--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 22 01:24:54 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Ace-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3896.21         -3907.89
2      -3896.54         -3908.69
--------------------------------------
TOTAL    -3896.36         -3908.37
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.421847    0.004365    0.306532    0.556562    0.414778   1454.84   1477.92    1.000
r(A<->C){all}   0.091361    0.000637    0.045196    0.141656    0.089458    950.77   1066.85    1.000
r(A<->G){all}   0.302913    0.002489    0.204696    0.397873    0.300596    790.65    860.43    1.000
r(A<->T){all}   0.060587    0.001030    0.002531    0.118541    0.056475    836.95    873.69    1.000
r(C<->G){all}   0.048360    0.000214    0.022845    0.079621    0.047326   1132.22   1200.41    1.000
r(C<->T){all}   0.428166    0.003037    0.325942    0.540279    0.426292    909.61    951.92    1.000
r(G<->T){all}   0.068612    0.000531    0.024285    0.110763    0.066857    874.72    977.34    1.001
pi(A){all}      0.201424    0.000078    0.185320    0.218879    0.201419   1043.76   1144.93    1.000
pi(C){all}      0.315521    0.000095    0.295872    0.333901    0.315679   1372.38   1385.57    1.000
pi(G){all}      0.295698    0.000093    0.276859    0.314937    0.295583   1276.35   1301.10    1.000
pi(T){all}      0.187358    0.000070    0.172142    0.204231    0.187360   1076.57   1134.75    1.000
alpha{1,2}      0.042312    0.000653    0.000115    0.084293    0.042280   1246.28   1336.86    1.000
alpha{3}        3.385969    0.926167    1.806039    5.462190    3.255749   1484.67   1492.83    1.000
pinvar{all}     0.663948    0.000750    0.612967    0.719941    0.664516   1080.00   1220.12    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3636.938398
Model 2: PositiveSelection	-3636.200461
Model 0: one-ratio	-3659.358651
Model 3: discrete	-3635.913343
Model 7: beta	-3639.770885
Model 8: beta&w>1	-3636.772137


Model 0 vs 1	44.84050600000046

Model 2 vs 1	1.4758739999997488

Model 8 vs 7	5.9974959999999555

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ace-PA)

            Pr(w>1)     post mean +- SE for w

     4 C      0.987*        3.322
   609 S      0.558         1.975
   617 D      0.867         2.943

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ace-PA)

            Pr(w>1)     post mean +- SE for w

     1 A      0.523         1.023 +- 0.689
     4 C      0.936         1.608 +- 0.662
    19 T      0.516         1.016 +- 0.712
   155 P      0.673         1.262 +- 0.786
   609 S      0.719         1.320 +- 0.751
   617 D      0.862         1.520 +- 0.688

>C1
MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C2
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C3
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHTNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGGSGSASISPRLQLLGIAALIYICAALRTKRVF
>C4
MATSSRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVMDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVDDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHANGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C5
MASARQSSLLPMSLPLPLPLPLPLVLVLSLHLSGVCGVIDRLVVQTSSGP
VRGRSVTVQGREVHVYTGIPYAKPPLEDLRFRKPVPAEPWHGVLDATRLS
ATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGAN
GAEHANGKQGDTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYN
ADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQAL
AIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMMQ
SGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDA
KTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGN
VRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKAKQAEREAII
FQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYF
THRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSAV
IEFAKTGNPAQDGEDWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSFW
NDYLPKVRKWAGTDCDGKSASASTSPRLQLLGVAALIYICAALRTKGVF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=650 

C1              MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
C2              MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
C3              MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
C4              MATSSRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVMDRLVVQTSSG
C5              -MASARQSSLLPMSLPLPLPLPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
                   *.*** :*********.:******************:**********

C1              PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
C2              PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
C3              PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
C4              PVRGRSVTVQGREVHVYTGIPYAKPPVDDLRFRKPVPAEPWHGVLDATRL
C5              PVRGRSVTVQGREVHVYTGIPYAKPPLEDLRFRKPVPAEPWHGVLDATRL
                **************************::**********************

C1              SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
C2              SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
C3              SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
C4              SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
C5              SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
                **************************************************

C1              NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
C2              NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
C3              NGGEHTNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
C4              NGGEHANGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
C5              NGAEHANGKQGDTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
                **.**.****.***************************************

C1              NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
C2              NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
C3              NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
C4              NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
C5              NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
                **************************************************

C1              LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
C2              LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
C3              LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
C4              LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
C5              LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
                **************************************************

C1              QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
C2              QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
C3              QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
C4              QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
C5              QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
                **************************************************

C1              AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
C2              AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
C3              AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
C4              AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
C5              AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
                **************************************************

C1              NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
C2              NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
C3              NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
C4              NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
C5              NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKAKQAEREAI
                ******************************************.*******

C1              IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
C2              IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
C3              IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
C4              IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
C5              IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
                **************************************************

C1              FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
C2              FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
C3              FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
C4              FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
C5              FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
                **************************************************

C1              VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
C2              VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
C3              VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
C4              VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
C5              VIEFAKTGNPAQDGEDWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
                ***************:**********************************

C1              WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
C2              WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
C3              WNDYLPKVRSWAGT-CDGGSGSASISPRLQLLGIAALIYICAALRTKRVF
C4              WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
C5              WNDYLPKVRKWAGTDCDGKSASASTSPRLQLLGVAALIYICAALRTKGVF
                *********.**** *** *.*** ********:************* **




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 s       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  649 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  649 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13044]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [13044]--->[13028]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Ace-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.361 Mb, Max= 30.904 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C2
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C3
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHTNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGGSGSASISPRLQLLGIAALIYICAALRTKRVF
>C4
MATSSRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVMDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVDDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHANGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C5
-MASARQSSLLPMSLPLPLPLPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPLEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGAEHANGKQGDTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKAKQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEDWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRKWAGTDCDGKSASASTSPRLQLLGVAALIYICAALRTKGVF

FORMAT of file /tmp/tmp6576651466264291799aln Not Supported[FATAL:T-COFFEE]
>C1
MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C2
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C3
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHTNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGGSGSASISPRLQLLGIAALIYICAALRTKRVF
>C4
MATSSRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVMDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVDDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHANGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGT-CDGDSGSASISPRLQLLGIAALIYICAALRTKRVF
>C5
-MASARQSSLLPMSLPLPLPLPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPLEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGAEHANGKQGDTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKAKQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEDWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRKWAGTDCDGKSASASTSPRLQLLGVAALIYICAALRTKGVF
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:650 S:99 BS:650
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.69 C1	 C2	 99.69
TOP	    1    0	 99.69 C2	 C1	 99.69
BOT	    0    2	 99.38 C1	 C3	 99.38
TOP	    2    0	 99.38 C3	 C1	 99.38
BOT	    0    3	 99.08 C1	 C4	 99.08
TOP	    3    0	 99.08 C4	 C1	 99.08
BOT	    0    4	 97.07 C1	 C5	 97.07
TOP	    4    0	 97.07 C5	 C1	 97.07
BOT	    1    2	 99.69 C2	 C3	 99.69
TOP	    2    1	 99.69 C3	 C2	 99.69
BOT	    1    3	 99.38 C2	 C4	 99.38
TOP	    3    1	 99.38 C4	 C2	 99.38
BOT	    1    4	 97.07 C2	 C5	 97.07
TOP	    4    1	 97.07 C5	 C2	 97.07
BOT	    2    3	 99.23 C3	 C4	 99.23
TOP	    3    2	 99.23 C4	 C3	 99.23
BOT	    2    4	 97.07 C3	 C5	 97.07
TOP	    4    2	 97.07 C5	 C3	 97.07
BOT	    3    4	 96.91 C4	 C5	 96.91
TOP	    4    3	 96.91 C5	 C4	 96.91
AVG	 0	 C1	  *	 98.80
AVG	 1	 C2	  *	 98.96
AVG	 2	 C3	  *	 98.84
AVG	 3	 C4	  *	 98.65
AVG	 4	 C5	  *	 97.03
TOT	 TOT	  *	 98.46
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCCATCTCCTGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
C2              ATGGCCACCTCCTGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
C3              ATGGCCACCTCCTGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
C4              ATGGCCACCTCCAGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
C5              ---ATGGCCTCCGCACGGCAGAGCAGCCTCCTGCCAATGTCCCTGCCCCT
                   .  . ****  :***********. *******.****** *******

C1              GCCTCTGACCATCCCGCTGCCCCTGGTGCTGGTGCTATCACTGCACCTGT
C2              GCCCCTGGCCATCCCGCTGCCCCTGGTGCTGGTGCTATCGCTGCACCTGT
C3              GCCCCTGGCCATCCCGCTGCCCCTGGTACTGGTGCTATCGCTGCACCTGT
C4              ACCCCTGGCCATCCCGCTGCCCCTAGTACTGGTGCTATCGCTGCACCTGT
C5              GCCCCTCCCCCTGCCGCTGCCCCTGGTCCTGGTGCTGTCGCTGCACCTGT
                .** **  **.* ***********.** ********.**.**********

C1              CCGGCGTCTGCGGCGTCATCGATCGCCTGGTCGTGCAGACATCCTCCGGA
C2              CCGGCGTCTGCGGCGTCATCGATCGCCTGGTCGTGCAGACATCCTCCGGA
C3              CCGGCGTCTGCGGCGTCATCGATCGCCTGGTGGTGCAGACGTCCTCCGGA
C4              CTGGCGTCTGCGGCGTCATGGATCGCCTGGTGGTGCAGACGTCCTCCGGA
C5              CCGGCGTCTGCGGCGTCATCGATCGCCTCGTGGTGCAGACCTCCTCCGGG
                * ***************** ******** ** ******** ********.

C1              CCTGTACGCGGTCGCTCCGTGACGGTGCAGGGCAGGGAGGTGCATGTCTA
C2              CCCGTGCGCGGTCGCTCCGTGACGGTGCAGGGCAGGGAGGTGCATGTCTA
C3              CCCGTGCGCGGTCGCTCCGTAACGGTGCAGGGCAGGGAGGTGCATGTCTA
C4              CCAGTGCGCGGTCGCTCCGTGACGGTGCAGGGCAGGGAGGTGCATGTCTA
C5              CCCGTCCGCGGCCGCTCCGTCACGGTGCAGGGCCGCGAGGTGCACGTCTA
                ** ** ***** ******** ************.* ******** *****

C1              CACGGGCATCCCCTACGCCAAGCCGCCCGTCGAGGACCTGCGCTTCCGAA
C2              CACGGGCATTCCCTACGCCAAGCCGCCCGTCGAGGACCTGCGCTTCCGAA
C3              CACGGGCATCCCCTACGCCAAGCCGCCCGTCGAGGACCTGCGCTTCCGAA
C4              CACGGGCATCCCCTACGCCAAGCCGCCCGTCGACGACCTGCGCTTCCGGA
C5              CACGGGCATCCCCTACGCCAAGCCGCCGCTCGAGGACCTGCGCTTCCGCA
                ********* *****************  **** ************** *

C1              AGCCGGTTCCCGCGGAGCCATGGCACGGCGTCCTCGACGCCACGCGGTTA
C2              AGCCGGTTCCCGCGGAGCCCTGGCACGGCGTCCTCGACGCCACACGGTTA
C3              AGCCGGTGCCCGCGGAGCCATGGCACGGCGTCCTCGACGCCACCCGCTTA
C4              AGCCGGTTCCCGCGGAGCCCTGGCACGGCGTCCTCGATGCCACACGCTTA
C5              AGCCGGTGCCGGCGGAGCCCTGGCACGGCGTCCTCGACGCCACACGGCTG
                ******* ** ********.***************** ***** **  *.

C1              TCCGCCACCTGCGTCCAAGAGCGTTACGAGTACTTCCCCGGCTTCTCCGG
C2              TCCGCCACCTGCGTCCAGGAGCGTTACGAGTACTTCCCCGGCTTCTCCGG
C3              TCCGCCACCTGCGTCCAGGAACGTTACGAGTACTTCCCCGGCTTCTCCGG
C4              TCCGCCACCTGCGTCCAGGAACGTTACGAGTACTTCCCCGGCTTCTCCGG
C5              TCCGCCACCTGCGTCCAAGAGCGTTACGAGTACTTCCCGGGCTTCTCCGG
                *****************.**.***************** ***********

C1              CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
C2              CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
C3              CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
C4              CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
C5              CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGATTGCCTCTACA
                *************************************** **********

C1              TAAATGTCTGGGCGCCGGCAAAGGCCCGACTTCGCCATGGGCGGGGTGCC
C2              TAAATGTCTGGGCGCCGGCAAAGGCCCGACTTCGCCATGGGCGGGGTGCC
C3              TAAATGTCTGGGCGCCGGCAAAGGCTCGTCTCCGCCATGGGCGGGGTGCC
C4              TAAATGTCTGGGCGCCGGCAAAGGCTCGTCTTCGTCATGGGCGGGGTGCC
C5              TAAACGTCTGGGCGCCGGCCAAGGCACGACTTCGCCATGGGCGAGGTGCC
                **** **************.***** **:** ** ********.******

C1              AACGGGGGTGAGCACCCCAATGGCAAACAGGCGGACACTGACCATCTCAT
C2              AACGGGGGCGAGCACCCCAATGGCAAACAGGCGGACACTGACCATCTCAT
C3              AATGGAGGCGAGCACACCAATGGCAAACAGGCGGACACTGACCATCTCAT
C4              AACGGTGGTGAGCACGCCAATGGCAAGCAGGCGGACACCGACCATCTCAT
C5              AACGGAGCCGAGCACGCGAATGGCAAACAAGGGGACACGGATCACCTCAT
                ** ** *  ****** * ********.**.* ****** ** ** *****

C1              CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCGATTCTGATCT
C2              CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCGATTCTGATCT
C3              CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCAATTCTGATCT
C4              CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCGATTCTGATCT
C5              CCACAATGGCAATCCGCAGAACACGACCAACGGCCTGCCAATTCTGATCT
                ****** **.***********************.*****.**********

C1              GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
C2              GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
C3              GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
C4              GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
C5              GGATCTATGGCGGCGGCTTCATGACCGGATCTGCCACCCTGGACATCTAC
                ************* ***************** ******************

C1              AATGCGGATATCATGGCCGCCGTGGGCAATGTAATAGTGGCCTCCTTCCA
C2              AATGCGGATATCATGGCCGCCGTGGGCAATGTGATAGTGGCCTCCTTCCA
C3              AATGCGGACATCATGGCCGCGGTGGGCAATGTGATAGTGGCCTCCTTCCA
C4              AATGCGGACATCATGGCCGCCGTGGGCAATGTGATAGTGGCCTCCTTCCA
C5              AATGCGGACATCATGGCCGCCGTGGGCAATGTGATAGTGGCCTCCTTCCA
                ******** *********** ***********.*****************

C1              GTATCGGGTGGGAGCCTTTGGGTTCTTGCACCTGGCGCCGGAAATGCCGT
C2              GTATCGAGTTGGCGCATTTGGGTTCCTGCACCTGGCGCCGGAAATGCCGT
C3              GTATCGAGTGGGCGCCTTTGGGTTCCTTCACTTGGCTCCGGAAATGCCGT
C4              GTATCGAGTGGGCGCCTTTGGGTTCCTGCACCTGGCGCCGGAAATGCCGT
C5              GTACCGAGTGGGAGCCTTCGGATTCCTGCACCTGGCGCCGGAAATGCCGT
                *** **.** **.**.** **.*** * *** **** *************

C1              CGGAATTCGCGGAAGAGGCGCCCGGCAATGTGGGCCTATGGGATCAGGCA
C2              CGGAGTTCGCGGAAGAGGCGCCCGGCAATGTGGGCCTATGGGATCAGGCA
C3              CAGAATTCGCGGAGGAGGCGCCTGGCAATGTGGGCCTATGGGATCAGGCA
C4              CAGAGTTCGCGGAAGAGGCGCCTGGCAATGTCGGCCTATGGGATCAGGCA
C5              CGGAGTTCGCGGAGGAGGCGCCCGGCAACGTGGGCCTCTGGGATCAGGCG
                *.**.********.******** ***** ** *****.***********.

C1              CTCGCCATTCGCTGGCTGAAGGACAACGCTCATGCCTTCGGCGGAAATCC
C2              CTCGCCATTCGTTGGCTAAAGGACAACGCCCATGCTTTCGGCGGAAATCC
C3              CTCGCCATTCGCTGGCTAAAGGACAACGCTCATGCCTTTGGCGGAAATCC
C4              CTCGCCATTCGCTGGCTAAAGGACAACGCCCATGCCTTCGGCGGAAATCC
C5              CTGGCCATTCGCTGGCTGAAGGACAACGCCCATGCCTTCGGCGGAAATCC
                ** ******** *****.*********** ***** ** ***********

C1              GGAGTGGATGACACTGTTCGGAGAGTCGGCTGGATCCAGTTCGGTGAATG
C2              GGAGTGGATGACCCTGTTCGGGGAGTCGGCTGGATCCAGTTCGGTGAATG
C3              GGAGTGGATGACTCTGTTCGGGGAATCGGCTGGCTCCAGCTCGGTAAATG
C4              GGAATGGATGACCCTGTTCGGGGAATCGGCTGGATCCAGTTCGGTAAATG
C5              GGAGTGGATGACCCTCTTCGGGGAGTCGGCGGGATCCAGCTCGGTGAACG
                ***.******** ** *****.**.***** **.***** *****.** *

C1              CCCAGCTCATGTCGCCGGTGACGAGGGGTCTGGTCAAGCGCGGAATGATG
C2              CCCAGCTCATGTCGCCGGTGACCAGGGGCCTGGTCAAGCGGGGAATGATG
C3              CCCAACTCATGTCGCCGGTGACCAGGGGTCTGGTCAAGCGGGGCATGATG
C4              CCCAACTCATGTCGCCGGTGACCAGGGGTCTGGTCAAGCGGGGCATGATG
C5              CGCAGCTCATGTCGCCGGTCACCAGGGGCCTGGTCAAGAGGGGCATGATG
                * **.************** ** ***** *********.* **.******

C1              CAGTCGGGCACTATGAACGCCCCCTGGAGCCACATGACCTCCGAGAAGGC
C2              CAGTCGGGCACCATGAACGCCCCCTGGAGCCACATGACCTCCGAGAAGGC
C3              CAGTCGGGCACCATGAACGCTCCCTGGAGCCACATGACCTCCGAGAAGGC
C4              CAGTCGGGCACCATGAACGCTCCCTGGAGCCACATGACCTCCGAGAAGGC
C5              CAGTCGGGCACCATGAACGCCCCCTGGAGCCACATGACCTCCGAGAAGGC
                *********** ******** *****************************

C1              CGTGGAGATCGGCAAGGCGCTGATCAACGACTGCAACTGCAATGCATCTA
C2              CGTGGAGATCGGCAAGGCGCTGATCAACGACTGCAACTGCAATGCATCCA
C3              CGTGGAGATCGGCAAGGCGCTCATCAACGACTGCAACTGCAATGCATCCA
C4              CGTGGAGATCGGCAAGGCGCTGATCAACGACTGTAACTGCAATGCATCCA
C5              CGTGGAGATCGGCAAGGCGCTGATCAACGACTGTAACTGCAACGCCTCCA
                ********************* *********** ******** **.** *

C1              TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGTTCCGTGGAC
C2              TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGTTCCGTGGAC
C3              TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGCTCCGTGGAC
C4              TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGTTCCGTGGAC
C5              TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGCTCGGTAGAC
                **************************************** ** **.***

C1              GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATCCTCAG
C2              GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATCCTCAG
C3              GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATACTCAG
C4              GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATACTCAG
C5              GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATCCTCAG
                ********************************************.*****

C1              CTTTCCCTCGGCGCCCACCATTGATGGTGCGTTCCTGCCGGCGGATCCCA
C2              CTTCCCCTCGGCGCCCACCATTGATGGTGCGTTCCTGCCGGCGGATCCCA
C3              CTTCCCCTCGGCGCCCACCATTGATGGAGCGTTCCTGCCTGCGGATCCCA
C4              CTTCCCCTCGGCGCCCACCATTGACGGAGCGTTCCTGCCGGCGGATCCCA
C5              CTTCCCCTCGGCGCCCACCATCGACGGAGCCTTCCTGCCGGCTGATCCCA
                *** ***************** ** **:** ******** ** *******

C1              TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
C2              TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
C3              TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
C4              TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
C5              TGACGCTTATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
                ******* ******************************************

C1              AATGTCAGGGATGAGGGCACTTACTTCTTGCTGTACGATTTCATCGATTA
C2              AATGTCAGGGATGAGGGCACTTACTTCTTGCTGTACGATTTCATCGATTA
C3              AATGTCAGGGATGAGGGCACTTATTTCTTGCTGTACGATTTCATCGATTA
C4              AATGTCAGGGATGAGGGCACCTACTTCTTGCTGTACGATTTCATCGATTA
C5              AATGTCAGGGATGAGGGCACTTACTTCTTGCTGTACGATTTCATCGATTA
                ******************** ** **************************

C1              CTTCGATAAGGACGATGCCACGGCCCTGCCACGGGACAAATACCTGGAAA
C2              CTTCGATAAGGACGATGCCACGGCCCTGCCACGGGACAAATACCTGGAAA
C3              CTTCGATAAGGACGATGCCACGGCCCTGCCACGCGACAAATACCTGGAAA
C4              CTTCGATAAGGACGATGCTACGGCCCTGCCACGGGACAAATACCTGGAAA
C5              CTTCGATAAGGACGATGCCACGGCCCTGCCACGGGACAAATATCTTGAAA
                ****************** ************** ******** ** ****

C1              TTATGAACAATATTTTTGGCAAGGCAACGCAAGCGGAACGCGAGGCCATC
C2              TTATGAACAACATTTTCGGCAAGGCAACGCAAGCGGAACGCGAGGCCATC
C3              TTATGAACAACATTTTCGGCAAGGCAACGCAAGCGGAGCGCGAGGCCATC
C4              TTATGAACAACATTTTCGGCAAGGCAACGCAAGCGGAACGCGAGGCCATC
C5              TTATGAACAACATTTTCGGCAAGGCAAAGCAGGCGGAACGCGAGGCCATC
                ********** ***** **********.***.*****.************

C1              ATTTTCCAGTATACCAGTTGGGAAGGCAATCCTGGCTATCAGAACCAGCA
C2              ATTTTCCAGTATACCAGTTGGGAAGGCAATCCTGGCTATCAGAACCAGCA
C3              ATTTTCCAGTATACCAGTTGGGAGGGTAATCCGGGCTATCAGAACCAGCA
C4              ATTTTCCAGTATACCAGCTGGGAGGGTAATCCGGGCTATCAGAACCAGCA
C5              ATATTTCAGTACACCAGCTGGGAGGGCAATCCGGGATACCAGAATCAACA
                **:** ***** ***** *****.** ***** **.** ***** **.**

C1              GCAAATCGGACGCGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
C2              GCAAATCGGACGCGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
C3              GCAAATCGGACGAGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
C4              GCAAATCGGACGCGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
C5              GCAAATCGGACGCGCCGTGGGCGACCACTTCTTCACCTGCCCCACCAACG
                ************.*********** *************************

C1              AGTATGCCCAGGCTCTGGCGGAGCGAGGCGCTTCCGTGCACTACTACTAC
C2              AGTATGCCCAGGCTCTGGCGGAGCGAGGCGCCTCCGTGCATTACTACTAC
C3              AGTACGCCCAGGCTCTGGCGGAGCGAGGCGCCTCCGTGCACTACTACTAC
C4              AGTATGCCCAGGCTCTGGCGGAGCGAGGCGCCTCCGTACACTACTACTAC
C5              AGTATGCCCAGGCACTGGCGGAGCGAGGCGCCTCCGTGCACTACTACTAC
                **** ********:***************** *****.** *********

C1              TTTACACACCGCACAAGCACCTCATTGTGGGGCGAATGGATGGGCGTGCT
C2              TTTACACACCGCACAAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
C3              TTCACACACCGCACAAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
C4              TTCACACACCGCACAAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
C5              TTCACACACCGCACGAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
                ** ***********.********.**************************

C1              GCACGGCGATGAGATCGAATACTTCTTTGGCCAGCCGCTGAACAACTCCC
C2              GCACGGCGATGAGATCGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
C3              GCACGGCGATGAGATCGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
C4              GCACGGCGATGAGATCGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
C5              GCACGGCGATGAGATTGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
                *************** **.*******************************

C1              TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
C2              TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
C3              TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
C4              TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
C5              TGCAGTATCGACCTGTGGAGCGGGAGCTGGGCAAGCGTATGCTCAGTGCG
                ********************** ***************************

C1              GTCATCGAGTTTGCTAAGACGGGAAATCCCGCTCAGGATGGCGAGGAGTG
C2              GTCATCGAGTTTGCCAAGACGGGAAATCCCGCTCAGGATGGCGAGGAGTG
C3              GTCATCGAGTTTGCTAAGACGGGAAATCCCGCTCAGGATGGCGAAGAGTG
C4              GTCATCGAGTTTGCTAAGACGGGAAATCCCGCTCAGGATGGCGAAGAATG
C5              GTCATCGAGTTTGCCAAGACGGGAAATCCCGCTCAGGACGGCGAGGATTG
                ************** *********************** *****.** **

C1              GCCCAACTTCTCCAAGGAGGATCCCGTCTACTATATTTTCAGCACCGACG
C2              GCCCAACTTCTCGAAGGAGGATCCCGTCTACTATATTTTCAGCACCGACG
C3              GCCCAACTTCTCCAAGGAGGATCCCGTCTATTATATTTTCAGCACCGACG
C4              GCCCAACTTCTCCAAGGAGGATCCCGTCTATTATATTTTCAGCACCGACG
C5              GCCCAACTTCTCCAAGGAGGATCCCGTCTACTATATTTTCAGCACGGACG
                ************ ***************** ************** ****

C1              ATAAGATCGAGAAATTGGCCAGGGGTCCTTTGGCGGCTCGCTGCTCGTTC
C2              ATAAGATCGAGAAATTGGCCAGGGGTCCTTTGGCGGCTCGCTGCTCGTTC
C3              ATAAGATCGAGAAATTGGCCAGAGGTCCTTTGGCGGCTCGCTGCTCGTTC
C4              ATAAGATCGAGAAATTGGCCAGAGGTCCTTTGGCGGCTCGCTGCTCGTTC
C5              ACAAGATCGAGAAACTGGCCCGCGGTCCTTTGGCGGCCCGCTGTTCGTTC
                * ************ *****.* ************** ***** ******

C1              TGGAATGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
C2              TGGAACGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
C3              TGGAACGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
C4              TGGAACGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
C5              TGGAACGACTACTTGCCGAAGGTCAGGAAATGGGCAGGTACAGACTGCGA
                ***** ** ********.**.*******.:***********:   *****

C1              TGGCGATTCGGGAAGTGCTTCCATATCCCCGAGGCTCCAGCTCCTTGGAA
C2              TGGCGATTCGGGAAGTGCTTCCATATCCCCGAGGCTCCAGCTCCTTGGAA
C3              TGGCGGTTCGGGAAGTGCTTCCATATCCCCGAGGCTCCAGCTCCTTGGAA
C4              TGGCGATTCGGGAAGTGCTTCCATATCCCCTAGGCTCCAGCTCCTTGGAA
C5              TGGCAAGTCGGCCAGTGCTTCCACATCCCCAAGGCTGCAGCTCCTGGGAG
                ****.. **** .********** ****** ***** ******** ***.

C1              TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAAAGGGTTTTC
C2              TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAAAGGGTTTTC
C3              TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAGAGGGTTTTC
C4              TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAAAGGGTTTTC
C5              TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAGGGGGTTTTC
                ****************************************..********



>C1
ATGGCCATCTCCTGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
GCCTCTGACCATCCCGCTGCCCCTGGTGCTGGTGCTATCACTGCACCTGT
CCGGCGTCTGCGGCGTCATCGATCGCCTGGTCGTGCAGACATCCTCCGGA
CCTGTACGCGGTCGCTCCGTGACGGTGCAGGGCAGGGAGGTGCATGTCTA
CACGGGCATCCCCTACGCCAAGCCGCCCGTCGAGGACCTGCGCTTCCGAA
AGCCGGTTCCCGCGGAGCCATGGCACGGCGTCCTCGACGCCACGCGGTTA
TCCGCCACCTGCGTCCAAGAGCGTTACGAGTACTTCCCCGGCTTCTCCGG
CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
TAAATGTCTGGGCGCCGGCAAAGGCCCGACTTCGCCATGGGCGGGGTGCC
AACGGGGGTGAGCACCCCAATGGCAAACAGGCGGACACTGACCATCTCAT
CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCGATTCTGATCT
GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
AATGCGGATATCATGGCCGCCGTGGGCAATGTAATAGTGGCCTCCTTCCA
GTATCGGGTGGGAGCCTTTGGGTTCTTGCACCTGGCGCCGGAAATGCCGT
CGGAATTCGCGGAAGAGGCGCCCGGCAATGTGGGCCTATGGGATCAGGCA
CTCGCCATTCGCTGGCTGAAGGACAACGCTCATGCCTTCGGCGGAAATCC
GGAGTGGATGACACTGTTCGGAGAGTCGGCTGGATCCAGTTCGGTGAATG
CCCAGCTCATGTCGCCGGTGACGAGGGGTCTGGTCAAGCGCGGAATGATG
CAGTCGGGCACTATGAACGCCCCCTGGAGCCACATGACCTCCGAGAAGGC
CGTGGAGATCGGCAAGGCGCTGATCAACGACTGCAACTGCAATGCATCTA
TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGTTCCGTGGAC
GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATCCTCAG
CTTTCCCTCGGCGCCCACCATTGATGGTGCGTTCCTGCCGGCGGATCCCA
TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
AATGTCAGGGATGAGGGCACTTACTTCTTGCTGTACGATTTCATCGATTA
CTTCGATAAGGACGATGCCACGGCCCTGCCACGGGACAAATACCTGGAAA
TTATGAACAATATTTTTGGCAAGGCAACGCAAGCGGAACGCGAGGCCATC
ATTTTCCAGTATACCAGTTGGGAAGGCAATCCTGGCTATCAGAACCAGCA
GCAAATCGGACGCGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
AGTATGCCCAGGCTCTGGCGGAGCGAGGCGCTTCCGTGCACTACTACTAC
TTTACACACCGCACAAGCACCTCATTGTGGGGCGAATGGATGGGCGTGCT
GCACGGCGATGAGATCGAATACTTCTTTGGCCAGCCGCTGAACAACTCCC
TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
GTCATCGAGTTTGCTAAGACGGGAAATCCCGCTCAGGATGGCGAGGAGTG
GCCCAACTTCTCCAAGGAGGATCCCGTCTACTATATTTTCAGCACCGACG
ATAAGATCGAGAAATTGGCCAGGGGTCCTTTGGCGGCTCGCTGCTCGTTC
TGGAATGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
TGGCGATTCGGGAAGTGCTTCCATATCCCCGAGGCTCCAGCTCCTTGGAA
TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAAAGGGTTTTC
>C2
ATGGCCACCTCCTGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
GCCCCTGGCCATCCCGCTGCCCCTGGTGCTGGTGCTATCGCTGCACCTGT
CCGGCGTCTGCGGCGTCATCGATCGCCTGGTCGTGCAGACATCCTCCGGA
CCCGTGCGCGGTCGCTCCGTGACGGTGCAGGGCAGGGAGGTGCATGTCTA
CACGGGCATTCCCTACGCCAAGCCGCCCGTCGAGGACCTGCGCTTCCGAA
AGCCGGTTCCCGCGGAGCCCTGGCACGGCGTCCTCGACGCCACACGGTTA
TCCGCCACCTGCGTCCAGGAGCGTTACGAGTACTTCCCCGGCTTCTCCGG
CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
TAAATGTCTGGGCGCCGGCAAAGGCCCGACTTCGCCATGGGCGGGGTGCC
AACGGGGGCGAGCACCCCAATGGCAAACAGGCGGACACTGACCATCTCAT
CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCGATTCTGATCT
GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
AATGCGGATATCATGGCCGCCGTGGGCAATGTGATAGTGGCCTCCTTCCA
GTATCGAGTTGGCGCATTTGGGTTCCTGCACCTGGCGCCGGAAATGCCGT
CGGAGTTCGCGGAAGAGGCGCCCGGCAATGTGGGCCTATGGGATCAGGCA
CTCGCCATTCGTTGGCTAAAGGACAACGCCCATGCTTTCGGCGGAAATCC
GGAGTGGATGACCCTGTTCGGGGAGTCGGCTGGATCCAGTTCGGTGAATG
CCCAGCTCATGTCGCCGGTGACCAGGGGCCTGGTCAAGCGGGGAATGATG
CAGTCGGGCACCATGAACGCCCCCTGGAGCCACATGACCTCCGAGAAGGC
CGTGGAGATCGGCAAGGCGCTGATCAACGACTGCAACTGCAATGCATCCA
TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGTTCCGTGGAC
GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATCCTCAG
CTTCCCCTCGGCGCCCACCATTGATGGTGCGTTCCTGCCGGCGGATCCCA
TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
AATGTCAGGGATGAGGGCACTTACTTCTTGCTGTACGATTTCATCGATTA
CTTCGATAAGGACGATGCCACGGCCCTGCCACGGGACAAATACCTGGAAA
TTATGAACAACATTTTCGGCAAGGCAACGCAAGCGGAACGCGAGGCCATC
ATTTTCCAGTATACCAGTTGGGAAGGCAATCCTGGCTATCAGAACCAGCA
GCAAATCGGACGCGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
AGTATGCCCAGGCTCTGGCGGAGCGAGGCGCCTCCGTGCATTACTACTAC
TTTACACACCGCACAAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
GCACGGCGATGAGATCGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
GTCATCGAGTTTGCCAAGACGGGAAATCCCGCTCAGGATGGCGAGGAGTG
GCCCAACTTCTCGAAGGAGGATCCCGTCTACTATATTTTCAGCACCGACG
ATAAGATCGAGAAATTGGCCAGGGGTCCTTTGGCGGCTCGCTGCTCGTTC
TGGAACGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
TGGCGATTCGGGAAGTGCTTCCATATCCCCGAGGCTCCAGCTCCTTGGAA
TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAAAGGGTTTTC
>C3
ATGGCCACCTCCTGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
GCCCCTGGCCATCCCGCTGCCCCTGGTACTGGTGCTATCGCTGCACCTGT
CCGGCGTCTGCGGCGTCATCGATCGCCTGGTGGTGCAGACGTCCTCCGGA
CCCGTGCGCGGTCGCTCCGTAACGGTGCAGGGCAGGGAGGTGCATGTCTA
CACGGGCATCCCCTACGCCAAGCCGCCCGTCGAGGACCTGCGCTTCCGAA
AGCCGGTGCCCGCGGAGCCATGGCACGGCGTCCTCGACGCCACCCGCTTA
TCCGCCACCTGCGTCCAGGAACGTTACGAGTACTTCCCCGGCTTCTCCGG
CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
TAAATGTCTGGGCGCCGGCAAAGGCTCGTCTCCGCCATGGGCGGGGTGCC
AATGGAGGCGAGCACACCAATGGCAAACAGGCGGACACTGACCATCTCAT
CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCAATTCTGATCT
GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
AATGCGGACATCATGGCCGCGGTGGGCAATGTGATAGTGGCCTCCTTCCA
GTATCGAGTGGGCGCCTTTGGGTTCCTTCACTTGGCTCCGGAAATGCCGT
CAGAATTCGCGGAGGAGGCGCCTGGCAATGTGGGCCTATGGGATCAGGCA
CTCGCCATTCGCTGGCTAAAGGACAACGCTCATGCCTTTGGCGGAAATCC
GGAGTGGATGACTCTGTTCGGGGAATCGGCTGGCTCCAGCTCGGTAAATG
CCCAACTCATGTCGCCGGTGACCAGGGGTCTGGTCAAGCGGGGCATGATG
CAGTCGGGCACCATGAACGCTCCCTGGAGCCACATGACCTCCGAGAAGGC
CGTGGAGATCGGCAAGGCGCTCATCAACGACTGCAACTGCAATGCATCCA
TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGCTCCGTGGAC
GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATACTCAG
CTTCCCCTCGGCGCCCACCATTGATGGAGCGTTCCTGCCTGCGGATCCCA
TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
AATGTCAGGGATGAGGGCACTTATTTCTTGCTGTACGATTTCATCGATTA
CTTCGATAAGGACGATGCCACGGCCCTGCCACGCGACAAATACCTGGAAA
TTATGAACAACATTTTCGGCAAGGCAACGCAAGCGGAGCGCGAGGCCATC
ATTTTCCAGTATACCAGTTGGGAGGGTAATCCGGGCTATCAGAACCAGCA
GCAAATCGGACGAGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
AGTACGCCCAGGCTCTGGCGGAGCGAGGCGCCTCCGTGCACTACTACTAC
TTCACACACCGCACAAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
GCACGGCGATGAGATCGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
GTCATCGAGTTTGCTAAGACGGGAAATCCCGCTCAGGATGGCGAAGAGTG
GCCCAACTTCTCCAAGGAGGATCCCGTCTATTATATTTTCAGCACCGACG
ATAAGATCGAGAAATTGGCCAGAGGTCCTTTGGCGGCTCGCTGCTCGTTC
TGGAACGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
TGGCGGTTCGGGAAGTGCTTCCATATCCCCGAGGCTCCAGCTCCTTGGAA
TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAGAGGGTTTTC
>C4
ATGGCCACCTCCAGTCGGCAGAGCAGAGTCCTGCCCATGTCCTTGCCCCT
ACCCCTGGCCATCCCGCTGCCCCTAGTACTGGTGCTATCGCTGCACCTGT
CTGGCGTCTGCGGCGTCATGGATCGCCTGGTGGTGCAGACGTCCTCCGGA
CCAGTGCGCGGTCGCTCCGTGACGGTGCAGGGCAGGGAGGTGCATGTCTA
CACGGGCATCCCCTACGCCAAGCCGCCCGTCGACGACCTGCGCTTCCGGA
AGCCGGTTCCCGCGGAGCCCTGGCACGGCGTCCTCGATGCCACACGCTTA
TCCGCCACCTGCGTCCAGGAACGTTACGAGTACTTCCCCGGCTTCTCCGG
CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGACTGCCTCTACA
TAAATGTCTGGGCGCCGGCAAAGGCTCGTCTTCGTCATGGGCGGGGTGCC
AACGGTGGTGAGCACGCCAATGGCAAGCAGGCGGACACCGACCATCTCAT
CCACAACGGAAATCCGCAGAACACGACCAACGGACTGCCGATTCTGATCT
GGATCTATGGCGGTGGCTTCATGACCGGATCGGCCACCCTGGACATCTAC
AATGCGGACATCATGGCCGCCGTGGGCAATGTGATAGTGGCCTCCTTCCA
GTATCGAGTGGGCGCCTTTGGGTTCCTGCACCTGGCGCCGGAAATGCCGT
CAGAGTTCGCGGAAGAGGCGCCTGGCAATGTCGGCCTATGGGATCAGGCA
CTCGCCATTCGCTGGCTAAAGGACAACGCCCATGCCTTCGGCGGAAATCC
GGAATGGATGACCCTGTTCGGGGAATCGGCTGGATCCAGTTCGGTAAATG
CCCAACTCATGTCGCCGGTGACCAGGGGTCTGGTCAAGCGGGGCATGATG
CAGTCGGGCACCATGAACGCTCCCTGGAGCCACATGACCTCCGAGAAGGC
CGTGGAGATCGGCAAGGCGCTGATCAACGACTGTAACTGCAATGCATCCA
TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGTTCCGTGGAC
GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATACTCAG
CTTCCCCTCGGCGCCCACCATTGACGGAGCGTTCCTGCCGGCGGATCCCA
TGACGCTGATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
AATGTCAGGGATGAGGGCACCTACTTCTTGCTGTACGATTTCATCGATTA
CTTCGATAAGGACGATGCTACGGCCCTGCCACGGGACAAATACCTGGAAA
TTATGAACAACATTTTCGGCAAGGCAACGCAAGCGGAACGCGAGGCCATC
ATTTTCCAGTATACCAGCTGGGAGGGTAATCCGGGCTATCAGAACCAGCA
GCAAATCGGACGCGCCGTGGGCGATCACTTCTTCACCTGCCCCACCAACG
AGTATGCCCAGGCTCTGGCGGAGCGAGGCGCCTCCGTACACTACTACTAC
TTCACACACCGCACAAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
GCACGGCGATGAGATCGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
TGCAGTATCGACCTGTGGAGCGTGAGCTGGGCAAGCGTATGCTCAGTGCG
GTCATCGAGTTTGCTAAGACGGGAAATCCCGCTCAGGATGGCGAAGAATG
GCCCAACTTCTCCAAGGAGGATCCCGTCTATTATATTTTCAGCACCGACG
ATAAGATCGAGAAATTGGCCAGAGGTCCTTTGGCGGCTCGCTGCTCGTTC
TGGAACGATTACTTGCCAAAAGTCAGGAGTTGGGCAGGTACT---TGCGA
TGGCGATTCGGGAAGTGCTTCCATATCCCCTAGGCTCCAGCTCCTTGGAA
TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAAAGGGTTTTC
>C5
---ATGGCCTCCGCACGGCAGAGCAGCCTCCTGCCAATGTCCCTGCCCCT
GCCCCTCCCCCTGCCGCTGCCCCTGGTCCTGGTGCTGTCGCTGCACCTGT
CCGGCGTCTGCGGCGTCATCGATCGCCTCGTGGTGCAGACCTCCTCCGGG
CCCGTCCGCGGCCGCTCCGTCACGGTGCAGGGCCGCGAGGTGCACGTCTA
CACGGGCATCCCCTACGCCAAGCCGCCGCTCGAGGACCTGCGCTTCCGCA
AGCCGGTGCCGGCGGAGCCCTGGCACGGCGTCCTCGACGCCACACGGCTG
TCCGCCACCTGCGTCCAAGAGCGTTACGAGTACTTCCCGGGCTTCTCCGG
CGAGGAGATCTGGAACCCCAACACCAACGTGTCCGAGGATTGCCTCTACA
TAAACGTCTGGGCGCCGGCCAAGGCACGACTTCGCCATGGGCGAGGTGCC
AACGGAGCCGAGCACGCGAATGGCAAACAAGGGGACACGGATCACCTCAT
CCACAATGGCAATCCGCAGAACACGACCAACGGCCTGCCAATTCTGATCT
GGATCTATGGCGGCGGCTTCATGACCGGATCTGCCACCCTGGACATCTAC
AATGCGGACATCATGGCCGCCGTGGGCAATGTGATAGTGGCCTCCTTCCA
GTACCGAGTGGGAGCCTTCGGATTCCTGCACCTGGCGCCGGAAATGCCGT
CGGAGTTCGCGGAGGAGGCGCCCGGCAACGTGGGCCTCTGGGATCAGGCG
CTGGCCATTCGCTGGCTGAAGGACAACGCCCATGCCTTCGGCGGAAATCC
GGAGTGGATGACCCTCTTCGGGGAGTCGGCGGGATCCAGCTCGGTGAACG
CGCAGCTCATGTCGCCGGTCACCAGGGGCCTGGTCAAGAGGGGCATGATG
CAGTCGGGCACCATGAACGCCCCCTGGAGCCACATGACCTCCGAGAAGGC
CGTGGAGATCGGCAAGGCGCTGATCAACGACTGTAACTGCAACGCCTCCA
TGCTGAAGACCAATCCCGCTCACGTGATGAGCTGCATGCGCTCGGTAGAC
GCCAAGACCATATCGGTGCAGCAGTGGAACTCCTACTCGGGCATCCTCAG
CTTCCCCTCGGCGCCCACCATCGACGGAGCCTTCCTGCCGGCTGATCCCA
TGACGCTTATGAAGACGGCGGATCTGAAGGACTACGACATCCTGATGGGA
AATGTCAGGGATGAGGGCACTTACTTCTTGCTGTACGATTTCATCGATTA
CTTCGATAAGGACGATGCCACGGCCCTGCCACGGGACAAATATCTTGAAA
TTATGAACAACATTTTCGGCAAGGCAAAGCAGGCGGAACGCGAGGCCATC
ATATTTCAGTACACCAGCTGGGAGGGCAATCCGGGATACCAGAATCAACA
GCAAATCGGACGCGCCGTGGGCGACCACTTCTTCACCTGCCCCACCAACG
AGTATGCCCAGGCACTGGCGGAGCGAGGCGCCTCCGTGCACTACTACTAC
TTCACACACCGCACGAGCACCTCGTTGTGGGGCGAATGGATGGGCGTGCT
GCACGGCGATGAGATTGAGTACTTCTTTGGCCAGCCGCTGAACAACTCCC
TGCAGTATCGACCTGTGGAGCGGGAGCTGGGCAAGCGTATGCTCAGTGCG
GTCATCGAGTTTGCCAAGACGGGAAATCCCGCTCAGGACGGCGAGGATTG
GCCCAACTTCTCCAAGGAGGATCCCGTCTACTATATTTTCAGCACGGACG
ACAAGATCGAGAAACTGGCCCGCGGTCCTTTGGCGGCCCGCTGTTCGTTC
TGGAACGACTACTTGCCGAAGGTCAGGAAATGGGCAGGTACAGACTGCGA
TGGCAAGTCGGCCAGTGCTTCCACATCCCCAAGGCTGCAGCTCCTGGGAG
TCGCTGCTCTGATCTACATCTGCGCCGCATTGCGAACCAAGGGGGTTTTC
>C1
MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGToCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF

>C2
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGToCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF

>C3
MATSCRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHTNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGToCDGGSGSASISPRLQLLGIAALIYICAALRTKRVF

>C4
MATSSRQSRVLPMSLPLPLAIPLPLVLVLSLHLSGVCGVMDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPVDDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGGEHANGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKATQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRSWAGToCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF

>C5
oMASARQSSLLPMSLPLPLPLPLPLVLVLSLHLSGVCGVIDRLVVQTSSG
PVRGRSVTVQGREVHVYTGIPYAKPPLEDLRFRKPVPAEPWHGVLDATRL
SATCVQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGA
NGAEHANGKQGDTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIY
NADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQA
LAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMM
QSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVD
AKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMG
NVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNIFGKAKQAEREAI
IFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYY
FTHRTSTSLWGEWMGVLHGDEIEYFFGQPLNNSLQYRPVERELGKRMLSA
VIEFAKTGNPAQDGEDWPNFSKEDPVYYIFSTDDKIEKLARGPLAARCSF
WNDYLPKVRKWAGTDCDGKSASASTSPRLQLLGVAALIYICAALRTKGVF



                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1950 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479777528
      Setting output file names to "/opt/ADOPS/3/Ace-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1448754610
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 2984548529
      Seed = 50411953
      Swapseed = 1479777528
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 17 unique site patterns
      Division 2 has 14 unique site patterns
      Division 3 has 78 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -4834.456921 -- -25.624409
         Chain 2 -- -4833.050783 -- -25.624409
         Chain 3 -- -4874.667733 -- -25.624409
         Chain 4 -- -4874.667733 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -4832.779904 -- -25.624409
         Chain 2 -- -4881.527274 -- -25.624409
         Chain 3 -- -4876.487434 -- -25.624409
         Chain 4 -- -4876.487434 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-4834.457] (-4833.051) (-4874.668) (-4874.668) * [-4832.780] (-4881.527) (-4876.487) (-4876.487) 
        500 -- (-4027.257) (-4019.278) (-4029.543) [-4004.973] * (-4041.026) (-4029.606) (-4042.584) [-4028.305] -- 0:00:00
       1000 -- (-4014.040) (-3987.018) (-4023.573) [-3981.148] * (-4014.664) [-4002.801] (-4007.317) (-4011.358) -- 0:00:00
       1500 -- (-4002.949) (-3953.269) (-3994.285) [-3948.747] * (-3992.452) (-3982.609) [-3982.673] (-3985.282) -- 0:11:05
       2000 -- (-3992.560) [-3924.319] (-3978.583) (-3924.299) * [-3944.601] (-3945.467) (-3958.694) (-3983.794) -- 0:08:19
       2500 -- (-3970.497) [-3907.530] (-3944.996) (-3920.188) * (-3915.552) [-3900.690] (-3945.748) (-3967.279) -- 0:06:39
       3000 -- (-3932.933) (-3900.873) (-3904.848) [-3901.978] * [-3911.751] (-3902.438) (-3913.570) (-3943.042) -- 0:05:32
       3500 -- (-3921.660) (-3910.934) [-3896.268] (-3902.110) * [-3901.133] (-3900.061) (-3909.986) (-3904.532) -- 0:04:44
       4000 -- (-3913.981) (-3903.604) (-3894.683) [-3907.039] * (-3898.181) (-3898.944) (-3906.493) [-3902.722] -- 0:04:09
       4500 -- (-3898.405) (-3901.579) [-3897.995] (-3899.910) * [-3901.562] (-3907.370) (-3903.585) (-3902.082) -- 0:03:41
       5000 -- (-3900.635) (-3898.196) (-3897.620) [-3901.485] * (-3904.030) [-3900.157] (-3911.665) (-3898.925) -- 0:03:19

      Average standard deviation of split frequencies: 0.078567

       5500 -- [-3899.689] (-3897.769) (-3901.519) (-3903.624) * (-3904.560) [-3894.526] (-3906.409) (-3899.603) -- 0:03:00
       6000 -- (-3902.313) [-3898.044] (-3897.516) (-3900.117) * (-3897.504) (-3902.969) (-3898.597) [-3901.262] -- 0:05:31
       6500 -- (-3897.333) (-3903.242) (-3898.569) [-3898.553] * (-3905.511) [-3895.353] (-3898.133) (-3898.118) -- 0:05:05
       7000 -- (-3898.982) [-3895.876] (-3901.751) (-3899.454) * [-3897.291] (-3898.796) (-3900.606) (-3910.789) -- 0:04:43
       7500 -- (-3900.733) (-3897.533) (-3898.767) [-3896.011] * [-3897.858] (-3903.034) (-3900.747) (-3907.668) -- 0:04:24
       8000 -- (-3904.100) [-3898.798] (-3911.708) (-3897.479) * (-3905.275) (-3900.399) (-3899.547) [-3906.582] -- 0:04:08
       8500 -- [-3898.274] (-3905.246) (-3899.188) (-3899.082) * (-3897.586) (-3907.595) [-3897.956] (-3896.938) -- 0:03:53
       9000 -- (-3898.288) [-3899.104] (-3899.997) (-3904.884) * (-3906.898) [-3896.899] (-3900.982) (-3900.555) -- 0:03:40
       9500 -- (-3901.858) (-3901.443) (-3901.928) [-3918.120] * (-3903.257) [-3901.970] (-3901.646) (-3895.534) -- 0:03:28
      10000 -- [-3895.514] (-3899.517) (-3903.058) (-3909.492) * (-3908.231) (-3902.900) (-3900.479) [-3897.947] -- 0:03:18

      Average standard deviation of split frequencies: 0.044194

      10500 -- (-3900.979) (-3903.085) [-3899.785] (-3903.171) * (-3902.956) (-3903.606) (-3894.327) [-3898.411] -- 0:03:08
      11000 -- [-3895.319] (-3898.414) (-3907.296) (-3900.532) * [-3905.532] (-3899.955) (-3901.622) (-3906.121) -- 0:04:29
      11500 -- (-3896.384) (-3898.745) (-3898.109) [-3900.400] * [-3902.222] (-3903.243) (-3897.022) (-3900.079) -- 0:04:17
      12000 -- (-3899.833) [-3902.352] (-3906.017) (-3893.660) * (-3901.123) (-3900.934) [-3897.393] (-3900.033) -- 0:04:07
      12500 -- (-3900.301) (-3900.661) (-3896.223) [-3899.362] * (-3902.633) (-3902.569) (-3907.191) [-3908.654] -- 0:03:57
      13000 -- [-3896.897] (-3902.434) (-3902.062) (-3907.045) * (-3896.077) (-3905.152) (-3898.328) [-3903.333] -- 0:03:47
      13500 -- [-3904.528] (-3905.842) (-3896.723) (-3902.988) * [-3898.932] (-3904.959) (-3902.022) (-3901.071) -- 0:03:39
      14000 -- (-3908.407) (-3901.880) [-3902.857] (-3897.357) * (-3902.159) [-3897.236] (-3895.875) (-3895.279) -- 0:03:31
      14500 -- (-3911.405) (-3901.585) [-3901.876] (-3898.071) * (-3895.951) [-3897.763] (-3900.636) (-3897.618) -- 0:03:23
      15000 -- (-3905.659) (-3901.526) (-3900.579) [-3902.378] * (-3903.267) (-3897.067) [-3902.321] (-3898.033) -- 0:03:17

      Average standard deviation of split frequencies: 0.049105

      15500 -- (-3902.653) [-3905.713] (-3900.684) (-3902.148) * [-3899.039] (-3897.515) (-3908.884) (-3904.509) -- 0:04:14
      16000 -- [-3901.830] (-3901.231) (-3904.438) (-3905.796) * [-3894.925] (-3896.751) (-3897.161) (-3907.792) -- 0:04:06
      16500 -- (-3903.981) (-3903.302) [-3897.576] (-3897.767) * (-3900.136) [-3901.427] (-3899.542) (-3894.227) -- 0:03:58
      17000 -- (-3903.328) [-3904.897] (-3902.452) (-3897.171) * (-3900.580) (-3897.531) [-3897.028] (-3905.049) -- 0:03:51
      17500 -- [-3915.757] (-3902.544) (-3898.708) (-3898.213) * (-3899.124) [-3894.675] (-3904.166) (-3899.592) -- 0:03:44
      18000 -- (-3909.504) [-3894.765] (-3902.327) (-3900.901) * (-3902.938) (-3903.731) (-3904.988) [-3902.184] -- 0:03:38
      18500 -- (-3900.073) (-3893.206) (-3909.042) [-3900.874] * (-3898.428) (-3903.945) (-3902.954) [-3913.652] -- 0:03:32
      19000 -- (-3905.462) (-3895.559) [-3903.069] (-3903.080) * [-3904.445] (-3895.213) (-3900.621) (-3904.613) -- 0:03:26
      19500 -- (-3898.449) (-3899.644) (-3897.880) [-3900.903] * (-3904.430) [-3897.899] (-3901.868) (-3901.278) -- 0:03:21
      20000 -- (-3906.567) (-3898.031) [-3899.969] (-3895.827) * [-3898.166] (-3900.033) (-3901.738) (-3904.319) -- 0:03:16

      Average standard deviation of split frequencies: 0.057025

      20500 -- [-3899.641] (-3903.493) (-3897.506) (-3899.827) * (-3898.120) (-3902.941) [-3896.283] (-3898.695) -- 0:03:58
      21000 -- (-3900.891) (-3903.955) (-3897.349) [-3898.690] * (-3902.267) (-3903.710) [-3896.995] (-3904.972) -- 0:03:53
      21500 -- (-3904.111) [-3907.619] (-3905.025) (-3896.571) * (-3900.186) (-3897.599) [-3900.877] (-3905.531) -- 0:03:47
      22000 -- [-3896.428] (-3900.940) (-3900.104) (-3894.921) * (-3904.058) (-3904.191) [-3900.212] (-3903.881) -- 0:03:42
      22500 -- [-3898.930] (-3901.077) (-3905.932) (-3902.193) * [-3901.165] (-3904.920) (-3905.806) (-3899.592) -- 0:03:37
      23000 -- (-3904.168) [-3902.209] (-3895.418) (-3900.492) * (-3901.673) [-3907.824] (-3904.042) (-3901.142) -- 0:03:32
      23500 -- (-3899.952) (-3902.717) [-3900.885] (-3900.181) * (-3902.124) (-3904.156) [-3900.547] (-3902.718) -- 0:03:27
      24000 -- [-3899.055] (-3902.304) (-3899.067) (-3901.104) * (-3900.494) (-3904.333) (-3899.741) [-3903.144] -- 0:03:23
      24500 -- (-3904.106) (-3905.332) [-3898.563] (-3902.758) * (-3900.656) (-3907.035) [-3893.979] (-3901.763) -- 0:03:19
      25000 -- [-3896.745] (-3900.380) (-3899.471) (-3914.799) * [-3896.152] (-3899.246) (-3899.339) (-3907.740) -- 0:03:54

      Average standard deviation of split frequencies: 0.054393

      25500 -- (-3906.614) (-3898.322) (-3903.058) [-3900.520] * [-3900.492] (-3903.646) (-3896.382) (-3914.254) -- 0:03:49
      26000 -- (-3900.872) (-3893.953) [-3898.093] (-3902.485) * (-3902.114) [-3897.015] (-3901.539) (-3903.042) -- 0:03:44
      26500 -- (-3898.767) [-3901.103] (-3899.822) (-3898.852) * (-3896.712) [-3899.503] (-3905.729) (-3908.363) -- 0:03:40
      27000 -- (-3898.631) (-3900.827) (-3904.619) [-3901.196] * (-3898.772) [-3898.756] (-3901.837) (-3902.212) -- 0:03:36
      27500 -- [-3895.587] (-3899.538) (-3906.026) (-3899.738) * (-3911.563) (-3903.279) [-3901.283] (-3903.487) -- 0:03:32
      28000 -- (-3897.794) [-3896.434] (-3904.277) (-3899.553) * (-3895.123) (-3910.873) [-3898.052] (-3905.169) -- 0:03:28
      28500 -- [-3900.379] (-3896.552) (-3901.365) (-3899.878) * (-3897.314) (-3902.657) (-3893.949) [-3901.786] -- 0:03:24
      29000 -- (-3911.230) (-3899.324) (-3901.122) [-3905.784] * [-3897.391] (-3898.873) (-3896.440) (-3896.295) -- 0:03:20
      29500 -- (-3905.504) (-3904.668) [-3904.746] (-3898.836) * (-3895.636) (-3899.711) (-3894.554) [-3899.565] -- 0:03:17
      30000 -- (-3898.339) (-3908.081) (-3904.069) [-3897.088] * (-3900.128) (-3900.629) [-3894.272] (-3898.903) -- 0:03:46

      Average standard deviation of split frequencies: 0.053802

      30500 -- [-3901.297] (-3906.012) (-3905.966) (-3898.581) * [-3900.624] (-3898.193) (-3903.413) (-3903.842) -- 0:03:42
      31000 -- (-3901.311) (-3895.140) (-3902.863) [-3898.345] * (-3899.276) (-3901.147) [-3898.791] (-3903.229) -- 0:03:38
      31500 -- (-3901.798) [-3893.282] (-3901.839) (-3895.987) * (-3900.361) (-3904.849) (-3905.848) [-3905.879] -- 0:03:35
      32000 -- (-3901.897) (-3901.037) [-3898.366] (-3907.698) * (-3900.475) [-3902.462] (-3896.881) (-3900.946) -- 0:03:31
      32500 -- (-3898.950) [-3897.887] (-3900.178) (-3902.137) * (-3903.048) [-3903.403] (-3900.118) (-3902.506) -- 0:03:28
      33000 -- (-3900.632) (-3898.622) [-3896.754] (-3901.599) * (-3901.985) [-3898.396] (-3899.690) (-3902.385) -- 0:03:25
      33500 -- (-3901.362) (-3903.529) [-3898.253] (-3910.500) * (-3908.759) (-3910.512) (-3898.941) [-3901.186] -- 0:03:21
      34000 -- (-3906.547) [-3898.366] (-3902.803) (-3900.812) * (-3903.554) [-3899.976] (-3898.450) (-3894.946) -- 0:03:18
      34500 -- [-3904.792] (-3898.416) (-3903.486) (-3909.834) * (-3902.283) (-3908.205) [-3897.902] (-3906.967) -- 0:03:43
      35000 -- (-3903.743) (-3901.219) [-3898.443] (-3903.869) * [-3900.917] (-3911.307) (-3895.051) (-3899.555) -- 0:03:40

      Average standard deviation of split frequencies: 0.052378

      35500 -- (-3902.215) (-3904.225) [-3897.728] (-3906.515) * (-3900.409) (-3905.357) [-3895.419] (-3900.966) -- 0:03:37
      36000 -- [-3897.641] (-3907.150) (-3904.653) (-3902.917) * (-3896.487) (-3903.923) [-3896.118] (-3901.156) -- 0:03:34
      36500 -- [-3895.030] (-3908.252) (-3899.884) (-3899.497) * (-3897.749) [-3910.706] (-3897.914) (-3897.537) -- 0:03:31
      37000 -- (-3899.135) (-3903.311) [-3897.568] (-3903.698) * (-3899.709) (-3905.348) [-3896.004] (-3900.342) -- 0:03:28
      37500 -- (-3900.290) (-3900.727) [-3899.751] (-3905.388) * (-3902.938) (-3900.740) [-3901.901] (-3901.683) -- 0:03:25
      38000 -- (-3902.141) [-3903.018] (-3898.189) (-3896.162) * (-3898.935) (-3905.672) [-3900.016] (-3907.910) -- 0:03:22
      38500 -- (-3906.986) (-3910.739) [-3902.357] (-3904.949) * [-3898.639] (-3909.308) (-3903.321) (-3904.580) -- 0:03:44
      39000 -- (-3902.274) (-3901.793) (-3903.376) [-3895.276] * (-3899.459) (-3905.446) [-3903.851] (-3904.291) -- 0:03:41
      39500 -- (-3904.287) [-3898.388] (-3899.658) (-3905.875) * (-3913.362) [-3900.028] (-3901.919) (-3900.895) -- 0:03:38
      40000 -- (-3905.025) (-3899.887) [-3900.648] (-3907.170) * (-3900.301) [-3901.451] (-3906.861) (-3905.906) -- 0:03:36

      Average standard deviation of split frequencies: 0.023184

      40500 -- [-3902.569] (-3900.766) (-3904.186) (-3900.051) * [-3904.210] (-3899.206) (-3903.364) (-3902.272) -- 0:03:33
      41000 -- (-3905.599) (-3898.203) (-3904.409) [-3899.773] * [-3896.205] (-3897.664) (-3902.682) (-3905.945) -- 0:03:30
      41500 -- (-3904.056) (-3894.309) [-3897.654] (-3901.115) * (-3901.449) (-3899.282) (-3902.688) [-3904.877] -- 0:03:27
      42000 -- (-3907.179) (-3899.930) [-3896.028] (-3897.428) * (-3911.738) (-3900.593) (-3909.254) [-3905.619] -- 0:03:25
      42500 -- [-3901.011] (-3901.927) (-3901.753) (-3897.348) * [-3905.480] (-3896.744) (-3901.545) (-3901.025) -- 0:03:22
      43000 -- (-3903.724) [-3897.705] (-3906.934) (-3901.296) * (-3906.470) (-3904.671) [-3898.945] (-3906.137) -- 0:03:20
      43500 -- (-3904.898) (-3907.527) (-3906.735) [-3898.934] * [-3901.488] (-3899.317) (-3901.257) (-3907.299) -- 0:03:39
      44000 -- (-3910.154) (-3900.949) (-3898.351) [-3897.567] * [-3898.396] (-3898.362) (-3900.451) (-3902.774) -- 0:03:37
      44500 -- [-3896.664] (-3901.535) (-3897.695) (-3894.828) * (-3905.455) [-3906.114] (-3899.661) (-3899.849) -- 0:03:34
      45000 -- (-3895.587) [-3903.222] (-3902.871) (-3897.545) * [-3896.492] (-3902.787) (-3899.418) (-3897.152) -- 0:03:32

      Average standard deviation of split frequencies: 0.020496

      45500 -- (-3903.229) (-3894.407) [-3895.940] (-3903.601) * (-3897.877) (-3903.765) [-3900.779] (-3904.162) -- 0:03:29
      46000 -- (-3901.494) [-3903.500] (-3904.799) (-3901.515) * (-3895.355) (-3902.615) [-3898.500] (-3904.602) -- 0:03:27
      46500 -- (-3905.319) [-3903.337] (-3896.813) (-3899.468) * (-3900.958) (-3903.174) [-3906.668] (-3895.694) -- 0:03:25
      47000 -- (-3906.100) (-3904.530) (-3904.570) [-3907.552] * [-3899.691] (-3901.821) (-3900.223) (-3900.136) -- 0:03:22
      47500 -- (-3902.521) (-3899.971) [-3901.256] (-3899.391) * (-3899.451) [-3896.479] (-3909.032) (-3897.982) -- 0:03:20
      48000 -- (-3905.490) (-3905.463) (-3899.151) [-3899.905] * (-3898.297) (-3907.036) (-3896.080) [-3903.084] -- 0:03:38
      48500 -- (-3900.504) [-3895.270] (-3894.681) (-3899.667) * [-3897.907] (-3906.359) (-3902.371) (-3898.901) -- 0:03:35
      49000 -- (-3903.212) (-3901.147) [-3893.902] (-3900.945) * (-3900.096) (-3905.043) [-3895.879] (-3900.656) -- 0:03:33
      49500 -- (-3896.559) (-3897.190) [-3896.687] (-3896.451) * (-3893.673) (-3902.693) (-3893.260) [-3899.377] -- 0:03:31
      50000 -- (-3893.073) (-3896.740) [-3903.978] (-3895.929) * (-3900.489) (-3897.550) (-3895.989) [-3899.626] -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-3906.440) [-3900.257] (-3902.327) (-3899.574) * (-3899.556) [-3900.031] (-3896.504) (-3899.751) -- 0:03:26
      51000 -- (-3908.352) [-3903.803] (-3902.742) (-3906.416) * (-3899.040) (-3901.981) (-3901.199) [-3900.525] -- 0:03:24
      51500 -- (-3902.786) [-3899.876] (-3902.613) (-3903.892) * (-3908.105) (-3897.275) [-3901.466] (-3897.515) -- 0:03:22
      52000 -- (-3910.980) [-3897.596] (-3903.461) (-3905.541) * (-3904.148) (-3905.839) (-3893.542) [-3899.635] -- 0:03:20
      52500 -- [-3901.306] (-3903.373) (-3904.200) (-3896.682) * [-3899.128] (-3907.454) (-3897.398) (-3902.136) -- 0:03:18
      53000 -- [-3901.893] (-3898.346) (-3903.273) (-3900.406) * (-3898.066) [-3900.033] (-3899.325) (-3903.367) -- 0:03:34
      53500 -- [-3900.920] (-3896.394) (-3894.358) (-3901.099) * [-3896.828] (-3903.771) (-3896.506) (-3903.851) -- 0:03:32
      54000 -- (-3904.729) (-3902.711) [-3897.491] (-3909.054) * (-3902.523) (-3905.770) [-3891.553] (-3900.503) -- 0:03:30
      54500 -- (-3896.168) [-3900.372] (-3902.784) (-3902.785) * (-3900.176) [-3899.652] (-3897.931) (-3898.360) -- 0:03:28
      55000 -- (-3896.624) (-3908.273) [-3905.852] (-3902.170) * (-3900.753) (-3898.264) (-3904.005) [-3902.411] -- 0:03:26

      Average standard deviation of split frequencies: 0.021045

      55500 -- (-3898.585) (-3899.792) (-3899.418) [-3901.814] * (-3900.201) (-3903.144) (-3902.027) [-3901.481] -- 0:03:24
      56000 -- [-3897.271] (-3900.616) (-3904.206) (-3896.890) * (-3903.119) [-3900.873] (-3897.511) (-3903.747) -- 0:03:22
      56500 -- (-3900.650) (-3901.521) [-3903.079] (-3900.004) * [-3900.179] (-3898.080) (-3900.009) (-3905.786) -- 0:03:20
      57000 -- (-3897.543) (-3895.733) [-3898.166] (-3906.673) * [-3898.518] (-3896.040) (-3895.225) (-3895.965) -- 0:03:18
      57500 -- (-3903.150) (-3894.997) [-3896.422] (-3896.988) * (-3903.060) [-3895.182] (-3898.392) (-3900.376) -- 0:03:33
      58000 -- (-3900.256) (-3901.703) [-3909.626] (-3901.998) * (-3901.897) (-3897.876) [-3899.778] (-3900.761) -- 0:03:31
      58500 -- (-3901.225) (-3903.664) (-3906.974) [-3899.284] * [-3905.981] (-3901.792) (-3905.883) (-3907.179) -- 0:03:29
      59000 -- (-3905.902) [-3897.605] (-3901.751) (-3902.688) * [-3900.655] (-3905.260) (-3903.864) (-3897.907) -- 0:03:27
      59500 -- (-3910.022) [-3896.954] (-3897.983) (-3900.750) * (-3903.861) [-3900.022] (-3905.475) (-3903.987) -- 0:03:25
      60000 -- (-3899.958) (-3901.910) (-3907.476) [-3906.557] * (-3899.490) (-3910.870) (-3898.469) [-3899.557] -- 0:03:23

      Average standard deviation of split frequencies: 0.027196

      60500 -- (-3897.648) [-3900.152] (-3908.072) (-3908.256) * [-3894.909] (-3901.796) (-3903.905) (-3897.900) -- 0:03:21
      61000 -- (-3908.223) [-3899.221] (-3903.715) (-3910.900) * (-3905.471) (-3914.714) [-3897.553] (-3902.206) -- 0:03:20
      61500 -- (-3906.752) (-3905.789) [-3901.027] (-3912.576) * (-3900.947) [-3901.427] (-3899.672) (-3894.504) -- 0:03:18
      62000 -- (-3906.857) [-3902.133] (-3903.372) (-3904.288) * (-3895.174) [-3903.911] (-3909.065) (-3897.357) -- 0:03:16
      62500 -- (-3901.787) (-3901.424) [-3902.687] (-3905.949) * (-3899.887) [-3900.098] (-3902.406) (-3899.834) -- 0:03:30
      63000 -- (-3901.873) (-3911.353) [-3894.131] (-3909.563) * (-3902.700) [-3896.810] (-3908.144) (-3899.910) -- 0:03:28
      63500 -- [-3900.902] (-3902.357) (-3900.982) (-3898.423) * (-3899.107) (-3898.983) (-3913.165) [-3902.545] -- 0:03:26
      64000 -- [-3896.096] (-3902.993) (-3903.479) (-3898.542) * (-3898.590) (-3897.658) (-3899.273) [-3899.803] -- 0:03:24
      64500 -- (-3896.079) [-3903.381] (-3904.932) (-3899.882) * (-3897.644) (-3893.201) [-3894.074] (-3899.297) -- 0:03:23
      65000 -- [-3899.555] (-3897.830) (-3913.467) (-3897.680) * (-3898.083) (-3901.187) (-3897.947) [-3898.881] -- 0:03:21

      Average standard deviation of split frequencies: 0.028570

      65500 -- (-3902.470) (-3903.060) (-3902.428) [-3904.048] * (-3904.633) (-3892.421) (-3901.684) [-3894.976] -- 0:03:19
      66000 -- (-3895.035) [-3898.986] (-3903.107) (-3904.210) * (-3894.806) [-3901.792] (-3902.665) (-3899.354) -- 0:03:18
      66500 -- [-3898.733] (-3901.128) (-3904.267) (-3895.709) * (-3893.961) (-3898.849) [-3900.089] (-3903.517) -- 0:03:16
      67000 -- [-3904.663] (-3905.071) (-3903.196) (-3905.163) * [-3900.295] (-3901.043) (-3899.518) (-3901.402) -- 0:03:14
      67500 -- (-3907.725) (-3899.823) [-3901.702] (-3898.526) * (-3898.746) [-3896.432] (-3903.066) (-3901.083) -- 0:03:27
      68000 -- (-3908.660) (-3916.297) (-3897.946) [-3895.591] * (-3899.883) [-3897.302] (-3906.587) (-3903.742) -- 0:03:25
      68500 -- (-3901.836) (-3906.335) (-3898.408) [-3894.854] * [-3902.533] (-3899.486) (-3907.680) (-3909.924) -- 0:03:23
      69000 -- (-3911.615) (-3900.964) [-3897.610] (-3908.121) * [-3894.122] (-3902.024) (-3894.461) (-3910.946) -- 0:03:22
      69500 -- [-3900.132] (-3896.848) (-3908.969) (-3898.502) * (-3897.886) (-3904.377) [-3896.738] (-3907.470) -- 0:03:20
      70000 -- [-3901.845] (-3905.121) (-3910.439) (-3904.620) * (-3897.319) [-3903.249] (-3904.157) (-3908.308) -- 0:03:19

      Average standard deviation of split frequencies: 0.026683

      70500 -- (-3899.637) (-3901.818) (-3908.424) [-3898.558] * (-3904.518) [-3900.226] (-3896.864) (-3900.392) -- 0:03:17
      71000 -- (-3897.985) (-3897.518) [-3901.103] (-3906.254) * (-3899.896) (-3895.574) (-3902.362) [-3900.371] -- 0:03:16
      71500 -- (-3900.224) [-3903.244] (-3906.353) (-3917.181) * (-3901.155) (-3908.474) [-3906.286] (-3904.236) -- 0:03:14
      72000 -- [-3902.380] (-3898.330) (-3902.908) (-3909.982) * (-3897.944) (-3916.631) (-3905.461) [-3899.711] -- 0:03:26
      72500 -- (-3898.652) [-3900.226] (-3898.513) (-3903.786) * (-3899.494) (-3902.500) (-3903.797) [-3894.373] -- 0:03:24
      73000 -- (-3898.689) (-3902.338) [-3897.173] (-3902.603) * (-3902.026) (-3905.834) [-3906.716] (-3902.264) -- 0:03:23
      73500 -- (-3894.568) [-3899.685] (-3900.515) (-3900.728) * (-3900.181) (-3906.376) [-3897.683] (-3896.978) -- 0:03:21
      74000 -- (-3896.101) (-3908.803) [-3900.076] (-3904.844) * [-3899.484] (-3901.842) (-3903.966) (-3898.945) -- 0:03:20
      74500 -- [-3902.404] (-3899.919) (-3898.742) (-3899.423) * (-3903.008) (-3902.271) (-3900.974) [-3899.093] -- 0:03:18
      75000 -- (-3897.011) (-3904.926) [-3894.358] (-3896.988) * [-3894.117] (-3898.853) (-3905.427) (-3899.337) -- 0:03:17

      Average standard deviation of split frequencies: 0.024811

      75500 -- (-3898.199) (-3900.806) [-3904.290] (-3903.414) * (-3901.041) [-3896.082] (-3903.797) (-3901.232) -- 0:03:15
      76000 -- [-3899.086] (-3904.382) (-3905.251) (-3898.036) * (-3903.630) (-3898.230) (-3897.677) [-3895.144] -- 0:03:14
      76500 -- (-3899.116) (-3910.056) [-3902.502] (-3900.048) * (-3901.583) (-3902.995) [-3897.286] (-3901.726) -- 0:03:13
      77000 -- (-3898.570) (-3914.577) [-3902.987] (-3903.507) * [-3897.034] (-3897.677) (-3901.864) (-3904.897) -- 0:03:23
      77500 -- (-3901.107) [-3909.056] (-3905.389) (-3899.799) * (-3897.411) [-3901.279] (-3904.216) (-3907.060) -- 0:03:22
      78000 -- (-3899.892) [-3904.153] (-3903.001) (-3910.480) * [-3894.438] (-3899.275) (-3905.961) (-3907.131) -- 0:03:20
      78500 -- (-3902.412) (-3910.276) (-3897.761) [-3899.096] * [-3902.204] (-3903.013) (-3899.925) (-3895.796) -- 0:03:19
      79000 -- (-3905.020) (-3904.207) (-3904.823) [-3897.314] * (-3902.246) (-3899.576) (-3901.408) [-3902.369] -- 0:03:18
      79500 -- [-3897.296] (-3897.802) (-3897.943) (-3909.139) * [-3896.654] (-3903.990) (-3900.660) (-3905.980) -- 0:03:16
      80000 -- (-3900.976) (-3898.877) [-3900.242] (-3900.311) * [-3897.222] (-3898.287) (-3904.332) (-3902.825) -- 0:03:15

      Average standard deviation of split frequencies: 0.026297

      80500 -- [-3903.402] (-3903.489) (-3901.062) (-3903.334) * (-3899.727) (-3898.435) (-3902.383) [-3906.756] -- 0:03:14
      81000 -- (-3900.198) (-3899.206) (-3896.190) [-3899.036] * (-3899.139) [-3905.186] (-3904.620) (-3904.339) -- 0:03:12
      81500 -- [-3901.508] (-3905.244) (-3895.886) (-3902.722) * (-3896.747) (-3897.874) (-3907.207) [-3903.354] -- 0:03:22
      82000 -- (-3915.857) (-3903.964) [-3897.712] (-3901.799) * (-3902.157) [-3905.985] (-3909.146) (-3905.792) -- 0:03:21
      82500 -- (-3910.034) (-3902.911) (-3903.232) [-3900.850] * (-3899.005) (-3911.800) (-3901.801) [-3913.761] -- 0:03:20
      83000 -- (-3902.004) [-3904.340] (-3899.879) (-3905.499) * (-3894.153) (-3904.793) (-3900.037) [-3907.863] -- 0:03:18
      83500 -- (-3901.973) (-3902.055) (-3907.971) [-3901.267] * (-3900.808) [-3902.778] (-3899.605) (-3900.472) -- 0:03:17
      84000 -- (-3894.811) [-3900.117] (-3908.315) (-3897.020) * (-3904.082) (-3904.144) [-3897.783] (-3897.126) -- 0:03:16
      84500 -- (-3900.168) [-3897.267] (-3905.501) (-3902.145) * (-3896.666) (-3896.511) [-3896.552] (-3905.926) -- 0:03:15
      85000 -- [-3898.704] (-3903.768) (-3904.476) (-3898.404) * (-3897.763) [-3900.176] (-3899.614) (-3897.723) -- 0:03:13

      Average standard deviation of split frequencies: 0.019185

      85500 -- [-3903.306] (-3901.974) (-3897.665) (-3905.938) * (-3902.248) (-3899.012) (-3897.862) [-3896.703] -- 0:03:12
      86000 -- [-3900.452] (-3903.975) (-3894.888) (-3902.902) * [-3898.983] (-3900.565) (-3904.257) (-3901.201) -- 0:03:21
      86500 -- (-3897.734) (-3903.288) (-3898.192) [-3900.738] * (-3900.699) (-3900.364) [-3898.413] (-3904.019) -- 0:03:20
      87000 -- (-3897.129) [-3896.534] (-3905.274) (-3900.967) * (-3899.964) (-3901.898) (-3899.994) [-3894.196] -- 0:03:19
      87500 -- (-3903.700) [-3896.221] (-3899.838) (-3911.191) * [-3898.185] (-3901.124) (-3904.436) (-3898.189) -- 0:03:18
      88000 -- (-3901.958) (-3904.106) [-3907.978] (-3902.539) * (-3906.169) (-3900.328) [-3898.656] (-3904.026) -- 0:03:16
      88500 -- (-3901.867) [-3902.863] (-3914.505) (-3900.405) * [-3900.092] (-3900.791) (-3901.066) (-3904.968) -- 0:03:15
      89000 -- [-3902.621] (-3902.772) (-3904.744) (-3898.307) * (-3902.833) [-3899.676] (-3897.359) (-3911.424) -- 0:03:14
      89500 -- (-3898.573) [-3904.932] (-3910.193) (-3904.472) * (-3895.982) (-3898.376) [-3900.261] (-3903.543) -- 0:03:13
      90000 -- (-3900.464) [-3901.794] (-3917.710) (-3903.999) * (-3900.279) (-3899.725) (-3900.637) [-3900.253] -- 0:03:12

      Average standard deviation of split frequencies: 0.020797

      90500 -- [-3899.440] (-3902.445) (-3899.605) (-3898.235) * [-3901.371] (-3899.226) (-3908.159) (-3904.906) -- 0:03:10
      91000 -- [-3900.016] (-3898.027) (-3903.217) (-3901.408) * (-3902.263) (-3902.505) (-3899.669) [-3895.398] -- 0:03:19
      91500 -- (-3902.761) [-3895.749] (-3900.493) (-3900.894) * [-3900.517] (-3901.265) (-3898.403) (-3899.818) -- 0:03:18
      92000 -- (-3897.188) (-3895.941) (-3900.365) [-3902.410] * (-3899.907) (-3901.336) [-3898.475] (-3907.545) -- 0:03:17
      92500 -- (-3899.318) (-3896.843) [-3900.813] (-3908.163) * (-3896.741) (-3897.199) [-3903.425] (-3896.915) -- 0:03:16
      93000 -- (-3900.353) [-3901.177] (-3904.420) (-3904.109) * (-3899.666) (-3904.292) [-3905.134] (-3898.501) -- 0:03:15
      93500 -- (-3902.063) (-3898.373) [-3902.915] (-3900.073) * [-3899.541] (-3903.564) (-3902.841) (-3912.589) -- 0:03:13
      94000 -- (-3899.938) (-3902.814) [-3896.929] (-3902.276) * (-3901.762) (-3903.706) [-3896.555] (-3910.386) -- 0:03:12
      94500 -- (-3904.223) (-3897.549) [-3901.154] (-3900.235) * (-3904.913) [-3896.553] (-3908.545) (-3907.268) -- 0:03:11
      95000 -- [-3902.020] (-3899.781) (-3902.387) (-3901.271) * (-3908.169) (-3903.566) (-3901.328) [-3900.267] -- 0:03:10

      Average standard deviation of split frequencies: 0.022097

      95500 -- (-3907.944) (-3904.290) [-3898.750] (-3905.100) * (-3903.901) (-3899.597) [-3896.919] (-3899.959) -- 0:03:18
      96000 -- [-3898.817] (-3912.838) (-3899.451) (-3908.774) * (-3896.980) [-3901.056] (-3898.763) (-3898.221) -- 0:03:17
      96500 -- (-3895.228) (-3902.840) [-3897.124] (-3906.230) * [-3907.243] (-3899.369) (-3899.170) (-3903.383) -- 0:03:16
      97000 -- (-3899.625) [-3897.435] (-3898.901) (-3905.181) * (-3909.593) [-3902.726] (-3907.302) (-3902.245) -- 0:03:15
      97500 -- (-3904.658) (-3895.747) (-3909.800) [-3897.671] * (-3905.964) [-3897.996] (-3893.274) (-3898.539) -- 0:03:14
      98000 -- (-3900.055) (-3901.590) [-3900.044] (-3900.608) * (-3900.693) (-3899.881) (-3897.971) [-3900.247] -- 0:03:13
      98500 -- (-3900.334) (-3899.244) [-3898.402] (-3901.354) * (-3899.680) (-3901.008) (-3901.594) [-3900.637] -- 0:03:12
      99000 -- (-3905.291) [-3897.064] (-3898.565) (-3900.374) * (-3898.313) (-3901.494) (-3907.108) [-3899.650] -- 0:03:11
      99500 -- (-3900.630) (-3904.317) (-3904.586) [-3906.937] * (-3903.666) (-3905.679) [-3908.081] (-3899.634) -- 0:03:10
      100000 -- (-3900.653) [-3899.500] (-3901.038) (-3901.755) * [-3899.430] (-3906.121) (-3899.984) (-3906.928) -- 0:03:09

      Average standard deviation of split frequencies: 0.016390

      100500 -- [-3902.976] (-3904.334) (-3910.161) (-3903.616) * (-3895.685) [-3903.257] (-3898.371) (-3908.871) -- 0:03:16
      101000 -- (-3900.320) (-3909.796) (-3898.380) [-3899.798] * [-3895.029] (-3904.224) (-3903.279) (-3902.303) -- 0:03:15
      101500 -- (-3901.458) (-3901.371) [-3899.503] (-3906.867) * (-3899.439) (-3908.201) (-3897.725) [-3904.487] -- 0:03:14
      102000 -- (-3897.201) (-3895.205) (-3902.573) [-3899.867] * [-3899.876] (-3910.409) (-3905.416) (-3900.137) -- 0:03:13
      102500 -- [-3906.785] (-3906.933) (-3899.318) (-3901.206) * [-3901.507] (-3903.236) (-3904.455) (-3902.679) -- 0:03:12
      103000 -- (-3904.467) (-3903.540) [-3899.274] (-3896.572) * (-3900.461) (-3902.439) (-3901.015) [-3900.777] -- 0:03:11
      103500 -- (-3899.399) (-3904.882) (-3899.880) [-3896.430] * (-3901.852) (-3899.780) (-3894.916) [-3895.400] -- 0:03:10
      104000 -- (-3901.389) (-3899.388) (-3900.540) [-3897.751] * (-3899.936) (-3903.972) [-3898.767] (-3898.587) -- 0:03:09
      104500 -- (-3906.347) [-3901.258] (-3898.640) (-3899.312) * (-3905.839) [-3905.896] (-3905.265) (-3906.305) -- 0:03:08
      105000 -- (-3897.757) [-3904.248] (-3900.277) (-3900.033) * (-3901.379) (-3917.690) (-3906.560) [-3895.313] -- 0:03:16

      Average standard deviation of split frequencies: 0.015565

      105500 -- [-3897.179] (-3901.946) (-3903.363) (-3898.125) * [-3899.249] (-3901.162) (-3903.556) (-3896.356) -- 0:03:15
      106000 -- (-3905.692) (-3905.308) (-3898.227) [-3901.145] * (-3906.290) (-3899.495) [-3901.397] (-3898.148) -- 0:03:13
      106500 -- [-3901.338] (-3908.187) (-3898.979) (-3901.322) * [-3898.723] (-3900.071) (-3903.755) (-3896.418) -- 0:03:12
      107000 -- (-3906.611) (-3897.060) (-3896.831) [-3900.687] * (-3909.146) (-3900.118) (-3908.162) [-3902.973] -- 0:03:11
      107500 -- (-3910.166) (-3903.021) (-3900.221) [-3901.864] * (-3903.984) [-3898.977] (-3901.876) (-3900.659) -- 0:03:10
      108000 -- [-3895.619] (-3899.230) (-3899.806) (-3895.948) * [-3906.053] (-3903.241) (-3901.270) (-3900.083) -- 0:03:09
      108500 -- [-3896.348] (-3902.806) (-3902.229) (-3901.049) * (-3904.307) (-3908.556) [-3904.816] (-3903.155) -- 0:03:08
      109000 -- (-3900.925) [-3897.974] (-3906.719) (-3900.826) * (-3901.031) [-3898.468] (-3898.823) (-3903.874) -- 0:03:08
      109500 -- (-3903.107) (-3902.928) [-3909.948] (-3909.260) * (-3903.249) [-3894.342] (-3899.790) (-3896.426) -- 0:03:07
      110000 -- (-3903.110) [-3894.019] (-3902.841) (-3906.055) * (-3898.102) [-3899.539] (-3900.296) (-3915.494) -- 0:03:14

      Average standard deviation of split frequencies: 0.014909

      110500 -- (-3905.409) (-3897.310) [-3901.128] (-3916.133) * (-3898.918) [-3900.091] (-3901.446) (-3895.954) -- 0:03:13
      111000 -- (-3909.017) [-3897.957] (-3894.982) (-3904.456) * (-3898.693) [-3896.450] (-3899.900) (-3900.587) -- 0:03:12
      111500 -- (-3906.646) (-3894.823) [-3904.156] (-3897.772) * (-3901.974) [-3900.326] (-3896.682) (-3914.835) -- 0:03:11
      112000 -- (-3900.519) (-3901.554) (-3899.933) [-3897.372] * [-3902.446] (-3900.996) (-3903.673) (-3902.378) -- 0:03:10
      112500 -- (-3903.408) (-3903.044) (-3901.366) [-3898.907] * (-3905.295) (-3900.536) (-3898.143) [-3900.560] -- 0:03:09
      113000 -- (-3897.120) (-3900.577) (-3900.242) [-3901.244] * (-3905.079) (-3900.335) (-3900.962) [-3900.235] -- 0:03:08
      113500 -- (-3901.101) (-3904.506) [-3897.610] (-3897.519) * [-3906.401] (-3892.039) (-3898.833) (-3903.947) -- 0:03:07
      114000 -- (-3906.278) [-3899.597] (-3900.400) (-3900.737) * (-3903.192) (-3895.056) [-3900.486] (-3895.529) -- 0:03:06
      114500 -- (-3904.811) (-3901.225) [-3898.678] (-3895.791) * (-3898.338) (-3899.802) (-3903.997) [-3897.526] -- 0:03:13
      115000 -- [-3911.822] (-3899.588) (-3898.481) (-3904.396) * (-3907.225) [-3899.846] (-3909.248) (-3899.703) -- 0:03:12

      Average standard deviation of split frequencies: 0.010160

      115500 -- (-3898.129) (-3904.827) [-3900.820] (-3899.465) * (-3902.319) (-3897.915) [-3896.748] (-3900.474) -- 0:03:11
      116000 -- (-3899.463) (-3898.254) (-3903.116) [-3897.391] * [-3900.692] (-3900.201) (-3904.541) (-3901.440) -- 0:03:10
      116500 -- (-3900.366) (-3900.734) [-3901.319] (-3899.706) * (-3900.342) [-3898.049] (-3903.268) (-3898.696) -- 0:03:09
      117000 -- [-3901.430] (-3902.459) (-3902.970) (-3897.033) * [-3907.681] (-3895.422) (-3902.180) (-3899.478) -- 0:03:08
      117500 -- (-3903.924) [-3901.274] (-3912.549) (-3900.136) * (-3912.172) (-3907.669) (-3901.098) [-3903.714] -- 0:03:07
      118000 -- (-3895.900) [-3904.038] (-3915.640) (-3899.557) * (-3908.751) (-3898.337) (-3896.263) [-3898.785] -- 0:03:06
      118500 -- (-3902.639) [-3906.227] (-3901.730) (-3897.202) * (-3902.706) (-3911.438) (-3909.412) [-3903.020] -- 0:03:05
      119000 -- [-3898.274] (-3901.581) (-3905.823) (-3902.397) * (-3898.758) (-3899.264) [-3895.984] (-3904.241) -- 0:03:05
      119500 -- (-3895.682) (-3900.588) (-3905.824) [-3905.048] * [-3897.580] (-3895.325) (-3896.622) (-3909.755) -- 0:03:11
      120000 -- [-3899.555] (-3904.937) (-3899.560) (-3907.590) * (-3903.008) [-3894.547] (-3901.646) (-3900.306) -- 0:03:10

      Average standard deviation of split frequencies: 0.007813

      120500 -- (-3904.033) (-3907.462) (-3905.331) [-3900.727] * [-3898.818] (-3896.335) (-3902.004) (-3897.375) -- 0:03:09
      121000 -- [-3897.830] (-3904.695) (-3899.686) (-3901.474) * [-3899.974] (-3903.015) (-3900.920) (-3900.878) -- 0:03:08
      121500 -- (-3903.455) (-3901.287) (-3908.834) [-3903.031] * (-3896.420) (-3902.276) (-3904.729) [-3894.980] -- 0:03:07
      122000 -- (-3902.715) [-3897.956] (-3904.439) (-3900.788) * (-3903.449) (-3902.548) (-3906.875) [-3899.309] -- 0:03:07
      122500 -- (-3897.744) (-3902.948) [-3902.495] (-3900.990) * [-3899.804] (-3900.967) (-3895.037) (-3899.274) -- 0:03:06
      123000 -- (-3896.267) (-3906.830) [-3905.737] (-3894.013) * (-3906.239) (-3900.638) (-3904.336) [-3899.090] -- 0:03:05
      123500 -- [-3903.172] (-3911.746) (-3898.370) (-3898.752) * (-3905.482) (-3898.983) (-3894.998) [-3900.643] -- 0:03:04
      124000 -- [-3900.555] (-3906.362) (-3907.685) (-3906.246) * (-3910.461) [-3903.176] (-3897.110) (-3900.277) -- 0:03:10
      124500 -- [-3915.515] (-3905.545) (-3895.590) (-3902.952) * (-3907.881) [-3905.506] (-3897.291) (-3899.551) -- 0:03:09
      125000 -- (-3898.101) [-3900.632] (-3901.014) (-3904.702) * (-3902.900) (-3899.315) [-3905.056] (-3899.723) -- 0:03:09

      Average standard deviation of split frequencies: 0.001871

      125500 -- [-3898.101] (-3906.988) (-3903.623) (-3906.483) * [-3900.637] (-3898.871) (-3899.294) (-3900.325) -- 0:03:08
      126000 -- (-3900.560) (-3903.915) [-3902.041] (-3902.949) * (-3899.436) (-3898.840) (-3910.972) [-3902.174] -- 0:03:07
      126500 -- [-3906.110] (-3903.132) (-3898.213) (-3911.339) * (-3904.901) [-3898.649] (-3899.414) (-3892.816) -- 0:03:06
      127000 -- (-3905.185) (-3902.601) (-3898.855) [-3906.366] * [-3898.387] (-3900.969) (-3906.849) (-3904.270) -- 0:03:05
      127500 -- [-3897.932] (-3901.704) (-3906.444) (-3910.849) * (-3900.255) (-3906.903) (-3903.037) [-3899.917] -- 0:03:04
      128000 -- (-3906.210) (-3898.000) [-3900.250] (-3906.683) * (-3902.607) (-3902.290) [-3899.198] (-3898.333) -- 0:03:03
      128500 -- [-3896.006] (-3899.862) (-3900.777) (-3902.869) * (-3902.381) (-3894.977) [-3897.146] (-3907.049) -- 0:03:03
      129000 -- (-3903.529) (-3901.685) (-3900.924) [-3898.993] * [-3896.484] (-3902.439) (-3910.239) (-3901.531) -- 0:03:09
      129500 -- (-3901.791) (-3897.139) (-3899.630) [-3896.837] * (-3898.863) [-3899.023] (-3913.527) (-3902.654) -- 0:03:08
      130000 -- (-3899.027) (-3909.444) (-3901.989) [-3899.525] * [-3900.799] (-3895.678) (-3908.128) (-3899.621) -- 0:03:07

      Average standard deviation of split frequencies: 0.001804

      130500 -- (-3897.525) [-3896.829] (-3900.413) (-3903.029) * (-3900.562) [-3897.689] (-3910.315) (-3901.185) -- 0:03:06
      131000 -- [-3898.362] (-3902.993) (-3916.860) (-3905.100) * (-3903.041) (-3897.515) [-3902.161] (-3903.206) -- 0:03:05
      131500 -- (-3903.389) [-3893.500] (-3905.752) (-3898.279) * [-3901.484] (-3902.285) (-3911.164) (-3898.564) -- 0:03:04
      132000 -- (-3896.919) (-3898.297) (-3904.717) [-3896.599] * (-3908.543) [-3902.150] (-3903.361) (-3904.886) -- 0:03:04
      132500 -- (-3900.117) (-3898.042) [-3896.138] (-3901.904) * (-3908.126) [-3901.458] (-3903.178) (-3904.155) -- 0:03:03
      133000 -- (-3897.333) [-3900.702] (-3899.964) (-3902.955) * (-3906.051) [-3903.930] (-3903.080) (-3904.547) -- 0:03:02
      133500 -- (-3907.473) (-3900.929) (-3902.940) [-3902.857] * (-3903.940) (-3895.372) (-3897.328) [-3898.859] -- 0:03:08
      134000 -- (-3902.073) [-3906.440] (-3898.943) (-3898.496) * (-3895.327) (-3900.286) (-3893.887) [-3897.101] -- 0:03:07
      134500 -- (-3909.682) [-3897.060] (-3898.565) (-3902.284) * (-3904.311) (-3898.832) [-3905.934] (-3904.622) -- 0:03:06
      135000 -- (-3903.508) (-3899.586) [-3898.371] (-3907.819) * (-3910.009) (-3894.018) (-3900.188) [-3897.263] -- 0:03:05

      Average standard deviation of split frequencies: 0.003466

      135500 -- (-3898.909) [-3898.208] (-3897.136) (-3904.645) * (-3905.941) (-3898.380) (-3906.317) [-3899.933] -- 0:03:05
      136000 -- [-3901.021] (-3899.489) (-3897.381) (-3899.673) * (-3904.270) (-3905.395) [-3900.535] (-3899.276) -- 0:03:04
      136500 -- (-3914.224) (-3900.160) [-3900.439] (-3898.746) * (-3906.688) (-3901.323) [-3901.157] (-3904.023) -- 0:03:03
      137000 -- (-3905.902) [-3901.482] (-3904.136) (-3898.071) * (-3899.654) (-3899.613) (-3905.873) [-3911.395] -- 0:03:02
      137500 -- (-3907.469) [-3904.966] (-3902.073) (-3907.342) * (-3902.875) (-3897.524) [-3902.934] (-3900.203) -- 0:03:01
      138000 -- (-3895.867) (-3899.168) (-3902.400) [-3896.544] * (-3904.809) (-3896.499) (-3909.071) [-3903.553] -- 0:03:07
      138500 -- (-3908.350) (-3904.718) (-3904.235) [-3894.671] * (-3908.506) (-3901.215) (-3899.680) [-3900.350] -- 0:03:06
      139000 -- [-3909.235] (-3898.091) (-3899.857) (-3900.943) * (-3900.886) [-3897.451] (-3901.530) (-3900.855) -- 0:03:05
      139500 -- (-3897.392) [-3897.574] (-3897.232) (-3898.516) * (-3900.309) (-3904.735) [-3896.719] (-3898.420) -- 0:03:05
      140000 -- (-3898.999) (-3898.933) (-3900.771) [-3899.826] * (-3898.691) (-3900.547) [-3897.739] (-3905.681) -- 0:03:04

      Average standard deviation of split frequencies: 0.005027

      140500 -- (-3900.266) (-3898.739) [-3894.943] (-3897.030) * (-3897.588) (-3897.184) [-3902.038] (-3904.774) -- 0:03:03
      141000 -- [-3900.060] (-3899.045) (-3904.389) (-3899.693) * (-3899.369) [-3901.432] (-3906.676) (-3907.515) -- 0:03:02
      141500 -- (-3905.541) (-3901.739) [-3896.564] (-3899.415) * (-3901.157) (-3899.430) (-3905.814) [-3898.140] -- 0:03:02
      142000 -- (-3903.434) (-3900.024) [-3896.218] (-3905.496) * (-3895.394) (-3900.542) [-3900.109] (-3895.666) -- 0:03:01
      142500 -- (-3902.845) [-3900.409] (-3895.012) (-3904.614) * (-3897.451) (-3900.090) (-3898.065) [-3903.194] -- 0:03:00
      143000 -- (-3905.488) (-3900.215) (-3901.686) [-3908.064] * [-3902.838] (-3903.121) (-3905.399) (-3899.498) -- 0:03:05
      143500 -- (-3896.731) (-3898.666) [-3898.659] (-3908.690) * (-3896.657) (-3897.208) [-3897.111] (-3905.596) -- 0:03:05
      144000 -- (-3898.608) (-3898.623) (-3904.066) [-3897.376] * (-3896.027) (-3903.173) [-3897.972] (-3900.892) -- 0:03:04
      144500 -- (-3909.629) [-3897.478] (-3907.360) (-3901.265) * [-3904.201] (-3898.051) (-3897.751) (-3899.924) -- 0:03:03
      145000 -- (-3903.296) (-3896.812) (-3907.881) [-3898.242] * (-3902.591) [-3895.767] (-3903.802) (-3897.991) -- 0:03:02

      Average standard deviation of split frequencies: 0.004843

      145500 -- (-3902.720) (-3903.621) [-3902.067] (-3904.467) * (-3903.292) (-3901.116) (-3911.597) [-3897.436] -- 0:03:02
      146000 -- (-3899.034) (-3897.382) [-3907.603] (-3902.484) * [-3901.503] (-3897.067) (-3898.567) (-3903.345) -- 0:03:01
      146500 -- (-3899.784) (-3898.584) (-3899.214) [-3902.336] * [-3904.549] (-3902.247) (-3901.264) (-3899.151) -- 0:03:00
      147000 -- [-3899.309] (-3904.296) (-3898.477) (-3909.521) * (-3906.933) [-3901.550] (-3899.414) (-3901.063) -- 0:02:59
      147500 -- [-3905.456] (-3905.485) (-3905.991) (-3901.721) * (-3903.860) (-3898.485) [-3899.694] (-3899.681) -- 0:03:04
      148000 -- (-3902.349) [-3897.854] (-3909.693) (-3900.189) * [-3896.849] (-3899.275) (-3901.956) (-3904.762) -- 0:03:04
      148500 -- (-3901.863) [-3898.306] (-3904.006) (-3899.656) * [-3912.509] (-3903.029) (-3897.706) (-3899.579) -- 0:03:03
      149000 -- [-3905.530] (-3894.259) (-3901.380) (-3904.208) * (-3900.462) (-3898.298) (-3896.423) [-3897.256] -- 0:03:02
      149500 -- [-3899.545] (-3897.392) (-3898.943) (-3903.653) * (-3899.842) [-3898.991] (-3901.918) (-3896.003) -- 0:03:02
      150000 -- [-3906.175] (-3906.836) (-3896.998) (-3900.770) * (-3902.557) (-3898.798) [-3907.902] (-3898.331) -- 0:03:01

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-3896.707) [-3899.495] (-3903.141) (-3904.037) * (-3899.361) (-3902.432) [-3906.885] (-3896.398) -- 0:03:00
      151000 -- (-3899.508) [-3897.682] (-3903.263) (-3909.456) * (-3908.073) (-3904.578) [-3903.480] (-3900.757) -- 0:02:59
      151500 -- (-3904.272) (-3899.438) [-3901.153] (-3900.415) * [-3904.410] (-3899.479) (-3900.692) (-3907.390) -- 0:02:59
      152000 -- (-3899.993) [-3900.597] (-3896.751) (-3905.827) * (-3903.713) [-3901.745] (-3898.361) (-3904.309) -- 0:02:58
      152500 -- (-3906.024) (-3905.392) [-3897.779] (-3904.411) * [-3898.516] (-3899.443) (-3897.402) (-3906.786) -- 0:03:03
      153000 -- (-3894.758) (-3898.484) [-3898.819] (-3899.342) * (-3898.992) (-3898.998) (-3897.560) [-3894.025] -- 0:03:02
      153500 -- (-3898.335) (-3904.713) [-3898.923] (-3896.682) * (-3901.274) [-3897.760] (-3899.202) (-3899.134) -- 0:03:01
      154000 -- [-3894.823] (-3906.301) (-3895.471) (-3902.347) * (-3900.154) (-3902.287) (-3893.795) [-3899.724] -- 0:03:01
      154500 -- [-3898.738] (-3898.945) (-3909.478) (-3898.801) * (-3902.297) [-3900.841] (-3897.820) (-3899.313) -- 0:03:00
      155000 -- (-3900.518) (-3901.564) [-3899.730] (-3902.397) * (-3902.409) (-3900.209) (-3900.880) [-3899.642] -- 0:02:59

      Average standard deviation of split frequencies: 0.001511

      155500 -- [-3894.909] (-3901.135) (-3902.553) (-3897.537) * (-3895.750) (-3895.982) [-3907.978] (-3899.436) -- 0:02:59
      156000 -- [-3901.463] (-3896.264) (-3897.140) (-3899.996) * [-3898.520] (-3901.851) (-3900.752) (-3903.989) -- 0:02:58
      156500 -- (-3898.833) [-3903.081] (-3899.993) (-3897.373) * (-3906.191) [-3900.415] (-3897.433) (-3902.355) -- 0:02:57
      157000 -- (-3903.811) (-3903.783) [-3897.630] (-3903.996) * (-3901.469) (-3900.295) [-3904.602] (-3907.374) -- 0:03:02
      157500 -- [-3902.905] (-3899.825) (-3895.663) (-3896.119) * (-3892.517) (-3900.273) (-3902.654) [-3898.751] -- 0:03:01
      158000 -- (-3896.246) (-3904.534) [-3896.560] (-3910.152) * (-3905.331) (-3900.925) (-3903.040) [-3895.578] -- 0:03:01
      158500 -- (-3895.185) (-3900.679) (-3900.160) [-3900.209] * (-3904.267) [-3897.865] (-3895.440) (-3902.895) -- 0:03:00
      159000 -- (-3909.469) [-3898.062] (-3902.498) (-3901.726) * (-3907.555) (-3901.232) [-3900.135] (-3901.198) -- 0:02:59
      159500 -- (-3901.225) [-3894.009] (-3903.845) (-3900.908) * (-3901.042) [-3900.968] (-3900.896) (-3904.247) -- 0:02:59
      160000 -- [-3901.857] (-3898.482) (-3901.201) (-3896.123) * (-3904.136) [-3898.176] (-3901.976) (-3898.647) -- 0:02:58

      Average standard deviation of split frequencies: 0.005868

      160500 -- (-3901.104) (-3896.965) (-3895.871) [-3901.933] * (-3894.603) [-3893.104] (-3901.293) (-3903.499) -- 0:02:57
      161000 -- [-3898.729] (-3906.116) (-3907.635) (-3906.219) * (-3899.819) (-3902.270) (-3900.111) [-3898.253] -- 0:02:57
      161500 -- (-3899.610) (-3900.532) (-3901.996) [-3904.430] * (-3909.210) [-3893.395] (-3896.349) (-3905.219) -- 0:02:56
      162000 -- (-3905.496) (-3898.350) [-3899.598] (-3898.301) * (-3906.408) (-3896.884) (-3898.743) [-3899.501] -- 0:03:01
      162500 -- [-3900.414] (-3906.239) (-3914.673) (-3900.625) * (-3909.940) (-3899.874) [-3903.991] (-3907.828) -- 0:03:00
      163000 -- (-3906.624) (-3899.239) [-3900.925] (-3902.857) * (-3901.586) [-3898.100] (-3905.995) (-3909.934) -- 0:02:59
      163500 -- [-3900.080] (-3895.679) (-3904.866) (-3899.954) * (-3912.691) (-3895.977) (-3909.088) [-3899.380] -- 0:02:59
      164000 -- (-3896.166) (-3898.360) (-3910.964) [-3902.041] * (-3899.836) (-3903.573) (-3903.073) [-3904.740] -- 0:02:58
      164500 -- (-3899.155) (-3897.917) [-3899.337] (-3905.094) * (-3905.401) [-3902.468] (-3901.310) (-3899.736) -- 0:02:57
      165000 -- (-3897.319) [-3906.648] (-3897.552) (-3898.508) * (-3900.171) (-3900.186) [-3901.769] (-3898.553) -- 0:02:57

      Average standard deviation of split frequencies: 0.005680

      165500 -- [-3906.364] (-3901.241) (-3898.934) (-3900.201) * (-3899.628) [-3899.236] (-3907.444) (-3896.752) -- 0:02:56
      166000 -- (-3902.144) (-3901.307) [-3899.592] (-3901.087) * (-3903.544) [-3902.725] (-3905.798) (-3898.827) -- 0:02:55
      166500 -- [-3900.004] (-3902.629) (-3901.640) (-3900.771) * (-3899.096) (-3904.675) (-3900.404) [-3896.560] -- 0:03:00
      167000 -- (-3902.999) [-3908.377] (-3901.129) (-3899.401) * (-3895.942) (-3902.092) [-3900.038] (-3896.124) -- 0:02:59
      167500 -- (-3904.146) (-3904.423) (-3907.301) [-3901.951] * (-3900.114) (-3901.533) [-3895.161] (-3902.490) -- 0:02:58
      168000 -- (-3902.662) (-3893.286) [-3899.394] (-3905.480) * (-3896.029) (-3899.341) (-3900.935) [-3900.070] -- 0:02:58
      168500 -- (-3903.108) (-3897.394) (-3902.636) [-3898.661] * (-3903.881) (-3902.884) [-3904.037] (-3902.534) -- 0:02:57
      169000 -- (-3901.689) [-3898.324] (-3906.751) (-3902.488) * (-3903.509) (-3907.407) (-3901.259) [-3904.751] -- 0:02:57
      169500 -- (-3899.283) (-3911.409) (-3903.099) [-3896.194] * (-3898.344) (-3905.508) (-3897.233) [-3903.482] -- 0:02:56
      170000 -- [-3902.193] (-3910.571) (-3900.310) (-3897.276) * (-3901.543) [-3898.880] (-3899.422) (-3902.570) -- 0:02:55

      Average standard deviation of split frequencies: 0.005524

      170500 -- [-3907.447] (-3910.155) (-3905.637) (-3899.145) * (-3897.669) [-3904.021] (-3903.733) (-3898.093) -- 0:02:55
      171000 -- (-3895.394) (-3908.611) (-3901.935) [-3895.224] * (-3903.431) [-3904.068] (-3901.469) (-3905.542) -- 0:02:54
      171500 -- (-3906.151) [-3904.500] (-3909.131) (-3899.173) * (-3899.815) [-3901.680] (-3898.656) (-3904.175) -- 0:02:58
      172000 -- (-3906.965) (-3902.529) [-3905.264] (-3894.946) * (-3898.483) [-3901.890] (-3906.572) (-3905.614) -- 0:02:58
      172500 -- (-3906.005) (-3900.369) [-3905.852] (-3895.020) * (-3900.331) (-3901.656) (-3896.468) [-3901.202] -- 0:02:57
      173000 -- (-3901.766) (-3898.787) (-3903.084) [-3900.058] * (-3899.647) (-3896.830) (-3896.146) [-3901.115] -- 0:02:56
      173500 -- (-3903.726) (-3899.047) [-3899.923] (-3907.157) * (-3901.249) (-3900.099) (-3899.842) [-3898.616] -- 0:02:56
      174000 -- [-3895.590] (-3895.349) (-3905.625) (-3908.278) * (-3900.365) (-3898.172) (-3909.798) [-3901.043] -- 0:02:55
      174500 -- (-3901.008) (-3907.301) [-3900.748] (-3902.017) * (-3896.256) [-3900.118] (-3900.783) (-3908.109) -- 0:02:55
      175000 -- (-3895.872) (-3908.196) [-3904.805] (-3904.615) * [-3899.331] (-3896.953) (-3897.467) (-3899.594) -- 0:02:54

      Average standard deviation of split frequencies: 0.006696

      175500 -- (-3897.315) (-3909.754) (-3902.049) [-3897.484] * (-3902.599) (-3898.627) [-3897.257] (-3899.851) -- 0:02:53
      176000 -- [-3896.503] (-3907.097) (-3896.178) (-3903.284) * (-3908.989) (-3904.218) [-3903.327] (-3904.501) -- 0:02:57
      176500 -- (-3913.360) [-3907.095] (-3898.869) (-3900.874) * (-3899.575) (-3902.914) [-3898.479] (-3902.673) -- 0:02:57
      177000 -- [-3896.015] (-3900.672) (-3907.643) (-3906.933) * [-3899.308] (-3906.590) (-3897.214) (-3902.094) -- 0:02:56
      177500 -- [-3900.882] (-3897.422) (-3900.175) (-3898.607) * (-3899.404) (-3901.084) (-3903.586) [-3898.725] -- 0:02:56
      178000 -- (-3895.203) [-3906.250] (-3903.563) (-3905.615) * (-3899.240) (-3907.046) [-3899.725] (-3901.575) -- 0:02:55
      178500 -- (-3895.421) (-3899.726) [-3900.107] (-3898.115) * (-3896.747) (-3900.103) [-3900.076] (-3907.336) -- 0:02:54
      179000 -- (-3905.784) [-3898.538] (-3895.419) (-3893.321) * (-3899.411) [-3898.668] (-3903.833) (-3903.036) -- 0:02:54
      179500 -- (-3895.222) (-3900.483) [-3896.356] (-3898.022) * (-3902.346) (-3902.013) [-3899.074] (-3903.473) -- 0:02:53
      180000 -- [-3898.697] (-3896.553) (-3897.247) (-3899.927) * [-3903.085] (-3897.439) (-3903.849) (-3904.606) -- 0:02:53

      Average standard deviation of split frequencies: 0.002609

      180500 -- (-3896.522) (-3898.971) [-3898.064] (-3899.534) * (-3894.907) (-3904.901) [-3898.497] (-3899.527) -- 0:02:52
      181000 -- (-3902.410) (-3906.265) (-3898.400) [-3897.745] * [-3903.860] (-3905.575) (-3904.099) (-3898.138) -- 0:02:56
      181500 -- (-3899.354) (-3898.104) [-3900.774] (-3904.038) * (-3900.081) [-3901.422] (-3908.733) (-3901.596) -- 0:02:55
      182000 -- [-3909.033] (-3908.678) (-3903.677) (-3901.368) * [-3901.572] (-3904.235) (-3918.677) (-3903.717) -- 0:02:55
      182500 -- [-3896.630] (-3908.116) (-3905.787) (-3908.354) * (-3895.943) [-3896.826] (-3901.586) (-3900.174) -- 0:02:54
      183000 -- (-3906.925) (-3901.351) [-3898.571] (-3896.559) * (-3898.813) (-3896.884) [-3907.532] (-3909.028) -- 0:02:54
      183500 -- (-3902.395) [-3898.810] (-3898.931) (-3901.400) * (-3906.108) (-3895.129) (-3908.414) [-3898.360] -- 0:02:53
      184000 -- (-3904.314) (-3898.857) (-3906.826) [-3901.255] * [-3904.295] (-3900.574) (-3907.655) (-3896.750) -- 0:02:52
      184500 -- (-3895.901) [-3899.478] (-3900.595) (-3902.387) * (-3909.380) (-3901.094) (-3903.150) [-3895.717] -- 0:02:52
      185000 -- [-3906.174] (-3906.159) (-3899.175) (-3906.418) * (-3905.004) (-3894.134) (-3914.058) [-3899.438] -- 0:02:51

      Average standard deviation of split frequencies: 0.005069

      185500 -- (-3899.283) [-3900.940] (-3897.815) (-3904.313) * [-3895.570] (-3899.711) (-3921.972) (-3903.042) -- 0:02:55
      186000 -- (-3906.150) (-3901.701) (-3901.745) [-3898.519] * (-3900.243) (-3897.584) [-3899.939] (-3897.740) -- 0:02:55
      186500 -- (-3902.111) (-3901.935) [-3902.159] (-3905.349) * [-3897.957] (-3896.499) (-3901.378) (-3910.327) -- 0:02:54
      187000 -- (-3903.807) (-3902.811) [-3908.715] (-3913.665) * (-3896.602) (-3905.193) [-3895.856] (-3907.388) -- 0:02:53
      187500 -- (-3898.336) [-3901.749] (-3896.070) (-3908.122) * (-3898.605) (-3898.313) [-3896.221] (-3896.184) -- 0:02:53
      188000 -- (-3897.104) (-3901.530) (-3906.399) [-3901.700] * (-3906.523) (-3896.150) [-3898.723] (-3903.093) -- 0:02:52
      188500 -- [-3906.484] (-3905.641) (-3893.511) (-3911.419) * (-3904.609) (-3899.879) [-3897.728] (-3900.935) -- 0:02:52
      189000 -- (-3898.162) (-3900.476) (-3898.143) [-3904.368] * (-3900.350) (-3902.040) [-3896.676] (-3903.548) -- 0:02:51
      189500 -- (-3901.568) [-3898.053] (-3899.400) (-3899.678) * (-3896.960) [-3897.254] (-3901.626) (-3911.182) -- 0:02:51
      190000 -- (-3900.884) (-3897.204) (-3901.026) [-3896.510] * (-3899.625) (-3902.851) [-3898.271] (-3896.210) -- 0:02:54

      Average standard deviation of split frequencies: 0.004945

      190500 -- (-3895.849) [-3901.021] (-3902.651) (-3897.363) * (-3907.445) (-3905.502) (-3901.017) [-3906.362] -- 0:02:54
      191000 -- [-3898.755] (-3899.379) (-3910.345) (-3900.804) * (-3905.083) (-3907.925) (-3900.587) [-3897.984] -- 0:02:53
      191500 -- (-3899.053) (-3907.646) [-3905.009] (-3897.770) * [-3895.069] (-3893.765) (-3904.169) (-3897.050) -- 0:02:53
      192000 -- (-3897.243) (-3898.250) (-3911.290) [-3899.272] * [-3899.321] (-3902.226) (-3905.173) (-3897.023) -- 0:02:52
      192500 -- (-3897.095) [-3900.198] (-3905.543) (-3901.567) * [-3895.204] (-3903.963) (-3901.928) (-3901.422) -- 0:02:51
      193000 -- (-3897.500) (-3905.021) [-3899.377] (-3896.907) * (-3898.333) (-3903.458) (-3902.949) [-3896.770] -- 0:02:51
      193500 -- (-3898.134) (-3901.826) (-3903.957) [-3902.894] * (-3899.364) (-3895.591) [-3900.054] (-3910.853) -- 0:02:50
      194000 -- (-3905.574) (-3905.701) (-3909.683) [-3900.181] * (-3911.705) [-3902.962] (-3901.614) (-3907.370) -- 0:02:50
      194500 -- (-3905.355) (-3903.929) (-3896.864) [-3894.363] * (-3911.085) (-3899.173) [-3894.740] (-3902.854) -- 0:02:49
      195000 -- (-3907.691) (-3907.257) (-3903.459) [-3895.857] * (-3900.147) (-3895.249) (-3900.600) [-3901.432] -- 0:02:53

      Average standard deviation of split frequencies: 0.006013

      195500 -- (-3900.250) (-3910.276) [-3903.078] (-3901.830) * [-3906.048] (-3895.540) (-3898.806) (-3901.169) -- 0:02:52
      196000 -- (-3901.904) (-3898.532) [-3898.675] (-3904.615) * (-3906.132) (-3897.315) [-3898.890] (-3908.297) -- 0:02:52
      196500 -- (-3898.059) [-3902.161] (-3900.472) (-3901.751) * (-3899.336) (-3905.652) [-3896.312] (-3907.795) -- 0:02:51
      197000 -- (-3895.054) (-3896.830) [-3897.237] (-3904.585) * (-3900.365) (-3916.816) [-3895.036] (-3902.886) -- 0:02:51
      197500 -- (-3901.267) (-3898.260) (-3901.646) [-3901.512] * (-3896.227) [-3899.925] (-3900.150) (-3899.753) -- 0:02:50
      198000 -- [-3901.168] (-3899.916) (-3898.685) (-3904.889) * (-3898.777) [-3902.416] (-3897.090) (-3902.491) -- 0:02:50
      198500 -- (-3900.081) [-3903.052] (-3901.477) (-3899.406) * (-3901.169) (-3911.260) [-3897.802] (-3901.616) -- 0:02:49
      199000 -- (-3896.634) (-3901.332) [-3898.425] (-3905.413) * (-3896.898) (-3896.362) (-3904.623) [-3898.733] -- 0:02:49
      199500 -- [-3897.796] (-3899.224) (-3892.643) (-3900.453) * [-3896.776] (-3897.933) (-3909.215) (-3901.993) -- 0:02:48
      200000 -- (-3902.592) [-3898.499] (-3897.301) (-3905.276) * (-3901.614) [-3901.135] (-3898.248) (-3900.559) -- 0:02:52

      Average standard deviation of split frequencies: 0.003524

      200500 -- (-3908.803) [-3902.210] (-3898.217) (-3895.381) * (-3899.091) (-3907.475) (-3904.238) [-3898.585] -- 0:02:51
      201000 -- (-3901.960) (-3899.916) (-3899.358) [-3896.593] * (-3903.315) [-3896.935] (-3906.404) (-3909.971) -- 0:02:50
      201500 -- (-3899.878) [-3897.752] (-3897.209) (-3904.077) * [-3895.300] (-3908.665) (-3897.693) (-3898.703) -- 0:02:50
      202000 -- (-3900.756) (-3898.643) [-3899.518] (-3909.914) * [-3896.727] (-3897.559) (-3906.756) (-3906.445) -- 0:02:49
      202500 -- (-3897.568) [-3898.551] (-3895.084) (-3902.784) * (-3897.824) (-3899.477) (-3907.667) [-3895.479] -- 0:02:49
      203000 -- (-3901.377) (-3898.690) (-3903.586) [-3894.562] * [-3897.518] (-3897.635) (-3898.549) (-3903.616) -- 0:02:48
      203500 -- (-3896.954) (-3902.325) (-3904.292) [-3898.627] * (-3897.157) (-3904.230) [-3906.054] (-3908.211) -- 0:02:48
      204000 -- (-3898.741) (-3905.077) (-3897.453) [-3896.170] * (-3894.547) (-3899.687) [-3908.341] (-3903.960) -- 0:02:47
      204500 -- (-3895.664) (-3910.717) (-3903.149) [-3904.486] * (-3893.509) [-3904.049] (-3898.508) (-3902.712) -- 0:02:51
      205000 -- (-3895.079) (-3901.558) (-3904.752) [-3899.669] * (-3902.997) (-3904.829) [-3896.385] (-3903.267) -- 0:02:50

      Average standard deviation of split frequencies: 0.006865

      205500 -- [-3905.312] (-3901.051) (-3909.158) (-3899.389) * (-3906.199) (-3906.387) (-3902.136) [-3900.127] -- 0:02:50
      206000 -- (-3905.298) (-3902.899) (-3902.246) [-3897.922] * (-3915.424) [-3900.154] (-3898.312) (-3899.746) -- 0:02:49
      206500 -- (-3898.315) (-3899.320) (-3901.557) [-3899.044] * (-3909.114) (-3897.982) (-3896.419) [-3895.416] -- 0:02:49
      207000 -- [-3896.285] (-3900.135) (-3908.212) (-3899.925) * (-3907.276) (-3905.213) (-3901.256) [-3900.321] -- 0:02:48
      207500 -- (-3897.971) [-3897.722] (-3897.936) (-3898.614) * [-3909.441] (-3905.492) (-3902.010) (-3905.921) -- 0:02:48
      208000 -- [-3900.001] (-3911.737) (-3903.561) (-3900.458) * (-3900.805) (-3902.527) [-3898.868] (-3897.679) -- 0:02:47
      208500 -- [-3896.140] (-3895.898) (-3903.397) (-3900.817) * (-3901.542) (-3901.661) [-3898.586] (-3903.923) -- 0:02:47
      209000 -- [-3896.814] (-3896.158) (-3907.263) (-3901.772) * (-3904.005) [-3901.822] (-3901.348) (-3903.978) -- 0:02:50
      209500 -- (-3899.081) (-3900.915) [-3899.344] (-3900.607) * (-3904.427) [-3900.655] (-3900.241) (-3907.221) -- 0:02:49
      210000 -- (-3899.414) [-3894.367] (-3896.127) (-3895.862) * (-3905.944) (-3903.755) [-3895.518] (-3910.040) -- 0:02:49

      Average standard deviation of split frequencies: 0.007832

      210500 -- (-3896.740) [-3895.921] (-3902.520) (-3897.027) * (-3903.392) [-3898.286] (-3899.160) (-3916.610) -- 0:02:48
      211000 -- (-3901.134) (-3895.412) [-3898.442] (-3902.319) * (-3896.606) (-3896.459) [-3900.945] (-3901.138) -- 0:02:48
      211500 -- [-3898.474] (-3897.280) (-3896.772) (-3902.079) * (-3900.057) [-3900.893] (-3902.691) (-3897.669) -- 0:02:47
      212000 -- (-3902.115) (-3901.119) (-3897.514) [-3899.573] * [-3898.191] (-3902.270) (-3901.456) (-3904.880) -- 0:02:47
      212500 -- (-3906.828) (-3900.713) [-3898.378] (-3904.991) * (-3900.909) (-3906.804) [-3900.510] (-3902.963) -- 0:02:46
      213000 -- [-3908.721] (-3903.647) (-3900.669) (-3905.730) * (-3920.083) (-3899.754) (-3897.972) [-3904.617] -- 0:02:46
      213500 -- (-3896.315) [-3897.342] (-3902.468) (-3905.613) * (-3903.367) (-3897.665) [-3905.512] (-3906.492) -- 0:02:45
      214000 -- [-3900.343] (-3905.517) (-3903.482) (-3902.168) * (-3908.168) (-3899.896) [-3902.177] (-3905.385) -- 0:02:48
      214500 -- (-3899.830) [-3899.786] (-3899.433) (-3906.936) * (-3896.027) [-3900.150] (-3904.984) (-3906.008) -- 0:02:48
      215000 -- [-3905.758] (-3899.057) (-3899.706) (-3902.219) * (-3899.983) (-3905.833) [-3898.283] (-3898.259) -- 0:02:47

      Average standard deviation of split frequencies: 0.008730

      215500 -- (-3902.933) [-3900.418] (-3903.178) (-3903.033) * (-3900.905) [-3904.274] (-3905.677) (-3901.077) -- 0:02:47
      216000 -- [-3896.348] (-3903.164) (-3899.509) (-3904.082) * (-3903.415) [-3896.099] (-3896.722) (-3895.270) -- 0:02:46
      216500 -- [-3900.590] (-3897.602) (-3897.020) (-3896.522) * (-3900.652) (-3897.909) [-3902.843] (-3903.478) -- 0:02:46
      217000 -- (-3904.457) [-3895.969] (-3903.765) (-3909.006) * (-3902.034) (-3901.326) [-3896.307] (-3900.543) -- 0:02:45
      217500 -- (-3900.582) [-3901.074] (-3898.182) (-3897.174) * [-3899.455] (-3901.416) (-3903.713) (-3904.635) -- 0:02:45
      218000 -- (-3895.754) (-3904.194) [-3900.637] (-3903.613) * (-3902.799) (-3904.695) (-3899.294) [-3895.347] -- 0:02:45
      218500 -- (-3899.334) (-3906.778) [-3896.685] (-3904.000) * (-3895.851) (-3896.533) (-3905.124) [-3897.930] -- 0:02:48
      219000 -- (-3900.636) [-3896.867] (-3895.349) (-3899.278) * (-3900.977) [-3898.657] (-3897.891) (-3897.940) -- 0:02:47
      219500 -- (-3912.465) [-3898.451] (-3901.365) (-3899.232) * (-3898.849) (-3907.922) (-3901.364) [-3900.012] -- 0:02:47
      220000 -- (-3900.594) [-3900.508] (-3906.074) (-3902.832) * (-3896.008) [-3897.876] (-3901.077) (-3894.026) -- 0:02:46

      Average standard deviation of split frequencies: 0.009613

      220500 -- [-3901.790] (-3902.169) (-3905.295) (-3912.432) * (-3897.910) (-3905.558) (-3895.345) [-3894.651] -- 0:02:46
      221000 -- (-3894.444) (-3895.273) (-3899.848) [-3902.893] * (-3900.285) (-3902.682) (-3901.055) [-3898.066] -- 0:02:45
      221500 -- (-3901.890) (-3896.814) (-3902.874) [-3901.413] * (-3903.688) (-3901.268) [-3897.947] (-3904.456) -- 0:02:45
      222000 -- [-3903.347] (-3899.817) (-3900.421) (-3898.822) * (-3906.150) [-3905.616] (-3902.191) (-3900.516) -- 0:02:44
      222500 -- (-3897.905) [-3893.029] (-3899.000) (-3901.771) * (-3904.902) (-3903.115) [-3896.233] (-3900.208) -- 0:02:44
      223000 -- (-3901.000) (-3894.437) [-3896.021] (-3896.729) * (-3902.765) (-3899.309) (-3897.944) [-3902.461] -- 0:02:43
      223500 -- [-3896.429] (-3895.901) (-3903.099) (-3900.506) * (-3901.134) [-3897.550] (-3898.287) (-3904.725) -- 0:02:46
      224000 -- [-3903.198] (-3907.709) (-3902.186) (-3893.335) * (-3899.048) (-3896.915) [-3902.802] (-3901.740) -- 0:02:46
      224500 -- (-3896.887) (-3911.238) (-3898.618) [-3897.418] * (-3900.784) (-3898.686) [-3900.678] (-3898.250) -- 0:02:45
      225000 -- (-3903.680) (-3906.965) [-3898.279] (-3895.046) * (-3904.086) [-3898.741] (-3901.680) (-3914.525) -- 0:02:45

      Average standard deviation of split frequencies: 0.009386

      225500 -- (-3897.704) (-3901.683) (-3898.891) [-3900.855] * (-3899.958) (-3900.673) [-3894.616] (-3898.293) -- 0:02:44
      226000 -- [-3902.499] (-3904.308) (-3898.420) (-3897.083) * (-3897.724) (-3902.745) (-3899.014) [-3897.174] -- 0:02:44
      226500 -- [-3905.355] (-3900.214) (-3904.253) (-3900.000) * (-3902.057) [-3902.089] (-3901.177) (-3902.853) -- 0:02:43
      227000 -- (-3897.909) (-3908.156) (-3898.446) [-3894.144] * (-3908.345) [-3898.706] (-3902.267) (-3896.997) -- 0:02:43
      227500 -- (-3899.283) (-3904.247) (-3907.740) [-3898.780] * (-3901.916) (-3900.590) [-3900.710] (-3899.280) -- 0:02:42
      228000 -- (-3902.319) (-3902.610) [-3904.411] (-3899.864) * (-3909.526) (-3897.928) (-3907.051) [-3901.343] -- 0:02:45
      228500 -- (-3905.227) [-3903.581] (-3918.011) (-3898.052) * [-3899.924] (-3905.719) (-3904.126) (-3901.276) -- 0:02:45
      229000 -- (-3905.025) (-3899.102) (-3903.730) [-3895.997] * (-3906.340) [-3899.216] (-3910.667) (-3905.348) -- 0:02:44
      229500 -- (-3901.619) (-3912.321) (-3906.642) [-3898.222] * (-3899.237) [-3897.952] (-3913.128) (-3900.113) -- 0:02:44
      230000 -- (-3902.133) [-3896.650] (-3909.341) (-3900.345) * (-3898.368) [-3903.508] (-3899.757) (-3900.165) -- 0:02:44

      Average standard deviation of split frequencies: 0.008175

      230500 -- [-3898.821] (-3898.566) (-3902.846) (-3902.912) * (-3896.436) [-3900.500] (-3905.883) (-3896.932) -- 0:02:43
      231000 -- (-3903.390) (-3898.301) [-3896.923] (-3905.336) * (-3900.273) [-3894.214] (-3902.918) (-3896.666) -- 0:02:43
      231500 -- (-3902.315) (-3898.903) (-3896.765) [-3906.019] * (-3907.881) (-3895.539) [-3902.466] (-3893.489) -- 0:02:42
      232000 -- (-3899.803) (-3901.753) (-3903.357) [-3905.381] * [-3900.329] (-3894.544) (-3897.483) (-3900.864) -- 0:02:42
      232500 -- [-3896.144] (-3903.392) (-3901.235) (-3904.101) * (-3906.814) [-3901.472] (-3895.904) (-3903.011) -- 0:02:45
      233000 -- (-3899.990) [-3896.959] (-3900.767) (-3897.362) * (-3907.333) (-3897.131) (-3898.961) [-3899.797] -- 0:02:44
      233500 -- [-3897.025] (-3897.825) (-3903.952) (-3897.051) * (-3900.863) (-3902.911) (-3903.913) [-3898.077] -- 0:02:44
      234000 -- (-3898.718) [-3901.454] (-3899.988) (-3901.841) * (-3905.969) (-3900.740) [-3900.575] (-3902.821) -- 0:02:43
      234500 -- (-3901.372) (-3899.917) (-3899.090) [-3905.227] * (-3898.809) (-3902.425) (-3897.595) [-3899.823] -- 0:02:43
      235000 -- [-3904.144] (-3902.745) (-3902.723) (-3899.128) * [-3901.814] (-3897.471) (-3907.544) (-3905.093) -- 0:02:42

      Average standard deviation of split frequencies: 0.008989

      235500 -- (-3897.053) (-3905.961) [-3897.590] (-3896.916) * (-3895.344) [-3898.139] (-3903.426) (-3901.718) -- 0:02:42
      236000 -- (-3902.479) (-3902.698) (-3898.469) [-3893.973] * (-3898.438) (-3900.723) [-3896.979] (-3898.158) -- 0:02:41
      236500 -- [-3900.983] (-3898.533) (-3906.979) (-3899.659) * [-3900.565] (-3899.774) (-3917.027) (-3900.651) -- 0:02:41
      237000 -- (-3898.999) (-3902.182) (-3905.497) [-3896.936] * (-3900.651) (-3906.980) [-3902.360] (-3897.039) -- 0:02:40
      237500 -- [-3897.642] (-3908.076) (-3903.351) (-3899.546) * [-3900.403] (-3901.133) (-3910.965) (-3905.301) -- 0:02:43
      238000 -- [-3899.736] (-3900.640) (-3905.522) (-3905.439) * (-3898.429) (-3900.834) [-3903.901] (-3905.119) -- 0:02:43
      238500 -- (-3900.979) [-3898.596] (-3900.603) (-3906.277) * (-3896.767) (-3897.298) [-3903.989] (-3903.226) -- 0:02:42
      239000 -- (-3903.481) (-3901.859) [-3898.255] (-3906.192) * (-3900.180) (-3898.672) [-3899.735] (-3901.040) -- 0:02:42
      239500 -- (-3902.188) (-3901.570) [-3906.034] (-3901.067) * (-3896.729) (-3901.715) (-3898.863) [-3895.974] -- 0:02:41
      240000 -- [-3906.966] (-3899.153) (-3905.439) (-3900.824) * [-3898.886] (-3895.300) (-3900.174) (-3902.075) -- 0:02:41

      Average standard deviation of split frequencies: 0.008814

      240500 -- (-3904.779) [-3901.766] (-3894.304) (-3911.088) * [-3896.625] (-3900.980) (-3902.667) (-3902.312) -- 0:02:41
      241000 -- (-3901.781) (-3903.287) [-3900.699] (-3904.295) * (-3899.928) (-3907.689) [-3905.050] (-3900.880) -- 0:02:40
      241500 -- (-3899.426) (-3906.850) (-3899.010) [-3899.633] * (-3902.453) [-3907.668] (-3908.335) (-3899.432) -- 0:02:40
      242000 -- (-3894.007) [-3907.973] (-3901.828) (-3905.092) * (-3907.405) (-3903.984) (-3901.066) [-3901.347] -- 0:02:42
      242500 -- [-3905.712] (-3904.257) (-3896.622) (-3898.543) * (-3898.551) (-3900.724) (-3903.229) [-3893.876] -- 0:02:42
      243000 -- [-3902.345] (-3901.691) (-3904.149) (-3899.390) * (-3893.837) [-3898.422] (-3900.290) (-3900.608) -- 0:02:41
      243500 -- (-3902.134) (-3903.616) (-3900.376) [-3897.398] * (-3897.311) [-3896.389] (-3898.797) (-3897.974) -- 0:02:41
      244000 -- (-3903.187) [-3901.321] (-3900.471) (-3912.435) * (-3900.209) (-3904.512) (-3898.770) [-3898.103] -- 0:02:41
      244500 -- (-3904.858) (-3893.056) [-3898.486] (-3910.003) * [-3898.849] (-3905.563) (-3901.422) (-3904.281) -- 0:02:40
      245000 -- [-3899.199] (-3895.075) (-3901.015) (-3897.137) * (-3895.036) [-3901.179] (-3902.820) (-3906.967) -- 0:02:40

      Average standard deviation of split frequencies: 0.008623

      245500 -- (-3895.627) (-3897.710) [-3896.032] (-3900.128) * (-3900.018) [-3901.958] (-3899.758) (-3901.197) -- 0:02:39
      246000 -- (-3903.418) (-3908.304) [-3897.661] (-3900.049) * (-3901.518) (-3904.835) (-3899.811) [-3899.209] -- 0:02:39
      246500 -- [-3901.572] (-3910.896) (-3898.499) (-3902.591) * (-3897.844) [-3899.140] (-3901.867) (-3905.866) -- 0:02:38
      247000 -- (-3902.392) [-3899.856] (-3899.532) (-3901.424) * (-3902.693) [-3903.248] (-3895.386) (-3910.250) -- 0:02:41
      247500 -- (-3897.551) (-3900.034) [-3904.618] (-3909.549) * (-3902.154) [-3902.195] (-3901.607) (-3900.828) -- 0:02:41
      248000 -- [-3898.032] (-3895.645) (-3902.809) (-3905.491) * (-3909.592) (-3898.451) [-3900.258] (-3900.915) -- 0:02:40
      248500 -- [-3898.361] (-3894.187) (-3898.869) (-3903.852) * [-3904.114] (-3898.297) (-3899.381) (-3905.912) -- 0:02:40
      249000 -- (-3905.922) [-3902.102] (-3903.257) (-3906.711) * [-3900.358] (-3892.611) (-3905.622) (-3908.807) -- 0:02:39
      249500 -- [-3902.313] (-3910.892) (-3907.110) (-3899.455) * (-3901.046) [-3899.544] (-3903.496) (-3901.324) -- 0:02:39
      250000 -- (-3899.556) [-3903.551] (-3901.466) (-3898.896) * (-3908.384) (-3908.951) [-3897.046] (-3901.182) -- 0:02:39

      Average standard deviation of split frequencies: 0.011284

      250500 -- (-3903.866) (-3904.819) [-3900.791] (-3898.619) * (-3905.330) (-3897.861) [-3894.898] (-3899.172) -- 0:02:38
      251000 -- [-3903.106] (-3907.091) (-3901.242) (-3905.376) * (-3905.722) (-3903.667) [-3904.152] (-3901.337) -- 0:02:38
      251500 -- (-3911.734) (-3902.966) (-3897.248) [-3899.349] * (-3898.892) [-3898.735] (-3903.014) (-3901.411) -- 0:02:40
      252000 -- (-3904.752) [-3903.276] (-3901.762) (-3900.362) * [-3899.948] (-3898.869) (-3896.804) (-3903.662) -- 0:02:40
      252500 -- (-3900.955) [-3896.244] (-3906.362) (-3896.015) * (-3907.606) [-3901.506] (-3904.186) (-3900.025) -- 0:02:39
      253000 -- (-3904.614) (-3902.348) (-3900.336) [-3901.614] * [-3903.886] (-3902.664) (-3894.886) (-3903.266) -- 0:02:39
      253500 -- (-3904.607) (-3895.667) [-3894.798] (-3900.358) * (-3902.330) [-3898.653] (-3898.612) (-3909.324) -- 0:02:39
      254000 -- (-3900.938) (-3901.411) [-3895.892] (-3899.293) * (-3902.315) [-3899.274] (-3899.584) (-3895.199) -- 0:02:38
      254500 -- (-3898.557) (-3907.087) (-3900.300) [-3904.859] * (-3904.705) (-3901.850) [-3902.298] (-3904.998) -- 0:02:38
      255000 -- (-3899.236) (-3898.891) (-3898.349) [-3897.646] * (-3901.978) (-3899.911) [-3898.299] (-3895.979) -- 0:02:37

      Average standard deviation of split frequencies: 0.011969

      255500 -- (-3900.023) [-3900.505] (-3897.163) (-3898.254) * (-3898.983) (-3900.102) (-3900.999) [-3902.341] -- 0:02:37
      256000 -- (-3898.689) [-3897.801] (-3894.593) (-3896.888) * (-3904.954) [-3895.810] (-3899.601) (-3906.903) -- 0:02:36
      256500 -- (-3898.678) [-3902.742] (-3896.023) (-3897.447) * (-3900.339) [-3897.519] (-3903.623) (-3908.950) -- 0:02:39
      257000 -- (-3902.928) [-3897.724] (-3901.534) (-3898.659) * (-3903.736) (-3907.145) (-3904.216) [-3901.122] -- 0:02:39
      257500 -- (-3909.202) (-3898.856) [-3897.230] (-3899.496) * (-3904.830) [-3897.829] (-3901.477) (-3898.969) -- 0:02:38
      258000 -- (-3906.080) (-3897.655) [-3898.230] (-3913.697) * (-3906.678) (-3901.938) (-3911.670) [-3902.213] -- 0:02:38
      258500 -- (-3904.024) [-3906.386] (-3898.920) (-3896.413) * (-3913.512) (-3899.404) [-3905.774] (-3896.059) -- 0:02:37
      259000 -- (-3900.477) (-3914.224) [-3900.805] (-3905.911) * (-3896.752) [-3894.708] (-3900.565) (-3901.757) -- 0:02:37
      259500 -- (-3897.927) [-3901.566] (-3903.065) (-3901.535) * (-3895.233) (-3899.033) [-3894.108] (-3901.496) -- 0:02:36
      260000 -- (-3906.102) (-3906.695) (-3903.514) [-3905.645] * (-3905.024) (-3900.210) [-3903.464] (-3895.612) -- 0:02:36

      Average standard deviation of split frequencies: 0.010851

      260500 -- (-3900.789) (-3904.514) (-3899.346) [-3906.584] * (-3901.675) [-3896.172] (-3901.138) (-3903.047) -- 0:02:36
      261000 -- (-3900.636) [-3905.136] (-3910.926) (-3900.654) * (-3905.234) (-3906.206) (-3900.356) [-3898.394] -- 0:02:38
      261500 -- (-3902.449) (-3906.104) (-3907.998) [-3906.469] * (-3900.423) (-3902.176) [-3900.366] (-3898.013) -- 0:02:38
      262000 -- (-3907.248) (-3905.025) (-3907.320) [-3901.473] * (-3899.798) (-3901.247) (-3899.537) [-3902.775] -- 0:02:37
      262500 -- (-3901.609) (-3911.780) (-3904.553) [-3901.726] * [-3897.712] (-3901.586) (-3898.663) (-3901.958) -- 0:02:37
      263000 -- [-3903.182] (-3900.827) (-3900.085) (-3902.728) * [-3901.841] (-3907.225) (-3896.878) (-3901.294) -- 0:02:36
      263500 -- [-3900.295] (-3902.966) (-3898.914) (-3903.106) * [-3896.457] (-3906.170) (-3906.195) (-3898.302) -- 0:02:36
      264000 -- [-3896.645] (-3897.823) (-3895.675) (-3899.242) * (-3897.946) (-3911.121) (-3905.563) [-3907.203] -- 0:02:36
      264500 -- (-3899.271) (-3898.032) (-3894.640) [-3899.023] * (-3902.316) [-3902.401] (-3902.720) (-3907.327) -- 0:02:35
      265000 -- (-3904.002) (-3898.733) [-3896.093] (-3899.861) * (-3898.417) (-3903.310) (-3899.457) [-3903.048] -- 0:02:35

      Average standard deviation of split frequencies: 0.012405

      265500 -- [-3898.336] (-3900.567) (-3900.583) (-3904.894) * (-3904.533) [-3897.558] (-3895.884) (-3896.702) -- 0:02:37
      266000 -- (-3897.164) (-3900.309) [-3901.344] (-3905.239) * [-3893.291] (-3900.186) (-3898.798) (-3900.681) -- 0:02:37
      266500 -- (-3898.612) (-3909.599) [-3899.420] (-3908.356) * [-3907.902] (-3907.541) (-3905.828) (-3901.322) -- 0:02:36
      267000 -- [-3900.451] (-3905.330) (-3899.163) (-3900.358) * (-3903.156) (-3906.099) (-3900.247) [-3902.334] -- 0:02:36
      267500 -- [-3899.575] (-3912.533) (-3903.078) (-3903.872) * (-3904.842) (-3902.703) [-3900.966] (-3897.389) -- 0:02:36
      268000 -- [-3905.529] (-3912.200) (-3905.017) (-3902.792) * [-3900.878] (-3901.093) (-3901.236) (-3894.106) -- 0:02:35
      268500 -- (-3907.641) [-3898.608] (-3898.080) (-3902.924) * (-3902.325) [-3903.275] (-3898.720) (-3904.006) -- 0:02:35
      269000 -- (-3904.152) [-3897.895] (-3902.212) (-3906.270) * (-3907.060) (-3904.576) (-3900.914) [-3901.022] -- 0:02:34
      269500 -- (-3898.237) (-3901.565) [-3900.734] (-3895.069) * (-3906.044) (-3907.357) [-3905.190] (-3907.717) -- 0:02:34
      270000 -- (-3899.283) (-3899.515) (-3901.174) [-3899.458] * (-3903.151) (-3899.945) (-3903.300) [-3902.463] -- 0:02:34

      Average standard deviation of split frequencies: 0.013062

      270500 -- (-3895.404) (-3902.805) (-3898.093) [-3897.243] * (-3905.309) (-3906.588) (-3903.643) [-3900.432] -- 0:02:36
      271000 -- (-3900.451) (-3900.742) [-3895.328] (-3898.580) * (-3905.461) (-3898.917) [-3903.840] (-3904.079) -- 0:02:36
      271500 -- (-3899.238) [-3898.094] (-3898.229) (-3901.907) * (-3897.862) [-3902.249] (-3904.907) (-3902.730) -- 0:02:35
      272000 -- [-3900.857] (-3907.057) (-3900.676) (-3894.924) * (-3899.743) (-3903.770) (-3898.946) [-3906.228] -- 0:02:35
      272500 -- (-3900.101) (-3902.700) (-3895.187) [-3901.646] * (-3905.263) (-3907.968) (-3898.801) [-3899.173] -- 0:02:34
      273000 -- (-3904.209) (-3900.384) [-3898.297] (-3899.027) * (-3903.634) (-3902.947) [-3903.254] (-3902.607) -- 0:02:34
      273500 -- (-3897.648) (-3903.878) (-3903.432) [-3899.103] * (-3895.830) (-3910.763) (-3909.148) [-3898.471] -- 0:02:34
      274000 -- (-3901.475) (-3903.832) [-3903.526] (-3904.278) * [-3903.361] (-3898.882) (-3896.857) (-3899.093) -- 0:02:33
      274500 -- (-3896.775) (-3904.310) [-3900.782] (-3910.014) * (-3893.452) (-3907.607) [-3899.935] (-3905.086) -- 0:02:33
      275000 -- (-3901.415) (-3900.851) [-3896.841] (-3907.077) * (-3905.032) (-3905.829) (-3898.201) [-3899.812] -- 0:02:32

      Average standard deviation of split frequencies: 0.012810

      275500 -- [-3897.688] (-3903.073) (-3906.256) (-3899.056) * [-3904.664] (-3895.739) (-3900.848) (-3899.281) -- 0:02:35
      276000 -- (-3902.642) [-3906.076] (-3900.949) (-3900.638) * (-3911.892) (-3901.613) [-3898.771] (-3899.065) -- 0:02:34
      276500 -- (-3896.983) (-3902.896) [-3901.355] (-3894.749) * (-3900.322) (-3898.108) [-3901.868] (-3906.264) -- 0:02:34
      277000 -- [-3904.232] (-3897.546) (-3909.433) (-3897.092) * (-3906.235) [-3900.318] (-3901.868) (-3902.075) -- 0:02:33
      277500 -- [-3895.104] (-3902.553) (-3909.468) (-3901.837) * (-3907.475) (-3895.158) (-3899.360) [-3898.804] -- 0:02:33
      278000 -- (-3899.012) [-3897.108] (-3910.283) (-3897.652) * [-3901.511] (-3899.567) (-3896.269) (-3902.146) -- 0:02:33
      278500 -- (-3904.931) (-3897.932) (-3905.472) [-3898.417] * [-3900.411] (-3898.918) (-3901.218) (-3900.267) -- 0:02:32
      279000 -- [-3900.043] (-3897.258) (-3910.452) (-3907.536) * (-3902.070) (-3900.316) (-3897.465) [-3896.338] -- 0:02:32
      279500 -- [-3894.181] (-3899.894) (-3903.563) (-3903.790) * [-3902.843] (-3901.848) (-3902.774) (-3898.434) -- 0:02:32
      280000 -- (-3901.552) (-3904.349) [-3904.348] (-3896.721) * (-3902.292) (-3898.324) (-3896.533) [-3897.103] -- 0:02:34

      Average standard deviation of split frequencies: 0.012597

      280500 -- [-3894.385] (-3900.339) (-3908.554) (-3904.565) * (-3901.344) (-3905.431) (-3901.526) [-3902.671] -- 0:02:33
      281000 -- (-3898.941) (-3906.164) [-3903.295] (-3906.250) * [-3895.509] (-3902.867) (-3903.609) (-3896.864) -- 0:02:33
      281500 -- (-3903.332) (-3904.515) [-3902.575] (-3897.272) * (-3905.770) (-3895.937) [-3899.741] (-3898.625) -- 0:02:33
      282000 -- (-3896.161) (-3902.381) (-3908.245) [-3896.533] * (-3897.100) (-3900.987) [-3896.671] (-3907.656) -- 0:02:32
      282500 -- (-3903.719) [-3902.856] (-3904.481) (-3895.868) * (-3902.430) (-3899.309) [-3900.975] (-3906.939) -- 0:02:32
      283000 -- (-3901.764) [-3901.452] (-3898.079) (-3901.301) * (-3903.037) (-3904.052) (-3901.598) [-3897.040] -- 0:02:32
      283500 -- (-3900.820) [-3900.674] (-3895.836) (-3901.592) * (-3905.647) (-3896.531) [-3899.898] (-3902.603) -- 0:02:31
      284000 -- [-3903.585] (-3897.469) (-3899.102) (-3904.569) * [-3905.509] (-3900.195) (-3901.461) (-3904.537) -- 0:02:31
      284500 -- [-3900.068] (-3901.172) (-3898.311) (-3898.787) * (-3905.847) (-3900.205) (-3899.301) [-3900.457] -- 0:02:30
      285000 -- [-3898.205] (-3900.261) (-3909.695) (-3908.801) * (-3900.755) [-3897.452] (-3902.273) (-3909.561) -- 0:02:33

      Average standard deviation of split frequencies: 0.013186

      285500 -- [-3901.557] (-3898.263) (-3907.350) (-3900.426) * (-3903.809) [-3900.557] (-3896.979) (-3897.560) -- 0:02:32
      286000 -- (-3898.861) [-3902.606] (-3906.175) (-3904.236) * (-3904.896) [-3898.371] (-3893.594) (-3899.243) -- 0:02:32
      286500 -- (-3895.237) (-3901.807) (-3901.808) [-3900.097] * (-3905.781) (-3904.293) [-3894.337] (-3902.499) -- 0:02:31
      287000 -- (-3899.942) (-3894.884) [-3895.987] (-3899.865) * [-3899.164] (-3897.982) (-3901.286) (-3905.353) -- 0:02:31
      287500 -- (-3895.943) (-3898.897) [-3901.653] (-3901.278) * (-3899.742) [-3900.847] (-3903.692) (-3905.762) -- 0:02:31
      288000 -- [-3909.883] (-3899.365) (-3907.706) (-3904.234) * (-3894.579) (-3908.130) (-3906.889) [-3901.223] -- 0:02:30
      288500 -- (-3899.272) [-3894.749] (-3898.017) (-3907.346) * [-3892.534] (-3901.469) (-3896.214) (-3898.918) -- 0:02:30
      289000 -- (-3906.107) (-3904.584) (-3901.901) [-3896.263] * (-3897.518) (-3901.970) (-3905.722) [-3895.539] -- 0:02:30
      289500 -- [-3903.000] (-3898.341) (-3904.439) (-3902.661) * (-3901.005) (-3909.419) [-3902.076] (-3901.375) -- 0:02:32
      290000 -- [-3898.545] (-3900.554) (-3898.943) (-3909.443) * (-3897.524) (-3901.854) (-3906.058) [-3897.846] -- 0:02:31

      Average standard deviation of split frequencies: 0.010542

      290500 -- (-3910.702) [-3899.030] (-3905.815) (-3897.240) * (-3905.049) [-3895.471] (-3906.299) (-3906.639) -- 0:02:31
      291000 -- [-3894.794] (-3898.794) (-3901.902) (-3899.662) * (-3905.141) [-3897.902] (-3903.222) (-3900.891) -- 0:02:31
      291500 -- (-3902.054) [-3894.845] (-3901.261) (-3906.385) * (-3897.700) [-3900.786] (-3897.083) (-3901.372) -- 0:02:30
      292000 -- (-3902.450) (-3897.970) (-3900.811) [-3899.135] * (-3903.946) [-3901.513] (-3898.036) (-3900.799) -- 0:02:30
      292500 -- [-3898.861] (-3900.631) (-3895.113) (-3899.752) * (-3897.044) (-3898.946) [-3898.923] (-3900.151) -- 0:02:29
      293000 -- (-3907.363) [-3899.665] (-3915.029) (-3902.823) * (-3898.488) [-3900.031] (-3906.746) (-3899.914) -- 0:02:29
      293500 -- [-3897.103] (-3897.372) (-3906.254) (-3904.603) * [-3899.547] (-3905.987) (-3899.984) (-3901.496) -- 0:02:29
      294000 -- [-3898.596] (-3903.189) (-3898.602) (-3905.955) * (-3908.198) [-3896.784] (-3904.307) (-3897.543) -- 0:02:31
      294500 -- (-3901.298) (-3902.428) (-3900.920) [-3899.485] * (-3894.701) (-3904.886) (-3903.665) [-3900.707] -- 0:02:30
      295000 -- (-3897.668) (-3899.966) [-3900.753] (-3901.159) * (-3900.599) (-3903.725) [-3899.362] (-3900.441) -- 0:02:30

      Average standard deviation of split frequencies: 0.011944

      295500 -- (-3897.914) (-3901.690) (-3904.945) [-3902.132] * [-3898.709] (-3899.212) (-3900.653) (-3902.041) -- 0:02:30
      296000 -- (-3899.432) [-3901.007] (-3899.584) (-3900.594) * (-3900.974) [-3898.648] (-3896.006) (-3896.779) -- 0:02:29
      296500 -- (-3897.397) (-3907.577) (-3899.628) [-3899.364] * [-3894.897] (-3896.948) (-3898.047) (-3898.864) -- 0:02:29
      297000 -- (-3900.743) [-3901.561] (-3906.953) (-3897.826) * (-3897.729) [-3898.276] (-3900.732) (-3900.694) -- 0:02:29
      297500 -- (-3903.128) [-3899.380] (-3897.220) (-3898.456) * (-3898.082) (-3901.787) (-3899.283) [-3899.664] -- 0:02:28
      298000 -- (-3903.598) (-3901.916) (-3907.433) [-3893.519] * [-3900.724] (-3902.039) (-3900.146) (-3898.520) -- 0:02:30
      298500 -- (-3895.538) [-3899.528] (-3903.582) (-3902.264) * (-3904.248) [-3896.142] (-3903.979) (-3904.130) -- 0:02:30
      299000 -- (-3901.307) [-3897.006] (-3907.188) (-3899.303) * (-3906.803) (-3898.717) [-3897.604] (-3899.110) -- 0:02:30
      299500 -- (-3898.184) (-3894.372) (-3897.476) [-3900.772] * (-3896.957) (-3897.733) (-3895.412) [-3898.756] -- 0:02:29
      300000 -- (-3902.703) (-3897.386) (-3906.487) [-3900.016] * (-3906.753) (-3901.587) [-3896.803] (-3901.832) -- 0:02:29

      Average standard deviation of split frequencies: 0.014111

      300500 -- (-3898.643) (-3899.590) [-3901.177] (-3896.198) * (-3908.214) [-3895.096] (-3902.829) (-3904.244) -- 0:02:28
      301000 -- (-3896.047) (-3900.649) (-3908.933) [-3901.871] * [-3906.857] (-3896.868) (-3907.658) (-3895.666) -- 0:02:28
      301500 -- [-3903.879] (-3899.147) (-3905.606) (-3908.915) * [-3895.927] (-3897.308) (-3905.172) (-3898.388) -- 0:02:28
      302000 -- [-3898.708] (-3901.062) (-3901.261) (-3906.933) * (-3903.181) [-3897.789] (-3898.412) (-3901.261) -- 0:02:27
      302500 -- (-3902.133) (-3896.369) [-3902.629] (-3909.067) * [-3903.142] (-3897.964) (-3900.193) (-3897.680) -- 0:02:29
      303000 -- (-3899.751) [-3899.036] (-3900.711) (-3904.671) * (-3901.025) (-3899.928) [-3898.809] (-3896.012) -- 0:02:29
      303500 -- [-3899.692] (-3899.720) (-3904.106) (-3903.270) * (-3899.250) (-3906.948) [-3895.401] (-3895.101) -- 0:02:29
      304000 -- (-3898.567) [-3903.232] (-3903.618) (-3904.960) * (-3900.394) (-3901.812) (-3899.279) [-3904.186] -- 0:02:28
      304500 -- [-3900.172] (-3905.255) (-3899.345) (-3910.885) * (-3902.196) (-3900.113) (-3901.093) [-3898.283] -- 0:02:28
      305000 -- (-3902.694) (-3899.218) (-3896.979) [-3896.484] * (-3903.133) (-3902.568) [-3900.328] (-3898.179) -- 0:02:28

      Average standard deviation of split frequencies: 0.014635

      305500 -- [-3895.824] (-3897.910) (-3898.460) (-3897.289) * (-3901.410) [-3901.010] (-3904.138) (-3897.914) -- 0:02:27
      306000 -- (-3898.306) (-3906.109) (-3900.648) [-3905.151] * [-3903.903] (-3905.241) (-3898.177) (-3905.558) -- 0:02:27
      306500 -- (-3903.551) (-3906.821) [-3897.407] (-3899.625) * (-3897.042) (-3900.694) (-3902.699) [-3900.671] -- 0:02:27
      307000 -- [-3902.870] (-3907.064) (-3900.207) (-3896.851) * (-3901.089) [-3898.874] (-3908.131) (-3903.013) -- 0:02:26
      307500 -- (-3898.437) (-3913.148) (-3905.657) [-3893.707] * (-3900.138) [-3896.417] (-3896.146) (-3898.460) -- 0:02:28
      308000 -- [-3898.146] (-3912.138) (-3896.551) (-3904.208) * (-3898.231) (-3901.305) [-3906.380] (-3895.652) -- 0:02:28
      308500 -- (-3904.576) (-3905.609) (-3906.792) [-3900.737] * (-3901.701) (-3894.864) [-3897.887] (-3896.937) -- 0:02:27
      309000 -- [-3905.033] (-3910.040) (-3900.540) (-3902.164) * (-3901.967) (-3899.821) [-3897.150] (-3902.010) -- 0:02:27
      309500 -- (-3902.524) [-3907.903] (-3897.788) (-3900.942) * (-3899.295) (-3897.565) (-3910.659) [-3897.308] -- 0:02:27
      310000 -- (-3898.852) (-3903.801) (-3901.300) [-3904.318] * (-3902.250) (-3899.417) (-3899.825) [-3897.046] -- 0:02:26

      Average standard deviation of split frequencies: 0.015933

      310500 -- (-3900.418) (-3900.778) (-3895.991) [-3900.407] * [-3898.479] (-3899.092) (-3901.186) (-3894.634) -- 0:02:26
      311000 -- (-3902.455) [-3902.847] (-3898.974) (-3904.123) * (-3901.828) [-3896.690] (-3891.991) (-3906.475) -- 0:02:26
      311500 -- (-3898.141) [-3895.418] (-3894.755) (-3904.401) * (-3904.436) (-3902.762) [-3897.888] (-3902.750) -- 0:02:25
      312000 -- (-3899.783) [-3904.373] (-3903.258) (-3904.278) * [-3899.595] (-3902.543) (-3900.563) (-3898.496) -- 0:02:27
      312500 -- (-3897.634) (-3903.862) [-3897.147] (-3908.531) * (-3899.885) [-3902.869] (-3901.404) (-3901.108) -- 0:02:27
      313000 -- (-3897.182) (-3900.657) [-3902.151] (-3901.237) * (-3905.477) [-3899.856] (-3898.755) (-3900.926) -- 0:02:27
      313500 -- (-3897.856) [-3900.889] (-3899.514) (-3895.317) * (-3901.453) (-3903.405) (-3897.703) [-3899.290] -- 0:02:26
      314000 -- [-3899.063] (-3906.665) (-3902.689) (-3899.651) * (-3897.302) (-3904.062) (-3903.458) [-3901.176] -- 0:02:26
      314500 -- [-3896.407] (-3914.115) (-3898.499) (-3898.692) * (-3897.475) (-3902.032) (-3901.695) [-3895.504] -- 0:02:26
      315000 -- [-3897.144] (-3908.458) (-3895.168) (-3898.839) * (-3898.830) [-3897.759] (-3902.457) (-3908.371) -- 0:02:25

      Average standard deviation of split frequencies: 0.014172

      315500 -- [-3893.854] (-3895.728) (-3894.034) (-3900.377) * [-3897.801] (-3901.615) (-3902.116) (-3901.407) -- 0:02:25
      316000 -- (-3898.488) (-3898.906) (-3897.841) [-3895.101] * (-3905.243) [-3906.395] (-3901.948) (-3898.540) -- 0:02:25
      316500 -- (-3903.405) [-3895.496] (-3897.835) (-3905.405) * (-3908.579) [-3896.545] (-3910.529) (-3897.066) -- 0:02:24
      317000 -- (-3899.248) [-3896.381] (-3907.636) (-3907.177) * (-3904.588) (-3897.140) [-3903.764] (-3901.043) -- 0:02:26
      317500 -- [-3903.955] (-3900.435) (-3904.941) (-3915.063) * (-3901.967) (-3900.438) [-3906.655] (-3903.355) -- 0:02:26
      318000 -- (-3901.003) [-3899.455] (-3902.848) (-3904.736) * [-3902.597] (-3897.207) (-3906.571) (-3900.921) -- 0:02:25
      318500 -- (-3900.055) (-3902.114) [-3892.609] (-3897.593) * (-3900.756) [-3901.025] (-3902.344) (-3904.809) -- 0:02:25
      319000 -- (-3903.785) [-3902.559] (-3902.752) (-3908.650) * (-3908.449) [-3895.418] (-3901.695) (-3905.131) -- 0:02:25
      319500 -- (-3900.458) [-3897.022] (-3907.096) (-3902.998) * [-3897.810] (-3893.495) (-3902.216) (-3899.699) -- 0:02:24
      320000 -- (-3896.217) (-3898.603) (-3905.666) [-3903.786] * [-3896.729] (-3899.758) (-3904.407) (-3898.036) -- 0:02:24

      Average standard deviation of split frequencies: 0.013966

      320500 -- (-3899.311) [-3898.792] (-3896.028) (-3905.744) * (-3895.041) (-3904.989) [-3899.666] (-3897.696) -- 0:02:24
      321000 -- (-3897.443) [-3895.245] (-3899.748) (-3900.627) * [-3901.241] (-3902.801) (-3898.457) (-3899.248) -- 0:02:23
      321500 -- (-3898.502) (-3899.342) (-3898.054) [-3903.353] * (-3899.803) (-3899.914) [-3898.341] (-3902.153) -- 0:02:25
      322000 -- (-3898.980) (-3899.054) (-3897.977) [-3895.287] * (-3899.541) (-3896.657) [-3910.006] (-3901.759) -- 0:02:25
      322500 -- (-3897.393) (-3900.525) [-3899.014] (-3898.734) * (-3895.070) (-3897.847) [-3904.906] (-3910.936) -- 0:02:24
      323000 -- (-3899.188) (-3901.253) [-3899.305] (-3896.193) * (-3905.031) (-3900.714) [-3898.523] (-3897.467) -- 0:02:24
      323500 -- (-3902.262) (-3898.417) [-3902.615] (-3898.088) * (-3902.429) (-3898.538) [-3902.210] (-3899.894) -- 0:02:24
      324000 -- (-3897.888) (-3898.815) (-3898.930) [-3904.212] * (-3903.165) (-3896.026) (-3898.663) [-3899.843] -- 0:02:23
      324500 -- (-3899.790) [-3896.302] (-3896.790) (-3902.627) * (-3897.887) (-3901.191) [-3900.133] (-3902.761) -- 0:02:23
      325000 -- (-3902.649) [-3899.411] (-3903.130) (-3897.884) * (-3897.365) (-3904.240) [-3903.809] (-3901.379) -- 0:02:23

      Average standard deviation of split frequencies: 0.012291

      325500 -- [-3897.249] (-3904.916) (-3906.719) (-3896.755) * (-3900.444) (-3904.503) [-3905.269] (-3906.525) -- 0:02:22
      326000 -- (-3900.114) (-3897.868) (-3903.733) [-3897.493] * (-3895.964) (-3903.406) [-3904.329] (-3904.495) -- 0:02:22
      326500 -- [-3894.594] (-3900.804) (-3904.839) (-3901.825) * (-3901.445) (-3898.025) [-3900.154] (-3910.025) -- 0:02:24
      327000 -- (-3899.469) [-3901.781] (-3903.276) (-3896.834) * (-3900.319) (-3898.621) (-3899.956) [-3897.474] -- 0:02:24
      327500 -- (-3898.644) (-3893.456) (-3901.318) [-3898.157] * (-3904.673) (-3897.873) [-3899.185] (-3899.481) -- 0:02:23
      328000 -- [-3899.559] (-3900.073) (-3907.783) (-3901.568) * (-3902.100) (-3896.936) (-3901.768) [-3900.517] -- 0:02:23
      328500 -- (-3902.745) (-3908.433) [-3899.792] (-3907.435) * [-3910.853] (-3901.327) (-3901.015) (-3902.236) -- 0:02:23
      329000 -- (-3902.379) (-3894.625) [-3905.252] (-3898.860) * (-3907.973) (-3901.328) [-3898.292] (-3900.716) -- 0:02:22
      329500 -- (-3895.693) (-3898.898) (-3901.942) [-3898.873] * [-3901.804] (-3904.018) (-3898.157) (-3905.992) -- 0:02:22
      330000 -- (-3898.943) (-3900.102) (-3895.762) [-3901.691] * (-3898.794) (-3905.251) [-3904.156] (-3895.092) -- 0:02:22

      Average standard deviation of split frequencies: 0.009267

      330500 -- [-3900.892] (-3899.572) (-3895.671) (-3901.147) * [-3898.499] (-3907.443) (-3901.023) (-3902.777) -- 0:02:21
      331000 -- [-3901.544] (-3904.295) (-3899.881) (-3903.681) * [-3903.335] (-3910.235) (-3898.233) (-3902.009) -- 0:02:21
      331500 -- (-3901.452) (-3909.036) (-3902.549) [-3899.373] * (-3900.058) (-3902.847) [-3901.167] (-3902.914) -- 0:02:23
      332000 -- (-3894.569) [-3900.851] (-3901.357) (-3898.183) * (-3896.883) (-3898.441) (-3903.201) [-3896.585] -- 0:02:22
      332500 -- [-3897.443] (-3904.704) (-3897.100) (-3898.237) * (-3903.141) (-3899.994) (-3904.536) [-3897.903] -- 0:02:22
      333000 -- (-3900.028) (-3899.651) (-3903.120) [-3901.514] * (-3901.513) (-3904.570) (-3896.380) [-3898.488] -- 0:02:22
      333500 -- (-3901.338) [-3901.363] (-3903.821) (-3904.250) * (-3899.748) (-3898.528) [-3894.638] (-3903.919) -- 0:02:21
      334000 -- (-3904.632) [-3898.776] (-3908.117) (-3900.275) * (-3901.729) (-3899.291) (-3892.771) [-3904.144] -- 0:02:21
      334500 -- (-3905.397) (-3900.456) (-3908.357) [-3902.976] * (-3903.239) (-3897.307) [-3906.104] (-3907.131) -- 0:02:21
      335000 -- (-3911.947) (-3906.940) [-3902.874] (-3906.789) * (-3905.569) (-3893.582) (-3897.026) [-3898.945] -- 0:02:20

      Average standard deviation of split frequencies: 0.008418

      335500 -- (-3901.173) [-3904.655] (-3906.821) (-3904.288) * (-3897.704) [-3900.114] (-3897.070) (-3895.673) -- 0:02:20
      336000 -- (-3902.881) (-3901.994) (-3902.443) [-3901.954] * (-3902.864) (-3904.043) (-3900.707) [-3896.515] -- 0:02:22
      336500 -- (-3902.190) [-3900.182] (-3898.421) (-3904.196) * [-3898.004] (-3899.107) (-3902.091) (-3897.802) -- 0:02:21
      337000 -- [-3894.881] (-3896.658) (-3897.729) (-3905.358) * (-3901.502) (-3897.199) (-3898.018) [-3898.663] -- 0:02:21
      337500 -- (-3906.239) (-3900.343) [-3896.078] (-3904.180) * (-3902.619) [-3898.075] (-3902.652) (-3897.366) -- 0:02:21
      338000 -- (-3898.618) [-3900.826] (-3895.601) (-3903.155) * (-3899.910) (-3903.199) [-3894.243] (-3902.076) -- 0:02:21
      338500 -- (-3897.732) (-3904.638) [-3899.324] (-3907.375) * (-3903.874) (-3895.866) [-3899.144] (-3903.759) -- 0:02:20
      339000 -- (-3900.241) (-3904.191) [-3898.345] (-3906.159) * (-3894.868) (-3896.465) [-3901.408] (-3903.626) -- 0:02:20
      339500 -- (-3901.848) (-3900.182) [-3899.329] (-3898.443) * [-3907.452] (-3899.846) (-3902.230) (-3914.299) -- 0:02:20
      340000 -- (-3900.915) [-3899.284] (-3904.880) (-3899.182) * (-3910.037) [-3897.321] (-3901.805) (-3908.266) -- 0:02:19

      Average standard deviation of split frequencies: 0.008303

      340500 -- (-3906.697) [-3897.687] (-3898.270) (-3896.124) * (-3899.681) (-3901.602) (-3903.102) [-3899.388] -- 0:02:19
      341000 -- (-3903.715) (-3898.909) (-3900.242) [-3903.211] * (-3895.379) (-3896.994) (-3895.745) [-3901.859] -- 0:02:21
      341500 -- (-3897.549) (-3898.660) [-3900.393] (-3900.196) * [-3895.896] (-3901.853) (-3898.723) (-3901.711) -- 0:02:20
      342000 -- (-3898.147) [-3901.196] (-3894.934) (-3902.431) * [-3900.357] (-3901.951) (-3901.014) (-3898.963) -- 0:02:20
      342500 -- (-3905.075) (-3900.402) (-3895.298) [-3896.270] * (-3895.409) (-3907.189) (-3906.520) [-3899.459] -- 0:02:20
      343000 -- (-3903.265) (-3900.825) [-3900.067] (-3903.417) * (-3909.609) (-3899.159) (-3900.409) [-3900.165] -- 0:02:19
      343500 -- (-3905.340) (-3903.351) [-3911.235] (-3898.198) * (-3901.661) [-3901.347] (-3905.166) (-3905.649) -- 0:02:19
      344000 -- (-3901.483) (-3901.938) (-3901.263) [-3895.968] * (-3904.936) (-3904.683) [-3903.306] (-3900.381) -- 0:02:19
      344500 -- [-3897.510] (-3900.986) (-3898.542) (-3899.535) * (-3898.745) [-3903.836] (-3895.789) (-3895.298) -- 0:02:18
      345000 -- [-3898.366] (-3908.699) (-3901.574) (-3904.654) * (-3895.241) [-3904.546] (-3893.453) (-3898.219) -- 0:02:18

      Average standard deviation of split frequencies: 0.008175

      345500 -- (-3903.608) (-3904.322) (-3901.536) [-3896.545] * (-3895.835) (-3901.015) [-3898.093] (-3897.953) -- 0:02:20
      346000 -- (-3897.458) (-3901.716) [-3901.582] (-3909.965) * (-3902.564) (-3895.740) (-3897.418) [-3897.942] -- 0:02:19
      346500 -- [-3895.609] (-3910.239) (-3896.542) (-3905.214) * (-3896.299) [-3895.605] (-3902.918) (-3906.210) -- 0:02:19
      347000 -- (-3904.495) (-3895.476) [-3902.428] (-3905.028) * (-3905.685) (-3903.722) [-3901.472] (-3898.006) -- 0:02:19
      347500 -- (-3900.514) (-3903.611) (-3896.215) [-3895.914] * (-3896.166) (-3900.043) (-3901.027) [-3893.750] -- 0:02:18
      348000 -- (-3903.042) (-3902.063) [-3894.207] (-3897.463) * [-3895.220] (-3896.156) (-3897.881) (-3900.592) -- 0:02:18
      348500 -- (-3908.966) (-3906.098) [-3906.980] (-3895.973) * [-3897.179] (-3896.855) (-3900.785) (-3896.863) -- 0:02:18
      349000 -- [-3898.979] (-3902.175) (-3895.628) (-3910.471) * [-3899.480] (-3902.032) (-3902.390) (-3899.901) -- 0:02:18
      349500 -- (-3900.499) (-3902.920) [-3894.161] (-3903.901) * [-3898.736] (-3902.913) (-3898.548) (-3898.760) -- 0:02:17
      350000 -- (-3895.479) (-3904.794) (-3900.551) [-3896.881] * [-3899.502] (-3897.195) (-3902.710) (-3903.640) -- 0:02:19

      Average standard deviation of split frequencies: 0.008066

      350500 -- [-3900.300] (-3900.539) (-3898.738) (-3899.140) * (-3902.232) (-3900.442) (-3893.357) [-3900.171] -- 0:02:18
      351000 -- (-3898.555) (-3900.000) [-3896.055] (-3896.954) * [-3902.523] (-3896.428) (-3897.515) (-3900.005) -- 0:02:18
      351500 -- (-3900.052) (-3899.672) [-3901.592] (-3896.475) * [-3893.820] (-3899.433) (-3905.590) (-3905.392) -- 0:02:18
      352000 -- (-3897.728) (-3905.353) [-3897.086] (-3898.023) * (-3895.733) (-3899.69