198) [-2313.413] (-2311.314) * (-2311.698) [-2307.904] (-2311.189) (-2310.629) -- 0:01:03
      149000 -- (-2309.819) [-2310.698] (-2318.256) (-2309.651) * (-2317.874) [-2307.654] (-2311.149) (-2311.010) -- 0:01:02
      149500 -- (-2311.444) [-2311.764] (-2313.741) (-2310.484) * (-2315.468) [-2310.165] (-2312.290) (-2313.730) -- 0:01:02
      150000 -- [-2310.559] (-2313.760) (-2315.889) (-2310.478) * (-2315.691) (-2309.403) [-2312.397] (-2312.124) -- 0:01:02

      Average standard deviation of split frequencies: 0.022051

      150500 -- (-2311.053) (-2308.465) (-2311.522) [-2308.142] * [-2310.680] (-2310.808) (-2310.701) (-2310.570) -- 0:01:02
      151000 -- [-2310.362] (-2312.003) (-2308.981) (-2311.027) * [-2311.011] (-2312.153) (-2309.891) (-2312.159) -- 0:01:01
      151500 -- (-2309.780) [-2309.558] (-2313.219) (-2309.148) * (-2311.017) (-2315.062) [-2309.277] (-2310.842) -- 0:01:07
      152000 -- [-2310.786] (-2311.178) (-2312.743) (-2310.016) * (-2308.779) [-2309.353] (-2311.898) (-2310.424) -- 0:01:06
      152500 -- (-2309.153) (-2315.176) (-2312.802) [-2311.901] * (-2308.812) (-2310.549) (-2313.140) [-2310.544] -- 0:01:06
      153000 -- [-2310.900] (-2315.329) (-2311.817) (-2311.443) * (-2309.891) [-2309.339] (-2314.742) (-2309.742) -- 0:01:06
      153500 -- (-2311.221) (-2315.222) [-2313.510] (-2308.965) * (-2309.300) [-2310.609] (-2313.402) (-2314.382) -- 0:01:06
      154000 -- (-2312.208) (-2312.171) (-2311.575) [-2311.659] * (-2310.618) [-2309.580] (-2312.077) (-2308.468) -- 0:01:05
      154500 -- [-2309.964] (-2312.701) (-2311.222) (-2308.469) * (-2312.825) (-2307.170) (-2313.955) [-2308.060] -- 0:01:05
      155000 -- (-2308.055) (-2311.484) [-2312.945] (-2309.683) * (-2308.885) [-2310.483] (-2312.364) (-2310.696) -- 0:01:05

      Average standard deviation of split frequencies: 0.024016

      155500 -- (-2310.043) (-2315.418) (-2310.403) [-2309.962] * (-2310.275) (-2311.428) [-2311.450] (-2310.643) -- 0:01:05
      156000 -- (-2312.903) (-2309.848) [-2308.692] (-2310.917) * [-2308.911] (-2310.980) (-2311.732) (-2311.170) -- 0:01:04
      156500 -- (-2312.838) (-2310.150) (-2312.687) [-2309.422] * [-2309.298] (-2312.487) (-2314.007) (-2309.323) -- 0:01:04
      157000 -- [-2310.825] (-2312.953) (-2313.258) (-2308.590) * (-2310.734) [-2312.051] (-2313.974) (-2313.101) -- 0:01:04
      157500 -- (-2309.791) [-2310.733] (-2311.989) (-2308.098) * (-2310.849) (-2308.653) (-2311.781) [-2307.798] -- 0:01:04
      158000 -- (-2312.277) (-2311.330) [-2311.123] (-2308.444) * (-2308.560) (-2309.358) (-2313.887) [-2308.962] -- 0:01:03
      158500 -- (-2312.136) (-2309.917) (-2309.895) [-2309.439] * (-2309.415) (-2310.978) (-2314.718) [-2310.928] -- 0:01:03
      159000 -- (-2313.243) (-2312.458) (-2310.701) [-2313.237] * (-2309.397) [-2309.090] (-2311.166) (-2310.774) -- 0:01:03
      159500 -- [-2309.886] (-2311.415) (-2309.641) (-2308.929) * [-2312.584] (-2311.382) (-2311.166) (-2312.236) -- 0:01:03
      160000 -- (-2311.093) (-2313.536) (-2310.944) [-2309.764] * (-2311.629) (-2310.990) (-2314.816) [-2311.278] -- 0:01:02

      Average standard deviation of split frequencies: 0.021619

      160500 -- (-2310.896) [-2309.794] (-2310.685) (-2314.110) * (-2309.818) [-2308.440] (-2314.771) (-2311.601) -- 0:01:02
      161000 -- (-2312.031) (-2312.492) [-2309.738] (-2311.312) * (-2310.221) (-2310.561) (-2316.479) [-2309.587] -- 0:01:02
      161500 -- [-2311.408] (-2312.013) (-2314.757) (-2309.022) * (-2309.607) [-2311.937] (-2310.261) (-2311.648) -- 0:01:02
      162000 -- [-2311.105] (-2311.183) (-2310.779) (-2310.304) * (-2309.370) (-2315.491) (-2308.430) [-2311.481] -- 0:01:02
      162500 -- (-2309.551) (-2311.631) [-2308.488] (-2314.486) * (-2310.463) [-2311.341] (-2309.927) (-2312.246) -- 0:01:01
      163000 -- [-2308.012] (-2308.857) (-2310.232) (-2310.968) * (-2310.562) (-2310.406) [-2309.869] (-2309.391) -- 0:01:01
      163500 -- (-2308.939) (-2310.284) (-2312.380) [-2309.888] * (-2311.059) (-2311.604) [-2312.493] (-2312.498) -- 0:01:01
      164000 -- (-2309.464) [-2310.803] (-2311.217) (-2312.202) * [-2307.769] (-2308.926) (-2313.285) (-2313.005) -- 0:01:01
      164500 -- (-2313.300) (-2308.940) [-2311.243] (-2310.309) * (-2310.083) (-2308.342) [-2313.481] (-2311.052) -- 0:01:00
      165000 -- [-2311.031] (-2310.671) (-2310.774) (-2308.945) * (-2310.539) [-2307.488] (-2313.516) (-2309.125) -- 0:01:00

      Average standard deviation of split frequencies: 0.019879

      165500 -- (-2311.203) (-2312.701) (-2312.234) [-2309.976] * [-2309.020] (-2312.791) (-2313.904) (-2310.213) -- 0:01:05
      166000 -- (-2312.098) (-2312.446) [-2313.455] (-2310.146) * (-2310.173) [-2313.671] (-2315.773) (-2309.703) -- 0:01:05
      166500 -- (-2308.389) (-2312.823) [-2311.666] (-2309.943) * (-2308.891) (-2311.615) (-2310.776) [-2310.210] -- 0:01:05
      167000 -- (-2313.622) (-2311.345) (-2311.243) [-2308.957] * [-2314.356] (-2311.939) (-2311.418) (-2309.032) -- 0:01:04
      167500 -- (-2314.643) (-2310.725) (-2310.823) [-2308.763] * (-2316.014) (-2308.913) (-2309.508) [-2309.359] -- 0:01:04
      168000 -- (-2312.377) (-2309.993) (-2312.115) [-2308.280] * (-2311.244) [-2310.833] (-2310.302) (-2317.025) -- 0:01:04
      168500 -- (-2313.720) (-2309.659) [-2312.157] (-2310.824) * [-2309.033] (-2311.486) (-2309.390) (-2310.404) -- 0:01:04
      169000 -- (-2311.414) (-2314.417) [-2310.484] (-2311.523) * (-2310.191) (-2312.570) [-2312.863] (-2310.826) -- 0:01:03
      169500 -- [-2311.689] (-2312.181) (-2310.509) (-2312.150) * [-2311.643] (-2312.690) (-2312.125) (-2311.295) -- 0:01:03
      170000 -- (-2307.557) (-2311.025) (-2309.961) [-2313.213] * (-2308.357) (-2312.882) [-2310.677] (-2309.797) -- 0:01:03

      Average standard deviation of split frequencies: 0.019480

      170500 -- [-2308.439] (-2310.909) (-2308.788) (-2313.288) * [-2310.351] (-2314.675) (-2310.629) (-2309.821) -- 0:01:03
      171000 -- (-2313.401) (-2311.267) (-2310.936) [-2316.578] * (-2313.391) (-2309.207) (-2311.569) [-2310.014] -- 0:01:03
      171500 -- (-2312.666) [-2311.190] (-2308.569) (-2316.823) * (-2312.321) (-2310.528) (-2309.789) [-2313.477] -- 0:01:02
      172000 -- (-2311.686) (-2310.834) [-2312.050] (-2315.536) * [-2310.502] (-2312.374) (-2310.361) (-2314.197) -- 0:01:02
      172500 -- [-2307.953] (-2310.536) (-2309.527) (-2316.939) * (-2314.602) (-2311.795) (-2310.585) [-2309.070] -- 0:01:02
      173000 -- (-2310.282) (-2311.427) [-2311.948] (-2315.853) * (-2309.106) [-2310.015] (-2314.274) (-2310.315) -- 0:01:02
      173500 -- [-2314.449] (-2310.974) (-2309.841) (-2312.274) * (-2308.797) (-2308.918) (-2311.612) [-2310.536] -- 0:01:01
      174000 -- (-2312.996) (-2310.549) [-2312.107] (-2311.630) * [-2311.917] (-2309.760) (-2312.257) (-2313.656) -- 0:01:01
      174500 -- (-2311.696) [-2311.086] (-2312.433) (-2310.663) * [-2308.393] (-2311.218) (-2313.886) (-2315.890) -- 0:01:01
      175000 -- (-2311.654) (-2310.081) [-2312.881] (-2314.508) * (-2308.965) [-2310.383] (-2310.369) (-2310.951) -- 0:01:01

      Average standard deviation of split frequencies: 0.019172

      175500 -- (-2309.197) [-2314.709] (-2310.343) (-2309.471) * (-2309.858) (-2311.156) [-2310.314] (-2311.175) -- 0:01:01
      176000 -- (-2308.765) (-2316.286) (-2310.516) [-2308.071] * (-2311.181) (-2310.435) (-2310.793) [-2313.771] -- 0:01:00
      176500 -- (-2312.193) (-2310.252) (-2313.638) [-2310.906] * (-2311.858) (-2311.434) [-2314.189] (-2313.687) -- 0:01:00
      177000 -- (-2317.317) (-2311.413) [-2312.013] (-2314.970) * (-2312.192) [-2312.194] (-2314.810) (-2310.507) -- 0:01:00
      177500 -- (-2312.621) (-2311.411) [-2312.421] (-2311.184) * [-2314.048] (-2310.084) (-2309.975) (-2311.852) -- 0:01:00
      178000 -- (-2311.953) (-2311.897) (-2312.124) [-2311.462] * [-2316.723] (-2310.902) (-2309.742) (-2313.948) -- 0:01:00
      178500 -- (-2315.225) (-2311.796) [-2309.795] (-2311.554) * (-2316.974) (-2312.740) [-2307.641] (-2312.425) -- 0:00:59
      179000 -- (-2313.298) (-2314.192) (-2310.441) [-2309.762] * (-2317.065) (-2311.746) (-2309.419) [-2314.629] -- 0:00:59
      179500 -- (-2315.167) [-2312.754] (-2311.780) (-2310.962) * [-2309.243] (-2310.367) (-2310.683) (-2312.782) -- 0:01:03
      180000 -- (-2310.963) (-2312.138) (-2311.096) [-2311.044] * (-2315.602) (-2309.012) [-2310.254] (-2314.973) -- 0:01:03

      Average standard deviation of split frequencies: 0.018410

      180500 -- (-2314.059) (-2313.386) (-2309.297) [-2311.260] * [-2313.625] (-2312.286) (-2310.109) (-2309.289) -- 0:01:03
      181000 -- [-2312.261] (-2312.589) (-2308.685) (-2314.944) * [-2309.259] (-2309.867) (-2310.514) (-2314.923) -- 0:01:03
      181500 -- (-2308.994) (-2312.468) [-2311.876] (-2313.939) * [-2310.711] (-2309.706) (-2311.433) (-2317.596) -- 0:01:03
      182000 -- (-2311.037) (-2310.686) (-2315.392) [-2309.644] * (-2309.645) [-2310.988] (-2313.892) (-2311.767) -- 0:01:02
      182500 -- (-2310.224) (-2311.589) (-2313.317) [-2313.146] * [-2312.252] (-2311.120) (-2312.471) (-2312.570) -- 0:01:02
      183000 -- (-2310.561) (-2310.747) (-2310.714) [-2308.895] * [-2313.259] (-2311.222) (-2315.177) (-2309.966) -- 0:01:02
      183500 -- [-2309.815] (-2311.934) (-2310.387) (-2311.459) * (-2309.605) [-2311.392] (-2313.246) (-2314.014) -- 0:01:02
      184000 -- (-2310.893) [-2311.103] (-2309.152) (-2309.262) * [-2311.735] (-2311.422) (-2311.117) (-2310.430) -- 0:01:02
      184500 -- (-2310.646) (-2311.768) (-2313.687) [-2309.047] * [-2311.291] (-2309.771) (-2313.582) (-2311.594) -- 0:01:01
      185000 -- (-2309.190) [-2310.637] (-2310.003) (-2308.939) * (-2310.935) (-2311.766) [-2311.594] (-2313.079) -- 0:01:01

      Average standard deviation of split frequencies: 0.019609

      185500 -- (-2313.431) (-2310.512) [-2308.549] (-2308.767) * (-2311.755) (-2313.639) [-2311.850] (-2310.687) -- 0:01:01
      186000 -- (-2317.906) [-2309.415] (-2311.118) (-2313.261) * (-2313.056) (-2313.574) [-2310.020] (-2310.229) -- 0:01:01
      186500 -- (-2313.451) [-2310.966] (-2312.252) (-2315.931) * (-2311.524) (-2314.354) [-2310.778] (-2310.315) -- 0:01:01
      187000 -- [-2312.233] (-2311.880) (-2310.302) (-2316.182) * (-2312.827) (-2310.629) [-2311.335] (-2311.517) -- 0:01:00
      187500 -- [-2309.532] (-2312.025) (-2312.256) (-2312.027) * (-2312.073) (-2314.518) (-2310.788) [-2312.020] -- 0:01:00
      188000 -- [-2310.026] (-2311.984) (-2313.304) (-2308.755) * [-2310.539] (-2309.648) (-2311.579) (-2309.749) -- 0:01:00
      188500 -- (-2311.391) (-2313.295) [-2308.625] (-2308.620) * [-2310.104] (-2308.054) (-2313.044) (-2311.352) -- 0:01:00
      189000 -- (-2309.140) (-2314.198) [-2307.233] (-2310.732) * [-2309.303] (-2308.220) (-2311.309) (-2310.864) -- 0:01:00
      189500 -- [-2314.312] (-2316.255) (-2311.527) (-2310.096) * (-2311.078) (-2309.415) (-2311.625) [-2308.500] -- 0:00:59
      190000 -- (-2314.263) (-2313.812) (-2309.809) [-2306.622] * (-2310.937) [-2311.166] (-2310.031) (-2313.054) -- 0:00:59

      Average standard deviation of split frequencies: 0.020820

      190500 -- (-2311.023) (-2313.118) (-2310.041) [-2308.935] * [-2309.180] (-2312.199) (-2309.715) (-2310.685) -- 0:00:59
      191000 -- [-2311.054] (-2310.452) (-2311.705) (-2309.959) * (-2312.478) (-2310.598) (-2310.030) [-2311.300] -- 0:00:59
      191500 -- (-2312.632) (-2311.906) [-2308.772] (-2307.948) * (-2312.896) (-2311.583) (-2312.091) [-2312.707] -- 0:00:59
      192000 -- (-2312.420) (-2310.546) [-2311.447] (-2311.396) * (-2312.141) [-2311.227] (-2310.319) (-2310.219) -- 0:00:58
      192500 -- [-2311.367] (-2310.954) (-2312.195) (-2312.716) * (-2311.703) [-2312.612] (-2310.773) (-2309.657) -- 0:00:58
      193000 -- [-2312.274] (-2312.995) (-2309.567) (-2311.780) * (-2316.827) (-2311.865) (-2310.097) [-2309.558] -- 0:00:58
      193500 -- (-2311.740) (-2315.150) (-2307.965) [-2310.262] * (-2311.289) (-2312.545) (-2311.314) [-2308.893] -- 0:01:02
      194000 -- [-2311.477] (-2314.245) (-2307.498) (-2310.051) * [-2309.527] (-2309.967) (-2310.672) (-2314.505) -- 0:01:02
      194500 -- (-2309.731) (-2314.604) [-2307.709] (-2313.109) * (-2312.610) (-2309.125) [-2312.354] (-2310.972) -- 0:01:02
      195000 -- (-2310.094) [-2313.864] (-2308.712) (-2309.266) * [-2311.202] (-2312.714) (-2312.910) (-2310.711) -- 0:01:01

      Average standard deviation of split frequencies: 0.021646

      195500 -- [-2309.262] (-2317.177) (-2312.696) (-2311.538) * (-2310.898) (-2308.958) (-2310.802) [-2310.391] -- 0:01:01
      196000 -- (-2311.875) [-2313.567] (-2311.314) (-2309.342) * (-2311.907) (-2309.417) (-2311.097) [-2309.038] -- 0:01:01
      196500 -- (-2313.455) (-2309.342) [-2311.645] (-2313.010) * (-2313.592) [-2310.546] (-2312.622) (-2312.349) -- 0:01:01
      197000 -- (-2314.126) [-2310.087] (-2308.885) (-2309.709) * [-2310.124] (-2314.406) (-2313.258) (-2317.057) -- 0:01:01
      197500 -- (-2314.239) [-2310.090] (-2308.493) (-2308.240) * [-2311.052] (-2317.203) (-2313.197) (-2315.291) -- 0:01:00
      198000 -- (-2311.807) (-2315.791) (-2312.649) [-2311.684] * [-2310.506] (-2315.585) (-2313.245) (-2313.803) -- 0:01:00
      198500 -- (-2313.382) [-2309.909] (-2311.098) (-2312.410) * (-2309.963) (-2309.781) (-2311.101) [-2312.650] -- 0:01:00
      199000 -- (-2310.710) [-2311.664] (-2313.163) (-2311.870) * (-2309.659) (-2312.864) (-2311.226) [-2311.056] -- 0:01:00
      199500 -- (-2312.431) [-2314.257] (-2312.588) (-2309.440) * (-2310.352) (-2310.041) (-2311.240) [-2312.635] -- 0:01:00
      200000 -- (-2312.974) (-2311.698) (-2312.674) [-2310.481] * (-2309.114) (-2310.182) [-2314.196] (-2312.350) -- 0:00:59

      Average standard deviation of split frequencies: 0.022379

      200500 -- (-2315.497) (-2308.384) (-2312.830) [-2309.224] * (-2311.896) [-2311.653] (-2307.721) (-2315.455) -- 0:00:59
      201000 -- (-2309.035) [-2310.443] (-2312.583) (-2311.234) * (-2310.961) (-2308.658) [-2310.516] (-2312.927) -- 0:00:59
      201500 -- (-2314.222) (-2311.937) [-2311.670] (-2311.591) * (-2310.245) (-2309.793) [-2309.653] (-2309.373) -- 0:00:59
      202000 -- (-2313.243) (-2313.037) [-2312.806] (-2310.459) * (-2311.387) (-2309.287) [-2309.677] (-2312.592) -- 0:00:59
      202500 -- (-2310.664) (-2315.388) (-2312.298) [-2311.600] * (-2308.633) (-2307.877) (-2310.857) [-2310.427] -- 0:00:59
      203000 -- (-2310.500) (-2309.360) [-2309.697] (-2312.716) * (-2309.052) (-2309.451) (-2311.254) [-2310.727] -- 0:00:58
      203500 -- [-2311.294] (-2309.710) (-2314.599) (-2311.683) * [-2309.412] (-2311.227) (-2308.099) (-2309.736) -- 0:00:58
      204000 -- [-2309.784] (-2309.667) (-2312.688) (-2312.049) * (-2308.190) [-2310.360] (-2311.109) (-2311.762) -- 0:00:58
      204500 -- [-2311.997] (-2310.521) (-2314.098) (-2312.574) * (-2310.690) [-2312.045] (-2312.001) (-2310.063) -- 0:00:58
      205000 -- (-2311.975) [-2313.199] (-2310.190) (-2309.757) * (-2311.134) (-2309.810) (-2313.733) [-2313.164] -- 0:00:58

      Average standard deviation of split frequencies: 0.020595

      205500 -- (-2315.353) (-2310.120) (-2312.465) [-2312.928] * (-2308.578) (-2309.215) [-2311.276] (-2310.703) -- 0:00:57
      206000 -- (-2312.341) (-2312.409) (-2312.058) [-2310.072] * (-2308.469) (-2310.865) (-2312.755) [-2309.016] -- 0:00:57
      206500 -- (-2312.576) [-2312.322] (-2315.694) (-2312.499) * [-2312.687] (-2311.649) (-2308.334) (-2310.277) -- 0:00:57
      207000 -- (-2313.739) (-2312.458) (-2312.582) [-2312.191] * [-2309.773] (-2310.253) (-2310.789) (-2310.384) -- 0:01:01
      207500 -- (-2313.684) (-2320.490) (-2309.351) [-2308.440] * [-2308.029] (-2311.024) (-2308.568) (-2311.436) -- 0:01:01
      208000 -- (-2313.134) [-2309.677] (-2310.667) (-2308.558) * [-2310.355] (-2311.191) (-2306.975) (-2313.680) -- 0:01:00
      208500 -- (-2309.422) (-2313.873) [-2316.678] (-2308.288) * (-2307.750) (-2309.229) [-2310.527] (-2316.036) -- 0:01:00
      209000 -- (-2308.998) (-2313.846) (-2314.903) [-2308.652] * [-2308.504] (-2308.298) (-2310.991) (-2309.850) -- 0:01:00
      209500 -- (-2312.519) (-2314.118) [-2308.459] (-2311.084) * [-2308.378] (-2309.038) (-2311.082) (-2311.503) -- 0:01:00
      210000 -- [-2310.268] (-2309.767) (-2309.154) (-2310.984) * (-2309.548) (-2311.294) (-2311.564) [-2310.300] -- 0:01:00

      Average standard deviation of split frequencies: 0.018961

      210500 -- [-2308.759] (-2309.016) (-2311.314) (-2313.568) * (-2310.224) (-2311.102) (-2307.471) [-2309.079] -- 0:01:00
      211000 -- [-2309.590] (-2312.607) (-2311.161) (-2310.816) * [-2308.603] (-2310.564) (-2308.963) (-2309.696) -- 0:00:59
      211500 -- (-2311.030) (-2313.207) (-2311.644) [-2312.632] * (-2309.348) (-2313.698) (-2310.901) [-2312.217] -- 0:00:59
      212000 -- (-2313.016) [-2311.112] (-2311.869) (-2312.242) * (-2308.638) (-2309.185) [-2313.945] (-2313.891) -- 0:00:59
      212500 -- (-2311.025) (-2308.018) [-2310.726] (-2314.278) * (-2310.782) (-2309.234) [-2308.903] (-2310.650) -- 0:00:59
      213000 -- (-2310.690) [-2309.198] (-2310.039) (-2315.706) * (-2310.485) (-2311.345) (-2308.148) [-2308.902] -- 0:00:59
      213500 -- (-2310.919) (-2310.239) [-2310.394] (-2309.688) * (-2309.828) (-2310.998) (-2310.240) [-2308.636] -- 0:00:58
      214000 -- (-2311.139) (-2309.281) [-2309.775] (-2312.381) * [-2311.209] (-2308.089) (-2308.541) (-2310.241) -- 0:00:58
      214500 -- (-2311.648) (-2312.025) (-2310.613) [-2310.743] * [-2311.082] (-2311.505) (-2312.766) (-2312.795) -- 0:00:58
      215000 -- (-2311.912) (-2311.428) (-2311.199) [-2312.488] * (-2315.191) (-2310.281) [-2310.532] (-2311.034) -- 0:00:58

      Average standard deviation of split frequencies: 0.018615

      215500 -- (-2309.824) [-2311.716] (-2313.021) (-2314.290) * (-2312.549) (-2310.969) (-2309.390) [-2310.296] -- 0:00:58
      216000 -- (-2313.013) (-2311.092) (-2310.130) [-2312.317] * [-2315.395] (-2312.190) (-2312.331) (-2311.569) -- 0:00:58
      216500 -- (-2312.894) (-2308.412) [-2310.317] (-2310.935) * [-2313.474] (-2311.285) (-2310.010) (-2311.518) -- 0:00:57
      217000 -- [-2311.629] (-2309.641) (-2311.191) (-2310.803) * (-2311.038) [-2311.660] (-2312.686) (-2312.346) -- 0:00:57
      217500 -- (-2312.398) [-2308.911] (-2311.186) (-2310.171) * [-2309.482] (-2312.157) (-2312.134) (-2309.912) -- 0:00:57
      218000 -- [-2313.199] (-2307.526) (-2311.571) (-2311.234) * (-2312.783) [-2314.025] (-2311.640) (-2311.868) -- 0:00:57
      218500 -- (-2309.820) (-2311.339) (-2314.268) [-2311.379] * (-2311.168) (-2312.334) (-2309.843) [-2309.656] -- 0:00:57
      219000 -- (-2311.128) [-2310.049] (-2311.477) (-2311.622) * [-2309.274] (-2312.505) (-2317.294) (-2309.317) -- 0:00:57
      219500 -- [-2308.563] (-2315.612) (-2313.360) (-2310.201) * (-2311.609) (-2309.842) (-2312.954) [-2309.700] -- 0:00:56
      220000 -- (-2309.525) (-2309.242) [-2310.870] (-2310.293) * (-2310.688) (-2313.778) [-2312.142] (-2311.768) -- 0:00:56

      Average standard deviation of split frequencies: 0.017342

      220500 -- (-2309.381) [-2312.098] (-2310.691) (-2310.342) * (-2311.334) (-2308.262) [-2309.612] (-2313.847) -- 0:00:56
      221000 -- (-2311.106) (-2312.197) (-2312.489) [-2310.669] * (-2316.090) (-2308.957) [-2311.173] (-2316.550) -- 0:00:59
      221500 -- (-2308.286) (-2312.908) [-2311.951] (-2314.305) * (-2312.235) [-2311.865] (-2311.921) (-2311.034) -- 0:00:59
      222000 -- (-2310.909) [-2309.732] (-2312.081) (-2312.333) * [-2312.864] (-2314.414) (-2312.641) (-2312.493) -- 0:00:59
      222500 -- (-2311.454) (-2309.647) [-2310.529] (-2312.610) * (-2309.913) [-2311.109] (-2312.555) (-2310.888) -- 0:00:59
      223000 -- (-2313.997) (-2310.959) [-2310.894] (-2312.039) * (-2308.832) [-2310.333] (-2313.419) (-2312.029) -- 0:00:59
      223500 -- (-2312.403) (-2311.811) (-2311.569) [-2310.360] * (-2310.035) [-2309.877] (-2310.167) (-2310.308) -- 0:00:59
      224000 -- (-2309.276) (-2313.230) [-2314.895] (-2310.836) * (-2311.828) (-2311.077) [-2310.696] (-2312.245) -- 0:00:58
      224500 -- (-2310.773) (-2310.795) [-2311.332] (-2310.751) * [-2311.079] (-2313.785) (-2311.803) (-2309.977) -- 0:00:58
      225000 -- (-2310.342) (-2312.819) [-2310.681] (-2312.253) * (-2310.978) (-2312.173) [-2308.916] (-2313.780) -- 0:00:58

      Average standard deviation of split frequencies: 0.017894

      225500 -- (-2309.248) [-2308.834] (-2310.432) (-2310.816) * [-2310.992] (-2310.151) (-2312.035) (-2311.103) -- 0:00:58
      226000 -- (-2310.800) (-2312.162) (-2311.154) [-2309.418] * (-2309.626) [-2307.985] (-2309.457) (-2309.170) -- 0:00:58
      226500 -- [-2309.715] (-2313.297) (-2313.207) (-2310.577) * (-2311.277) (-2309.171) (-2308.440) [-2311.850] -- 0:00:58
      227000 -- (-2309.130) (-2312.223) (-2311.330) [-2310.743] * [-2312.394] (-2311.781) (-2310.465) (-2316.645) -- 0:00:57
      227500 -- [-2308.656] (-2309.108) (-2312.518) (-2311.387) * (-2311.542) (-2311.762) [-2308.275] (-2309.418) -- 0:00:57
      228000 -- (-2309.557) (-2309.592) (-2313.667) [-2313.858] * (-2311.844) (-2312.290) (-2309.059) [-2309.242] -- 0:00:57
      228500 -- [-2310.568] (-2310.426) (-2314.427) (-2316.288) * (-2308.514) (-2311.649) [-2311.174] (-2313.010) -- 0:00:57
      229000 -- (-2310.204) (-2312.156) (-2311.149) [-2314.716] * [-2310.642] (-2311.548) (-2310.957) (-2312.655) -- 0:00:57
      229500 -- (-2311.508) (-2309.951) (-2311.559) [-2314.088] * (-2309.677) (-2309.258) (-2309.323) [-2311.021] -- 0:00:57
      230000 -- (-2311.643) (-2310.105) (-2311.462) [-2313.329] * (-2310.746) [-2308.389] (-2310.722) (-2309.029) -- 0:00:56

      Average standard deviation of split frequencies: 0.019114

      230500 -- (-2313.366) (-2309.464) [-2309.351] (-2312.799) * (-2310.818) (-2308.199) [-2308.223] (-2312.701) -- 0:00:56
      231000 -- (-2311.498) [-2309.983] (-2311.918) (-2311.544) * (-2311.271) (-2311.997) (-2310.054) [-2311.373] -- 0:00:56
      231500 -- (-2308.352) [-2314.296] (-2312.066) (-2312.927) * (-2310.242) (-2312.415) [-2311.725] (-2313.925) -- 0:00:56
      232000 -- (-2308.155) (-2315.617) [-2311.971] (-2312.558) * (-2310.902) (-2312.238) [-2311.551] (-2312.207) -- 0:00:56
      232500 -- (-2309.403) (-2316.732) (-2314.480) [-2311.418] * (-2310.085) (-2310.691) (-2309.998) [-2309.952] -- 0:00:56
      233000 -- (-2311.547) (-2311.558) (-2313.747) [-2311.194] * (-2309.976) (-2315.845) (-2309.501) [-2312.245] -- 0:00:55
      233500 -- (-2311.241) (-2310.292) [-2310.407] (-2313.452) * (-2310.445) (-2315.980) [-2309.534] (-2314.495) -- 0:00:55
      234000 -- (-2312.314) (-2312.880) [-2312.554] (-2310.547) * [-2311.182] (-2312.656) (-2309.240) (-2318.567) -- 0:00:55
      234500 -- [-2309.770] (-2310.090) (-2312.311) (-2311.071) * (-2308.993) (-2318.272) (-2309.182) [-2311.443] -- 0:00:55
      235000 -- (-2311.313) (-2312.667) [-2312.406] (-2309.924) * [-2311.897] (-2310.936) (-2310.923) (-2308.990) -- 0:00:58

      Average standard deviation of split frequencies: 0.017742

      235500 -- (-2312.093) (-2309.255) (-2311.434) [-2309.766] * (-2314.086) [-2311.647] (-2312.772) (-2307.844) -- 0:00:58
      236000 -- (-2312.195) (-2308.279) (-2312.926) [-2310.792] * (-2315.461) (-2317.872) [-2310.053] (-2309.887) -- 0:00:58
      236500 -- [-2309.812] (-2311.650) (-2314.011) (-2311.463) * [-2310.029] (-2322.897) (-2308.947) (-2309.179) -- 0:00:58
      237000 -- [-2311.227] (-2307.945) (-2312.122) (-2311.810) * (-2310.122) (-2312.264) [-2309.056] (-2312.645) -- 0:00:57
      237500 -- (-2310.964) [-2308.734] (-2311.904) (-2311.464) * (-2311.193) (-2313.877) (-2313.108) [-2312.324] -- 0:00:57
      238000 -- (-2315.496) (-2307.544) (-2312.034) [-2308.596] * [-2312.933] (-2312.014) (-2310.680) (-2311.635) -- 0:00:57
      238500 -- (-2309.352) [-2309.971] (-2310.548) (-2311.371) * (-2311.130) (-2314.017) (-2312.054) [-2310.809] -- 0:00:57
      239000 -- [-2312.360] (-2310.564) (-2310.821) (-2316.047) * [-2313.827] (-2318.907) (-2314.635) (-2312.365) -- 0:00:57
      239500 -- (-2310.807) [-2314.561] (-2310.758) (-2315.185) * (-2311.429) (-2316.180) [-2309.355] (-2311.581) -- 0:00:57
      240000 -- [-2310.139] (-2319.286) (-2312.255) (-2315.235) * (-2309.381) [-2313.519] (-2307.523) (-2311.170) -- 0:00:56

      Average standard deviation of split frequencies: 0.017859

      240500 -- (-2309.829) (-2315.065) (-2313.948) [-2312.881] * (-2310.303) [-2315.744] (-2314.128) (-2312.047) -- 0:00:56
      241000 -- (-2309.906) (-2318.542) [-2310.979] (-2315.394) * (-2311.787) [-2310.965] (-2309.898) (-2311.806) -- 0:00:56
      241500 -- [-2308.964] (-2311.576) (-2311.281) (-2313.722) * (-2314.902) (-2317.649) [-2308.964] (-2317.141) -- 0:00:56
      242000 -- (-2312.652) [-2308.075] (-2314.280) (-2312.057) * (-2311.747) (-2313.056) [-2309.681] (-2311.437) -- 0:00:56
      242500 -- (-2313.853) [-2309.850] (-2312.754) (-2311.044) * (-2310.973) (-2308.737) [-2310.011] (-2312.607) -- 0:00:56
      243000 -- (-2310.651) (-2309.940) (-2315.019) [-2311.617] * (-2310.876) (-2313.078) [-2308.584] (-2311.796) -- 0:00:56
      243500 -- (-2310.213) (-2310.325) [-2314.744] (-2313.117) * (-2311.004) [-2310.782] (-2310.871) (-2316.143) -- 0:00:55
      244000 -- [-2310.198] (-2313.835) (-2313.641) (-2315.827) * (-2309.448) (-2310.242) (-2309.580) [-2314.391] -- 0:00:55
      244500 -- (-2311.213) (-2309.881) (-2312.940) [-2311.938] * [-2310.610] (-2316.557) (-2312.630) (-2310.486) -- 0:00:55
      245000 -- (-2311.953) (-2308.996) [-2310.958] (-2312.993) * (-2309.562) [-2310.453] (-2309.955) (-2309.850) -- 0:00:55

      Average standard deviation of split frequencies: 0.017885

      245500 -- (-2311.367) (-2310.030) [-2309.972] (-2313.714) * (-2316.501) (-2312.142) [-2314.866] (-2310.015) -- 0:00:55
      246000 -- [-2308.409] (-2318.371) (-2313.411) (-2313.397) * (-2309.693) (-2310.006) [-2313.698] (-2311.120) -- 0:00:55
      246500 -- (-2308.865) [-2312.175] (-2310.192) (-2314.221) * (-2312.688) [-2309.543] (-2312.088) (-2312.015) -- 0:00:55
      247000 -- (-2314.117) (-2310.114) [-2310.860] (-2313.627) * (-2313.309) (-2309.588) (-2310.906) [-2311.418] -- 0:00:54
      247500 -- (-2314.391) [-2311.356] (-2313.303) (-2310.876) * (-2308.220) [-2311.092] (-2314.869) (-2311.843) -- 0:00:54
      248000 -- (-2311.649) (-2312.538) [-2312.186] (-2311.454) * (-2312.723) [-2308.999] (-2309.120) (-2308.460) -- 0:00:54
      248500 -- (-2315.271) (-2314.198) [-2311.577] (-2314.783) * (-2311.721) (-2308.902) [-2309.856] (-2312.345) -- 0:00:54
      249000 -- (-2312.479) [-2312.358] (-2316.669) (-2312.143) * (-2309.759) [-2310.800] (-2310.747) (-2312.270) -- 0:00:57
      249500 -- [-2311.239] (-2311.261) (-2311.515) (-2315.740) * [-2310.705] (-2311.601) (-2311.893) (-2311.835) -- 0:00:57
      250000 -- (-2312.162) [-2308.903] (-2313.728) (-2313.515) * (-2311.724) [-2310.504] (-2311.034) (-2310.946) -- 0:00:57

      Average standard deviation of split frequencies: 0.017134

      250500 -- [-2309.676] (-2308.545) (-2312.068) (-2310.962) * [-2313.085] (-2311.903) (-2309.941) (-2308.755) -- 0:00:56
      251000 -- (-2312.211) (-2310.641) (-2312.288) [-2310.439] * (-2312.039) (-2309.788) [-2308.256] (-2310.897) -- 0:00:56
      251500 -- (-2310.394) (-2309.004) (-2312.441) [-2309.737] * (-2311.211) [-2311.722] (-2310.469) (-2314.547) -- 0:00:56
      252000 -- [-2308.942] (-2307.079) (-2313.962) (-2311.244) * (-2314.643) [-2308.779] (-2310.735) (-2313.887) -- 0:00:56
      252500 -- (-2309.659) (-2310.607) (-2315.149) [-2310.833] * (-2312.548) [-2313.277] (-2311.821) (-2309.720) -- 0:00:56
      253000 -- (-2311.944) (-2310.687) [-2311.459] (-2310.277) * (-2312.657) (-2313.730) [-2311.855] (-2313.828) -- 0:00:56
      253500 -- (-2310.962) [-2313.971] (-2311.474) (-2308.408) * [-2307.632] (-2318.427) (-2313.429) (-2315.199) -- 0:00:55
      254000 -- (-2310.412) [-2309.284] (-2312.129) (-2310.630) * (-2308.860) [-2310.796] (-2312.550) (-2317.813) -- 0:00:55
      254500 -- (-2317.731) (-2312.399) [-2317.138] (-2310.724) * (-2311.105) [-2310.216] (-2312.581) (-2314.468) -- 0:00:55
      255000 -- (-2312.736) (-2314.256) [-2314.049] (-2314.014) * (-2312.267) (-2310.597) (-2312.092) [-2311.164] -- 0:00:55

      Average standard deviation of split frequencies: 0.017187

      255500 -- (-2310.796) [-2309.871] (-2312.336) (-2312.198) * (-2310.285) (-2311.222) [-2312.455] (-2313.052) -- 0:00:55
      256000 -- (-2310.897) (-2307.626) (-2312.082) [-2312.431] * [-2311.912] (-2309.141) (-2314.009) (-2314.360) -- 0:00:55
      256500 -- (-2310.574) [-2310.297] (-2311.594) (-2312.016) * [-2308.756] (-2315.455) (-2313.873) (-2315.441) -- 0:00:55
      257000 -- (-2312.205) [-2312.305] (-2314.282) (-2313.973) * (-2310.581) [-2311.904] (-2316.630) (-2312.763) -- 0:00:54
      257500 -- [-2310.055] (-2309.631) (-2311.106) (-2310.854) * (-2311.129) (-2314.007) (-2313.002) [-2311.844] -- 0:00:54
      258000 -- (-2310.128) [-2308.905] (-2317.255) (-2309.642) * [-2309.131] (-2314.315) (-2313.200) (-2310.905) -- 0:00:54
      258500 -- [-2313.001] (-2311.257) (-2312.004) (-2310.307) * [-2313.672] (-2313.053) (-2307.912) (-2311.203) -- 0:00:54
      259000 -- (-2314.368) [-2311.723] (-2313.036) (-2312.823) * [-2311.939] (-2311.391) (-2310.866) (-2311.145) -- 0:00:54
      259500 -- (-2315.382) (-2314.414) (-2311.553) [-2309.344] * (-2311.944) [-2313.581] (-2316.362) (-2310.943) -- 0:00:54
      260000 -- [-2310.776] (-2312.568) (-2313.543) (-2311.564) * (-2311.171) (-2312.053) (-2308.363) [-2313.439] -- 0:00:54

      Average standard deviation of split frequencies: 0.017281

      260500 -- (-2313.116) (-2314.445) (-2310.516) [-2312.433] * (-2315.195) (-2313.018) (-2310.596) [-2308.496] -- 0:00:53
      261000 -- (-2313.893) (-2313.122) [-2312.723] (-2314.156) * [-2313.758] (-2309.020) (-2312.109) (-2311.883) -- 0:00:53
      261500 -- (-2313.752) [-2311.134] (-2311.633) (-2310.528) * (-2311.531) [-2314.784] (-2310.351) (-2311.646) -- 0:00:53
      262000 -- (-2310.984) [-2311.656] (-2312.769) (-2311.968) * (-2312.076) [-2314.328] (-2309.794) (-2311.710) -- 0:00:53
      262500 -- (-2312.351) (-2311.924) [-2308.161] (-2311.185) * [-2314.431] (-2312.959) (-2312.079) (-2311.797) -- 0:00:56
      263000 -- (-2313.426) (-2310.252) [-2311.617] (-2309.603) * (-2312.485) (-2310.059) [-2311.947] (-2314.262) -- 0:00:56
      263500 -- [-2310.991] (-2310.199) (-2308.491) (-2310.436) * (-2313.026) [-2311.354] (-2311.565) (-2311.529) -- 0:00:55
      264000 -- (-2312.723) [-2311.865] (-2309.961) (-2312.661) * (-2310.527) (-2314.108) [-2312.596] (-2310.283) -- 0:00:55
      264500 -- [-2312.284] (-2311.010) (-2308.911) (-2311.981) * (-2311.105) (-2313.267) [-2318.263] (-2313.732) -- 0:00:55
      265000 -- (-2311.924) (-2308.843) (-2310.227) [-2309.980] * (-2312.272) (-2313.012) (-2310.676) [-2314.116] -- 0:00:55

      Average standard deviation of split frequencies: 0.015950

      265500 -- [-2312.452] (-2312.318) (-2310.398) (-2311.435) * (-2308.915) (-2313.046) (-2309.735) [-2310.500] -- 0:00:55
      266000 -- (-2310.896) [-2310.432] (-2309.838) (-2309.851) * (-2311.833) (-2314.970) (-2312.469) [-2310.368] -- 0:00:55
      266500 -- (-2313.186) (-2309.959) (-2314.369) [-2309.327] * (-2309.824) (-2318.063) [-2314.661] (-2314.558) -- 0:00:55
      267000 -- (-2315.367) (-2309.339) (-2309.380) [-2310.040] * (-2309.652) (-2311.933) [-2309.795] (-2315.573) -- 0:00:54
      267500 -- (-2312.307) (-2312.238) [-2310.686] (-2310.804) * [-2310.594] (-2310.901) (-2309.930) (-2313.599) -- 0:00:54
      268000 -- (-2311.994) (-2311.026) [-2312.910] (-2310.691) * (-2313.329) [-2313.461] (-2309.728) (-2317.678) -- 0:00:54
      268500 -- (-2309.992) (-2313.886) (-2314.537) [-2312.135] * (-2308.811) (-2313.732) [-2311.290] (-2310.944) -- 0:00:54
      269000 -- (-2311.093) (-2313.889) [-2313.237] (-2313.849) * [-2314.981] (-2314.892) (-2312.236) (-2312.102) -- 0:00:54
      269500 -- (-2313.471) (-2312.271) (-2312.358) [-2312.069] * [-2310.719] (-2315.391) (-2311.735) (-2312.508