--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 21:43:15 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/340/para-PG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/340/para-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/340/para-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1     -12285.68        -12300.58
2     -12285.69        -12299.69
--------------------------------------
TOTAL   -12285.69        -12300.23
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/340/para-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/340/para-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.217982    0.000235    0.189104    0.248361    0.217189   1380.27   1440.63    1.000
r(A<->C){all}   0.070411    0.000154    0.045874    0.093778    0.069961    896.80    897.09    1.001
r(A<->G){all}   0.245670    0.000588    0.200198    0.294262    0.245308   1096.27   1117.96    1.000
r(A<->T){all}   0.077310    0.000263    0.045250    0.108502    0.076161    975.68    995.06    1.002
r(C<->G){all}   0.082568    0.000146    0.058348    0.105639    0.082266   1014.68   1123.76    1.001
r(C<->T){all}   0.464039    0.000910    0.403580    0.521429    0.463885    894.84    978.30    1.001
r(G<->T){all}   0.060001    0.000150    0.036386    0.083394    0.059660   1044.36   1183.99    1.000
pi(A){all}      0.255696    0.000029    0.244682    0.265950    0.255777    871.27    943.57    1.001
pi(C){all}      0.241456    0.000027    0.231728    0.251608    0.241337   1114.41   1130.16    1.000
pi(G){all}      0.265703    0.000029    0.254939    0.276108    0.265673    972.82   1146.37    1.000
pi(T){all}      0.237144    0.000028    0.227020    0.247620    0.237140   1065.64   1161.20    1.000
alpha{1,2}      0.073806    0.000875    0.003451    0.113842    0.080688   1054.22   1186.58    1.001
alpha{3}        4.579715    1.273849    2.640027    6.909384    4.460328   1261.74   1315.14    1.000
pinvar{all}     0.781121    0.000198    0.753723    0.807093    0.781667   1160.24   1217.82    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-11586.38773
Model 2: PositiveSelection	-11577.853048
Model 0: one-ratio	-11694.756539
Model 3: discrete	-11577.807921
Model 7: beta	-11604.803584
Model 8: beta&w>1	-11578.04207


Model 0 vs 1	216.7376179999992

Model 2 vs 1	17.06936399999904

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PG)

            Pr(w>1)     post mean +- SE for w

  1962 E      0.811         3.279
  1973 H      0.979*        3.749
  1982 G      0.792         3.224
  1988 E      0.770         3.163
  1989 A      0.911         3.559
  1990 T      0.669         2.879
  1994 P      0.702         2.973
  1998 S      0.896         3.516
  2032 A      0.654         2.837
  2034 A      0.918         3.578

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PG)

            Pr(w>1)     post mean +- SE for w

   326 S      0.566         1.612 +- 0.842
   849 M      0.704         1.851 +- 0.783
  1962 E      0.840         2.038 +- 0.755
  1971 T      0.642         1.745 +- 0.847
  1973 H      0.924         2.129 +- 0.709
  1976 G      0.564         1.608 +- 0.842
  1982 G      0.812         2.008 +- 0.770
  1983 D      0.531         1.549 +- 0.841
  1985 A      0.607         1.685 +- 0.847
  1988 E      0.808         2.002 +- 0.771
  1989 A      0.875         2.081 +- 0.739
  1990 T      0.759         1.932 +- 0.804
  1991 D      0.655         1.767 +- 0.850
  1992 D      0.698         1.838 +- 0.812
  1994 P      0.776         1.957 +- 0.794
  1995 A      0.641         1.744 +- 0.849
  1996 G      0.654         1.765 +- 0.846
  1998 S      0.869         2.074 +- 0.742
  2004 E      0.593         1.660 +- 0.846
  2018 G      0.662         1.779 +- 0.844
  2030 A      0.630         1.724 +- 0.850
  2031 A      0.630         1.724 +- 0.850
  2032 A      0.775         1.957 +- 0.779
  2034 A      0.878         2.084 +- 0.737


Model 8 vs 7	53.52302799999961

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PG)

            Pr(w>1)     post mean +- SE for w

   112 V      0.594         1.558
   135 M      0.614         1.608
   324 R      0.580         1.523
   326 S      0.951*        2.441
   786 F      0.540         1.426
   849 M      0.997**       2.555
  1962 E      1.000**       2.563
  1965 G      0.760         1.968
  1971 T      0.973*        2.495
  1973 H      1.000**       2.563
  1976 G      0.950         2.438
  1977 G      0.501         1.330
  1982 G      0.999**       2.561
  1983 D      0.935         2.402
  1985 A      0.964*        2.473
  1986 P      0.559         1.472
  1987 D      0.772         2.000
  1988 E      0.999**       2.561
  1989 A      1.000**       2.563
  1990 T      0.994**       2.548
  1991 D      0.975*        2.500
  1992 D      0.989*        2.536
  1994 P      0.996**       2.553
  1995 A      0.972*        2.494
  1996 G      0.975*        2.502
  1998 S      1.000**       2.563
  1999 V      0.560         1.474
  2002 T      0.602         1.580
  2003 A      0.636         1.663
  2004 E      0.959*        2.463
  2018 G      0.977*        2.506
  2025 A      0.628         1.644
  2026 A      0.608         1.595
  2030 A      0.969*        2.486
  2031 A      0.969*        2.486
  2032 A      0.999**       2.560
  2034 A      1.000**       2.563

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PG)

            Pr(w>1)     post mean +- SE for w

   326 S      0.694         1.182 +- 0.534
   849 M      0.864         1.387 +- 0.357
  1962 E      0.947         1.470 +- 0.237
  1971 T      0.748         1.246 +- 0.498
  1973 H      0.984*        1.503 +- 0.163
  1976 G      0.691         1.179 +- 0.535
  1982 G      0.916         1.439 +- 0.293
  1983 D      0.662         1.144 +- 0.551
  1985 A      0.722         1.216 +- 0.516
  1988 E      0.915         1.438 +- 0.294
  1989 A      0.962*        1.484 +- 0.209
  1990 T      0.858         1.373 +- 0.386
  1991 D      0.751         1.249 +- 0.497
  1992 D      0.824         1.337 +- 0.421
  1994 P      0.876         1.394 +- 0.361
  1995 A      0.744         1.241 +- 0.501
  1996 G      0.756         1.255 +- 0.492
  1998 S      0.958*        1.480 +- 0.219
  2004 E      0.713         1.205 +- 0.522
  2018 G      0.763         1.263 +- 0.486
  2030 A      0.735         1.231 +- 0.508
  2031 A      0.735         1.231 +- 0.508
  2032 A      0.899         1.423 +- 0.315
  2034 A      0.963*        1.485 +- 0.207

>C1
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
ESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKH
HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
QHAWRKHKARGEGGGSFEPDTDHGDGGDPDAGDPAPDEATDGDAPAGGDG
SVNGTAEGAADADESNVNSPGEDAAAAAAAAAAAAAAGTTTAGSPGAGSA
GRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVooooooooooooo
oo
>C2
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
ESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKH
HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
ETYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
QHAWRKHKARGEGGGSFEPDTDQGDGGDPDAGDPAPDEQTDGDAPAGGDG
SVNGTAEGAADADESNVNSPGEDAAAASAAAAAAAAGTTTAGSPGAGSTG
RQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooooooooo
oo
>C3
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDFEIGLECTDEAGKIKH
HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
QHAWRKHKARGAGGGSFEPDTDGDGDGDCDPDAVDPAPDEQADGGEAPAG
GALDGSVNGTGNGTGTGEGAADADESNVNSPGEDAAAAAVAAAAAATTAG
SPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooo
oo
>C4
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKH
HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
QHAWRKHKARGEGGGGSFEPDTDQGDGGDPDAADPAPGDETADGEAPAGG
DGSVNGTGGNGEGAADADESNVNSPGEDAAAAAAAAAAGTTAGTTAGSPG
AGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVooooooooo
oo
>C5
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKH
HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
QHAWRKHKARGSGGDGGGSFEPDPEQGDHQGGGGNGGEPEAGAPAPGDAA
DGEAPTDGEANGNGTGDGAAGADESNVNSPIEDAVAAAAAAAVATAAGAV
TTTTTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTA
DV
>C6
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKH
HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKIQEWVSLIVFDPFVE
LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLCA
MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
QHAWRKHKARGEGGGSFEPDPDQGGGGDGGDPDAAEPQLDEPTDAEGPEG
DGSGVNGTGTGDGAADADENNVNSPGEDAAAAAAAAAGTTTGTAAGSPGA
GSAGRQTAVLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooooo
oo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=2127 

C1              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C2              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C3              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C4              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C5              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C6              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
                **************************************************

C1              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C2              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C3              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C4              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C5              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C6              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
                **************************************************

C1              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
C2              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C3              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C4              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C5              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C6              PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
                *******:***:**********************:***************

C1              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C2              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C3              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C4              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C5              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C6              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
                **************************************************

C1              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C2              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C3              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C4              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C5              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C6              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
                **************************************************

C1              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C2              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C3              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C4              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C5              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C6              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
                **************************************************

C1              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C2              CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
C3              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C4              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C5              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C6              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
                ******************* ***:*.************************

C1              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C2              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C3              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C4              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C5              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C6              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
                **************************************************

C1              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C2              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C3              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C4              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C5              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C6              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
                **************************************************

C1              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C2              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C3              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C4              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C5              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C6              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
                **************************************************

C1              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C2              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C3              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C4              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C5              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C6              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
                **************************************************

C1              KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
C2              KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
C3              KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
C4              KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
C5              KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
C6              KVSTYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE
                **************************************************

C1              ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
C2              ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
C3              ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
C4              ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
C5              ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
C6              ENGAIIVPVYYGNLGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTK
                **************************************************

C1              ESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKH
C2              ESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKH
C3              ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDFEIGLECTDEAGKIKH
C4              ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKH
C5              ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKH
C6              ESKLRNRNTRNQSVGATNGGTTCLDTNHKLEHRDYEIGLECTDEAGKIKH
                ******************************:***:***************

C1              HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
C2              HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
C3              HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
C4              HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
C5              HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
C6              HDNPFIEPVQTQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTE
                **************************************************

C1              DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
C2              DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
C3              DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
C4              DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
C5              DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVE
C6              DDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKIQEWVSLIVFDPFVE
                ***********************************:**************

C1              LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
C2              LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
C3              LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
C4              LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
C5              LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMA
C6              LFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLCA
                ************************************************ *

C1              MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
C2              MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
C3              MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
C4              MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
C5              MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
C6              MSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAK
                **************************************************

C1              SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
C2              SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
C3              SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
C4              SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
C5              SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
C6              SWPTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKD
                **************************************************

C1              RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
C2              RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
C3              RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
C4              RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
C5              RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
C6              RFPDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYVGDVSCIPFFL
                **************************************************

C1              ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
C2              ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
C3              ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
C4              ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
C5              ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
C6              ATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFK
                **************************************************

C1              SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
C2              SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
C3              SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
C4              SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
C5              SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
C6              SWVKRNIADCFKLIRNKLTNQISDQPSEHGDNELELGHDEILADGLIKKG
                **************************************************

C1              IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
C2              IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
C3              IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
C4              IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
C5              IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
C6              IKEQTQLEVAIGDGMEFTIHGDMKNNKPKKSKYLNNATDDDTASINSYGS
                **************************************************

C1              HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
C2              HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
C3              HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
C4              HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
C5              HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
C6              HKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG
                **************************************************

C1              DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
C2              DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
C3              DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
C4              DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
C5              DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
C6              DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKT
                **************************************************

C1              FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
C2              FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
C3              FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
C4              FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
C5              FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
C6              FQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYMDRIFTV
                **************************************************

C1              IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
C2              IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
C3              IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
C4              IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
C5              IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
C6              IFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQA
                **************************************************

C1              FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
C2              FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
C3              FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
C4              FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
C5              FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
C6              FKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIF
                **************************************************

C1              AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
C2              AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
C3              AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
C4              AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
C5              AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
C6              AIMGVQLFAGKYFKCEDMNGTKLSHEIIPNRNACESENYTWVNSAMNFDH
                **************************************************

C1              VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
C2              VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
C3              VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
C4              VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
C5              VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
C6              VGNAYLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFI
                **************************************************

C1              IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
C2              IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
C3              IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
C4              IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
C5              IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
C6              IFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGS
                **************************************************

C1              KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
C2              KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
C3              KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
C4              KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
C5              KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
C6              KKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDAS
                **************************************************

C1              DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
C2              ETYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
C3              DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
C4              DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
C5              DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
C6              DTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSI
                :*************************************************

C1              LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
C2              LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
C3              LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
C4              LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
C5              LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
C6              LGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMS
                **************************************************

C1              LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
C2              LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
C3              LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
C4              LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
C5              LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
C6              LPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMIL
                **************************************************

C1              LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
C2              LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
C3              LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
C4              LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
C5              LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
C6              LFQMSTSAGWDGVLDAIINEEACDPPDNDKGYPGNCGSATVGITFLLSYL
                **************************************************

C1              VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
C2              VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
C3              VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
C4              VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
C5              VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
C6              VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGT
                **************************************************

C1              QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
C2              QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
C3              QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
C4              QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
C5              QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
C6              QYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDA
                **************************************************

C1              LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
C2              LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
C3              LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
C4              LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
C5              LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
C6              LTKDFFARKGNPIEETGEIGEIAARPDTEGYEPVSSTLWRQREEYCARLI
                **************************************************

C1              QHAWRKHKARGEGGG---SFEPDTD------HGDG-GDPDAGDPAP-DEA
C2              QHAWRKHKARGEGGG---SFEPDTD------QGDG-GDPDAGDPAP-DEQ
C3              QHAWRKHKARGAGGG---SFEPDTDG-----DGDGDCDPDAVDPAPDEQA
C4              QHAWRKHKARGEGGGG--SFEPDTD------QGDG-GDPDAADPAPGDET
C5              QHAWRKHKARGSGGDGGGSFEPDPEQGDHQGGGGNGGEPEAGAPAPGDAA
C6              QHAWRKHKARGEGGG---SFEPDPDQGG---GGDG-GDPDAAEPQLDEPT
                *********** **.   *****.:       *..  :*:*  *   :  

C1              TDGDAPAGG--DGSVNGT------AEGAADADESNVNSPGEDAAAAAAAA
C2              TDGDAPAGG--DGSVNGT------AEGAADADESNVNSPGEDAAAASAAA
C3              DGGEAPAGGALDGSVNGTGNGTGTGEGAADADESNVNSPGEDAAAAAVAA
C4              ADGEAPAGG--DGSVNGTG---GNGEGAADADESNVNSPGEDAAAAAAAA
C5              DG-EAPTDG----EANGNG----TGDGAAGADESNVNSPIEDAVAAAAAA
C6              DAEGPEGDG---SGVNGTG----TGDGAADADENNVNSPGEDAAAAAAAA
                    .  .*     .**.      .:***.***.***** ***.**:.**

C1              AAA-----AAAGTTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSR
C2              AAA-----AAG-TTTAGSPGAGSTGRQTAVLVESDGFVTKNGHKVVIHSR
C3              AAA-----ATT----AGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSR
C4              AAG-----TTA-GTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSR
C5              AVATAAGAVTTTTTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSR
C6              AGT-----TTG--TAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSR
                *       .:     ********:**************************

C1              SPSITSRTADVooooooooooooooo-
C2              SPSITSRTADVoooooooooooooooo
C3              SPSITSRTADVoooooooo--------
C4              SPSITSRTADVooooooooooo-----
C5              SPSITSRTADV----------------
C6              SPSITSRTADVoooooooooooo----
                ***********                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67672]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67672]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67672]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67672]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67672]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [67672]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2102 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2102 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PG/batch/allfiles/