--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:09:54 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2442/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -759.19 -762.50
2 -759.18 -762.90
--------------------------------------
TOTAL -759.18 -762.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888916 0.088597 0.383660 1.482354 0.849143 1501.00 1501.00 1.000
r(A<->C){all} 0.160812 0.019352 0.000006 0.439526 0.120430 187.07 251.88 1.008
r(A<->G){all} 0.167835 0.019242 0.000123 0.434547 0.132935 201.92 257.20 1.002
r(A<->T){all} 0.169274 0.021026 0.000063 0.462778 0.128825 163.91 234.00 1.000
r(C<->G){all} 0.169281 0.020259 0.000004 0.454211 0.135458 218.26 233.51 1.000
r(C<->T){all} 0.165300 0.019922 0.000045 0.448931 0.125992 140.14 207.74 1.000
r(G<->T){all} 0.167498 0.020732 0.000038 0.469782 0.128217 263.95 275.80 1.001
pi(A){all} 0.195938 0.000271 0.163018 0.226805 0.195527 1028.40 1235.98 1.000
pi(C){all} 0.258675 0.000345 0.223653 0.296563 0.258300 1240.81 1370.91 1.000
pi(G){all} 0.311445 0.000372 0.275239 0.349333 0.310926 1125.33 1246.56 1.000
pi(T){all} 0.233942 0.000323 0.199273 0.268976 0.233481 1251.78 1266.73 1.000
alpha{1,2} 0.424121 0.238510 0.000171 1.363898 0.255857 985.69 1041.09 1.002
alpha{3} 0.477440 0.263592 0.000179 1.556781 0.304903 1133.73 1221.11 1.001
pinvar{all} 0.997164 0.000012 0.991108 0.999999 0.998228 1209.27 1355.13 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -726.726083
Model 2: PositiveSelection -726.726083
Model 0: one-ratio -726.726476
Model 7: beta -726.72627
Model 8: beta&w>1 -726.726235
Model 0 vs 1 7.860000000619038E-4
Model 2 vs 1 0.0
Model 8 vs 7 7.000000005064066E-5
>C1
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C2
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C3
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C4
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C5
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C6
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
C1 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C2 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C3 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C4 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C5 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C6 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
**************************************************
C1 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C2 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C3 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C4 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C5 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C6 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
**************************************************
C1 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C2 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C3 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C4 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C5 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C6 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
**************************************************
C1 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C2 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C3 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C4 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C5 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C6 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5520]--->[5520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.724 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C2 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C3 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C4 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C5 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
C6 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
**************************************************
C1 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C2 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C3 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C4 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C5 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
C6 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
**************************************************
C1 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C2 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C3 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C4 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C5 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
C6 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
**************************************************
C1 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C2 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C3 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C4 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C5 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
C6 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
C2 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
C3 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
C4 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
C5 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
C6 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
**************************************************
C1 CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
C2 CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
C3 CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
C4 CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
C5 CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
C6 CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
**************************************************
C1 ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
C2 ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
C3 ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
C4 ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
C5 ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
C6 ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
**************************************************
C1 ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
C2 ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
C3 ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
C4 ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
C5 ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
C6 ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
**************************************************
C1 CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
C2 CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
C3 CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
C4 CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
C5 CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
C6 CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
**************************************************
C1 TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
C2 TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
C3 TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
C4 TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
C5 TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
C6 TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
**************************************************
C1 GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
C2 GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
C3 GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
C4 GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
C5 GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
C6 GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
**************************************************
C1 CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
C2 CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
C3 CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
C4 CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
C5 CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
C6 CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
**************************************************
C1 TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
C2 TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
C3 TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
C4 TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
C5 TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
C6 TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
**************************************************
C1 GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
C2 GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
C3 GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
C4 GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
C5 GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
C6 GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
**************************************************
C1 GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
C2 GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
C3 GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
C4 GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
C5 GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
C6 GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
**************************************************
C1 CG
C2 CG
C3 CG
C4 CG
C5 CG
C6 CG
**
>C1
ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
CG
>C2
ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
CG
>C3
ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
CG
>C4
ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
CG
>C5
ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
CG
>C6
ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA
CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG
ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG
ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT
CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC
TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG
GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA
CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT
TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG
GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC
GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC
CG
>C1
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C2
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C3
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C4
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C5
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
>C6
MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 552 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856916
Setting output file names to "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 203039255
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5309682979
Seed = 1177724210
Swapseed = 1579856916
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1235.402461 -- -24.965149
Chain 2 -- -1235.402389 -- -24.965149
Chain 3 -- -1235.402461 -- -24.965149
Chain 4 -- -1235.402389 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1235.402461 -- -24.965149
Chain 2 -- -1235.402273 -- -24.965149
Chain 3 -- -1235.402461 -- -24.965149
Chain 4 -- -1235.402461 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1235.402] (-1235.402) (-1235.402) (-1235.402) * [-1235.402] (-1235.402) (-1235.402) (-1235.402)
500 -- [-772.488] (-770.922) (-768.350) (-774.058) * (-767.164) (-768.005) (-775.934) [-771.047] -- 0:00:00
1000 -- (-770.692) (-771.714) [-766.045] (-767.876) * [-766.599] (-769.384) (-768.742) (-773.896) -- 0:00:00
1500 -- (-765.716) [-766.352] (-767.078) (-764.408) * [-770.771] (-770.849) (-769.202) (-777.162) -- 0:00:00
2000 -- (-771.034) (-769.424) [-770.744] (-772.186) * [-768.840] (-774.568) (-772.485) (-776.100) -- 0:00:00
2500 -- (-769.543) (-767.975) [-765.760] (-772.003) * (-770.339) [-766.600] (-765.189) (-766.089) -- 0:00:00
3000 -- (-764.343) (-763.801) (-771.519) [-767.856] * (-766.281) (-764.238) [-771.783] (-775.319) -- 0:00:00
3500 -- [-773.026] (-767.092) (-765.710) (-765.870) * (-766.190) [-766.637] (-772.961) (-762.867) -- 0:00:00
4000 -- [-767.271] (-767.343) (-770.652) (-766.395) * (-774.195) (-766.735) (-767.533) [-769.708] -- 0:00:00
4500 -- (-768.793) (-777.114) [-765.047] (-773.054) * (-763.636) (-766.155) [-770.429] (-766.647) -- 0:00:00
5000 -- [-768.681] (-770.365) (-768.499) (-773.839) * (-776.284) [-768.479] (-766.652) (-766.873) -- 0:00:00
Average standard deviation of split frequencies: 0.121422
5500 -- [-766.904] (-769.340) (-767.906) (-769.303) * (-781.120) (-773.609) (-768.568) [-766.460] -- 0:00:00
6000 -- (-768.714) [-769.215] (-772.157) (-766.672) * (-768.616) (-767.882) (-767.421) [-768.145] -- 0:00:00
6500 -- [-766.657] (-763.338) (-769.729) (-778.090) * [-761.402] (-766.241) (-779.552) (-767.402) -- 0:00:00
7000 -- (-776.255) [-769.080] (-758.946) (-770.541) * (-758.744) (-777.158) [-760.949] (-764.667) -- 0:00:00
7500 -- [-769.318] (-766.708) (-759.042) (-764.253) * (-758.206) (-769.742) (-760.666) [-765.178] -- 0:00:00
8000 -- (-777.155) [-769.295] (-759.581) (-767.457) * (-760.306) (-766.652) [-759.573] (-773.663) -- 0:00:00
8500 -- (-763.881) (-770.162) (-758.354) [-771.354] * [-759.208] (-768.951) (-758.555) (-770.590) -- 0:00:00
9000 -- (-770.329) [-764.514] (-758.217) (-763.835) * [-758.817] (-776.575) (-759.168) (-768.917) -- 0:00:00
9500 -- (-769.047) [-770.852] (-759.537) (-767.271) * (-757.943) [-772.706] (-760.485) (-765.412) -- 0:00:00
10000 -- [-767.544] (-766.578) (-758.400) (-766.603) * (-759.324) (-771.784) (-759.380) [-763.294] -- 0:00:00
Average standard deviation of split frequencies: 0.061872
10500 -- (-767.895) [-767.723] (-758.467) (-769.976) * (-759.038) (-767.202) [-760.592] (-767.719) -- 0:00:00
11000 -- (-767.815) (-773.930) [-757.897] (-772.758) * (-762.376) (-770.301) (-760.381) [-773.925] -- 0:00:00
11500 -- (-768.860) (-774.288) (-758.282) [-767.725] * (-759.660) (-768.796) (-760.722) [-766.727] -- 0:00:00
12000 -- (-767.058) (-767.722) [-758.012] (-780.778) * (-759.398) (-770.353) (-758.844) [-767.522] -- 0:00:00
12500 -- (-764.562) (-774.289) (-762.465) [-766.956] * [-758.906] (-769.402) (-760.335) (-771.137) -- 0:00:00
13000 -- (-763.528) [-764.243] (-758.168) (-770.271) * [-759.491] (-768.328) (-760.742) (-774.288) -- 0:00:00
13500 -- (-769.173) (-771.313) [-759.332] (-770.952) * [-758.809] (-768.939) (-762.175) (-764.967) -- 0:00:00
14000 -- (-772.214) (-770.968) [-758.429] (-765.490) * [-759.078] (-769.989) (-758.415) (-772.408) -- 0:00:00
14500 -- (-769.874) [-770.177] (-758.872) (-771.073) * (-760.369) [-767.384] (-758.322) (-770.481) -- 0:00:00
15000 -- (-771.603) (-776.467) [-758.092] (-769.435) * (-759.551) (-775.262) [-759.164] (-769.144) -- 0:01:05
Average standard deviation of split frequencies: 0.051993
15500 -- (-770.563) [-759.891] (-762.716) (-771.571) * (-759.575) (-775.402) [-758.931] (-775.452) -- 0:01:03
16000 -- (-772.063) (-760.276) (-762.335) [-770.648] * (-760.351) (-767.686) (-762.222) [-766.888] -- 0:01:01
16500 -- (-773.947) [-760.758] (-760.646) (-770.221) * (-759.242) [-763.767] (-768.204) (-770.340) -- 0:00:59
17000 -- (-767.935) (-761.079) [-761.357] (-766.917) * [-764.598] (-774.138) (-764.951) (-768.181) -- 0:00:57
17500 -- (-766.615) (-761.007) (-758.460) [-768.771] * (-761.837) (-769.243) [-758.171] (-775.665) -- 0:00:56
18000 -- (-773.256) (-761.962) [-760.585] (-770.871) * (-762.554) [-772.439] (-764.649) (-771.251) -- 0:00:54
18500 -- [-763.428] (-762.805) (-759.030) (-763.982) * (-760.978) (-774.317) (-760.823) [-763.717] -- 0:00:53
19000 -- (-772.830) (-759.409) (-758.901) [-768.595] * (-759.557) [-766.930] (-759.220) (-766.464) -- 0:00:51
19500 -- [-766.978] (-757.907) (-758.477) (-763.156) * [-759.327] (-771.741) (-769.229) (-767.588) -- 0:00:50
20000 -- (-769.873) (-757.906) [-760.459] (-767.279) * (-759.889) (-764.117) (-759.242) [-769.971] -- 0:00:49
Average standard deviation of split frequencies: 0.038492
20500 -- (-774.804) [-760.572] (-762.039) (-769.684) * (-759.655) (-772.598) [-760.875] (-766.154) -- 0:00:47
21000 -- [-767.132] (-760.126) (-760.262) (-766.201) * (-759.081) (-766.318) [-761.685] (-770.789) -- 0:00:46
21500 -- (-769.449) (-759.136) (-760.243) [-766.013] * [-760.055] (-772.202) (-758.540) (-769.598) -- 0:00:45
22000 -- (-764.768) [-758.949] (-759.457) (-773.402) * (-759.095) (-775.976) (-761.900) [-772.475] -- 0:00:44
22500 -- (-773.316) (-759.121) (-758.588) [-774.222] * [-760.304] (-772.232) (-759.846) (-766.528) -- 0:00:43
23000 -- (-773.538) (-759.113) [-759.219] (-769.869) * (-760.309) (-769.048) (-760.439) [-765.666] -- 0:00:42
23500 -- (-763.345) (-760.234) (-760.192) [-768.556] * (-761.104) [-764.284] (-761.185) (-769.984) -- 0:00:41
24000 -- (-766.151) (-758.701) (-760.697) [-767.063] * (-760.176) (-773.448) [-761.854] (-775.237) -- 0:00:40
24500 -- (-765.843) (-758.791) [-761.253] (-782.292) * (-759.343) (-770.714) [-760.897] (-762.829) -- 0:00:39
25000 -- (-771.663) [-759.605] (-759.404) (-769.390) * (-758.605) (-765.989) (-760.837) [-768.606] -- 0:00:39
Average standard deviation of split frequencies: 0.031729
25500 -- [-764.055] (-761.041) (-760.922) (-776.611) * (-759.701) [-775.115] (-760.251) (-771.267) -- 0:00:38
26000 -- (-779.937) (-759.029) [-758.856] (-767.497) * (-762.747) (-766.821) (-761.406) [-765.713] -- 0:00:37
26500 -- (-767.508) (-759.122) (-761.169) [-763.741] * (-759.631) [-773.069] (-763.398) (-772.850) -- 0:00:36
27000 -- (-772.504) (-759.122) [-761.052] (-768.473) * [-761.060] (-776.584) (-763.835) (-772.451) -- 0:00:36
27500 -- (-765.156) [-759.056] (-760.560) (-766.824) * (-760.855) (-762.737) [-758.645] (-764.331) -- 0:00:35
28000 -- [-766.858] (-758.998) (-759.693) (-768.116) * (-759.778) (-769.620) [-758.051] (-772.873) -- 0:00:34
28500 -- (-767.797) [-759.667] (-763.243) (-771.019) * (-760.257) [-765.856] (-758.984) (-771.431) -- 0:00:34
29000 -- (-769.256) [-759.552] (-758.786) (-766.505) * [-758.832] (-763.240) (-761.184) (-769.357) -- 0:00:33
29500 -- (-769.693) (-763.379) (-758.334) [-769.013] * (-760.901) (-766.828) [-758.626] (-779.098) -- 0:00:32
30000 -- (-778.962) [-758.695] (-761.242) (-768.506) * (-758.651) (-773.048) [-760.104] (-767.504) -- 0:00:32
Average standard deviation of split frequencies: 0.030744
30500 -- (-766.174) (-760.106) [-761.443] (-782.473) * (-758.684) [-768.598] (-758.557) (-771.211) -- 0:00:31
31000 -- [-764.162] (-759.530) (-759.342) (-775.886) * (-759.980) (-776.336) (-758.865) [-771.269] -- 0:00:31
31500 -- (-768.415) (-759.443) (-760.026) [-772.249] * (-759.577) [-766.100] (-760.873) (-778.385) -- 0:00:30
32000 -- [-769.054] (-759.296) (-761.675) (-775.269) * (-759.927) (-779.865) (-763.066) [-763.360] -- 0:01:00
32500 -- (-771.849) (-759.083) [-760.863] (-767.154) * (-758.398) (-769.419) [-759.899] (-768.154) -- 0:00:59
33000 -- [-765.847] (-759.942) (-759.451) (-766.880) * [-759.982] (-765.042) (-759.890) (-774.118) -- 0:00:58
33500 -- (-770.736) [-761.930] (-759.437) (-767.208) * (-760.806) (-768.127) (-758.542) [-763.513] -- 0:00:57
34000 -- (-773.674) (-761.326) (-760.172) [-766.762] * (-757.839) [-764.672] (-758.242) (-773.417) -- 0:00:56
34500 -- [-767.442] (-759.557) (-759.558) (-765.626) * (-758.599) [-767.110] (-760.269) (-772.695) -- 0:00:55
35000 -- (-773.480) (-759.151) (-759.268) [-767.138] * [-758.523] (-775.548) (-760.015) (-770.999) -- 0:00:55
Average standard deviation of split frequencies: 0.020496
35500 -- (-770.147) (-759.588) (-762.432) [-774.997] * (-759.856) (-774.524) (-758.726) [-763.916] -- 0:00:54
36000 -- (-765.837) (-758.276) [-760.161] (-774.988) * [-759.037] (-768.893) (-758.501) (-773.106) -- 0:00:53
36500 -- [-769.303] (-759.778) (-764.926) (-774.298) * (-760.718) (-767.204) (-758.335) [-765.071] -- 0:00:52
37000 -- [-766.078] (-758.287) (-760.261) (-770.006) * [-759.778] (-771.347) (-758.932) (-771.152) -- 0:00:52
37500 -- (-765.432) (-761.242) [-759.201] (-770.355) * [-758.946] (-764.019) (-764.776) (-772.798) -- 0:00:51
38000 -- [-770.095] (-764.935) (-759.413) (-771.937) * (-759.511) (-768.903) [-758.380] (-768.368) -- 0:00:50
38500 -- (-770.993) (-764.308) (-761.141) [-763.080] * (-760.910) (-771.568) (-761.422) [-765.575] -- 0:00:49
39000 -- (-766.206) (-762.453) [-761.336] (-768.723) * (-761.800) (-769.074) [-759.376] (-770.291) -- 0:00:49
39500 -- [-767.303] (-764.299) (-760.982) (-767.583) * (-760.704) [-767.329] (-760.237) (-767.609) -- 0:00:48
40000 -- (-768.673) (-758.898) (-759.069) [-772.359] * (-759.960) (-777.468) [-760.414] (-767.851) -- 0:00:48
Average standard deviation of split frequencies: 0.019320
40500 -- (-766.417) [-759.869] (-758.965) (-791.607) * (-759.844) (-773.909) (-760.932) [-775.840] -- 0:00:47
41000 -- [-770.008] (-759.081) (-759.811) (-789.718) * (-759.956) (-770.098) (-760.897) [-769.091] -- 0:00:46
41500 -- (-771.836) [-759.816] (-763.256) (-763.390) * (-763.635) (-780.022) [-761.434] (-771.531) -- 0:00:46
42000 -- [-765.387] (-759.190) (-761.494) (-760.716) * (-760.209) [-766.351] (-760.854) (-765.801) -- 0:00:45
42500 -- (-771.098) [-758.513] (-758.675) (-759.075) * [-763.287] (-759.200) (-763.478) (-763.987) -- 0:00:45
43000 -- (-779.985) (-758.457) [-760.810] (-759.211) * [-759.604] (-760.014) (-759.500) (-767.036) -- 0:00:44
43500 -- (-760.555) (-758.642) (-759.884) [-759.086] * (-758.840) [-757.772] (-760.963) (-768.378) -- 0:00:43
44000 -- (-762.564) (-758.794) [-762.336] (-761.527) * (-759.642) (-761.621) (-758.865) [-774.837] -- 0:00:43
44500 -- [-765.288] (-760.274) (-760.454) (-761.346) * (-759.049) (-761.846) [-759.471] (-767.590) -- 0:00:42
45000 -- (-759.215) (-759.778) [-762.453] (-759.901) * [-758.921] (-761.969) (-758.910) (-768.787) -- 0:00:42
Average standard deviation of split frequencies: 0.018959
45500 -- (-759.590) [-759.167] (-761.478) (-761.503) * [-760.579] (-762.045) (-760.679) (-764.871) -- 0:00:41
46000 -- (-758.299) (-758.398) [-761.009] (-761.605) * (-759.538) (-761.663) [-761.896] (-768.766) -- 0:00:41
46500 -- [-760.218] (-759.934) (-765.603) (-761.027) * [-760.918] (-763.513) (-762.636) (-766.758) -- 0:00:41
47000 -- (-760.288) (-759.622) (-758.811) [-760.575] * [-760.093] (-758.768) (-761.877) (-766.938) -- 0:00:40
47500 -- (-760.006) (-759.494) [-758.374] (-757.999) * (-758.485) (-757.742) [-760.402] (-771.089) -- 0:00:40
48000 -- (-758.774) [-759.623] (-759.198) (-759.884) * [-759.455] (-758.285) (-763.157) (-765.822) -- 0:00:39
48500 -- [-762.967] (-761.041) (-758.469) (-758.295) * [-759.096] (-762.011) (-770.527) (-769.438) -- 0:00:58
49000 -- (-760.088) [-761.286] (-757.579) (-757.704) * (-757.700) [-760.096] (-769.565) (-770.586) -- 0:00:58
49500 -- [-760.857] (-757.951) (-758.778) (-758.105) * (-759.940) (-760.373) (-763.594) [-769.099] -- 0:00:57
50000 -- (-758.930) (-758.651) [-761.069] (-758.078) * [-758.180] (-763.542) (-760.410) (-777.201) -- 0:00:57
Average standard deviation of split frequencies: 0.019073
50500 -- [-758.883] (-763.979) (-761.815) (-758.648) * [-758.265] (-758.987) (-760.126) (-759.549) -- 0:00:56
51000 -- (-760.069) (-760.245) (-760.490) [-759.629] * [-758.193] (-761.249) (-761.513) (-760.462) -- 0:00:55
51500 -- (-759.094) (-758.092) [-759.519] (-759.170) * (-758.767) (-762.974) (-761.324) [-760.519] -- 0:00:55
52000 -- (-760.362) (-758.979) (-761.888) [-759.278] * [-759.742] (-760.764) (-757.585) (-759.768) -- 0:00:54
52500 -- [-762.133] (-760.203) (-761.065) (-762.778) * (-766.799) (-758.702) [-757.629] (-758.672) -- 0:00:54
53000 -- (-766.415) (-763.864) [-762.792] (-764.077) * (-760.766) (-760.618) [-758.938] (-761.426) -- 0:00:53
53500 -- [-766.293] (-759.638) (-768.230) (-762.236) * (-759.542) (-759.374) (-759.441) [-761.785] -- 0:00:53
54000 -- (-765.038) (-758.892) (-764.667) [-760.315] * (-760.481) (-758.815) [-759.764] (-762.209) -- 0:00:52
54500 -- [-759.563] (-758.378) (-762.131) (-766.380) * (-761.032) (-759.364) (-760.178) [-760.410] -- 0:00:52
55000 -- (-758.708) (-758.854) [-758.824] (-760.989) * [-759.845] (-760.098) (-759.456) (-759.124) -- 0:00:51
Average standard deviation of split frequencies: 0.023149
55500 -- (-759.911) (-757.728) (-762.428) [-758.686] * (-761.315) [-762.980] (-760.512) (-762.793) -- 0:00:51
56000 -- (-759.350) [-759.342] (-762.011) (-759.192) * (-759.444) [-761.318] (-760.153) (-760.656) -- 0:00:50
56500 -- (-759.621) (-759.410) (-760.146) [-761.345] * (-758.910) [-760.648] (-759.257) (-761.304) -- 0:00:50
57000 -- (-759.068) (-757.808) (-762.456) [-759.629] * [-759.430] (-761.330) (-759.050) (-761.422) -- 0:00:49
57500 -- (-759.016) (-760.878) [-762.487] (-767.163) * (-758.718) (-766.610) (-757.828) [-761.157] -- 0:00:49
58000 -- (-758.649) [-760.776] (-765.954) (-766.993) * (-759.220) (-761.404) (-759.611) [-760.803] -- 0:00:48
58500 -- (-758.585) (-758.444) (-759.827) [-764.483] * (-760.357) (-758.440) (-761.566) [-759.868] -- 0:00:48
59000 -- (-760.799) (-764.671) [-758.650] (-761.121) * (-758.786) [-760.138] (-761.009) (-759.487) -- 0:00:47
59500 -- (-759.950) (-760.515) [-758.357] (-765.360) * (-760.774) (-762.742) (-759.906) [-761.924] -- 0:00:47
60000 -- (-764.793) [-762.206] (-758.490) (-763.404) * (-764.457) [-757.868] (-761.046) (-765.307) -- 0:00:47
Average standard deviation of split frequencies: 0.023311
60500 -- (-761.361) (-758.858) (-759.491) [-762.193] * [-762.565] (-758.556) (-758.486) (-763.751) -- 0:00:46
61000 -- (-761.600) (-758.826) [-758.059] (-759.960) * [-761.320] (-760.299) (-758.835) (-761.994) -- 0:00:46
61500 -- (-759.595) (-761.195) [-758.016] (-759.277) * (-763.016) (-759.771) [-761.552] (-758.018) -- 0:00:45
62000 -- (-759.482) (-760.641) [-758.834] (-758.102) * [-758.776] (-759.800) (-758.839) (-758.656) -- 0:00:45
62500 -- (-759.098) (-762.606) [-758.504] (-758.563) * (-758.532) (-760.198) (-758.697) [-760.089] -- 0:00:45
63000 -- (-759.754) (-763.419) [-760.287] (-760.284) * [-760.038] (-758.124) (-758.659) (-759.082) -- 0:00:44
63500 -- [-760.575] (-763.242) (-759.181) (-759.982) * [-758.669] (-759.287) (-759.458) (-759.165) -- 0:00:44
64000 -- (-759.765) (-758.496) [-758.108] (-760.682) * (-763.257) [-759.478] (-758.951) (-758.658) -- 0:00:43
64500 -- (-761.288) (-762.204) [-759.158] (-758.572) * (-764.407) (-760.297) (-760.263) [-759.182] -- 0:00:43
65000 -- [-758.528] (-759.213) (-763.518) (-759.255) * [-760.161] (-759.912) (-760.409) (-759.990) -- 0:00:57
Average standard deviation of split frequencies: 0.018366
65500 -- [-758.051] (-762.937) (-762.352) (-759.469) * (-758.718) [-758.125] (-758.778) (-759.581) -- 0:00:57
66000 -- [-762.662] (-758.744) (-758.649) (-758.231) * (-759.051) (-758.882) [-758.153] (-760.642) -- 0:00:56
66500 -- (-762.554) (-758.687) [-760.590] (-760.132) * (-758.935) [-759.650] (-757.984) (-759.599) -- 0:00:56
67000 -- (-762.599) (-758.654) (-759.909) [-759.589] * (-760.780) [-758.013] (-759.795) (-761.889) -- 0:00:55
67500 -- (-763.589) (-758.554) (-760.711) [-760.001] * [-760.681] (-761.831) (-759.497) (-758.705) -- 0:00:55
68000 -- [-759.344] (-762.138) (-760.127) (-759.649) * (-762.088) [-761.398] (-759.641) (-761.442) -- 0:00:54
68500 -- (-759.918) (-761.939) [-760.936] (-760.486) * (-758.785) (-761.490) [-760.469] (-759.182) -- 0:00:54
69000 -- (-759.402) (-759.036) (-759.016) [-759.776] * (-759.044) (-764.933) (-763.744) [-759.115] -- 0:00:53
69500 -- (-760.175) (-761.428) (-758.644) [-759.542] * [-760.795] (-760.812) (-760.018) (-759.057) -- 0:00:53
70000 -- (-760.721) [-761.787] (-759.994) (-758.772) * (-760.808) (-758.259) (-758.992) [-759.368] -- 0:00:53
Average standard deviation of split frequencies: 0.017471
70500 -- (-761.543) (-760.230) [-761.940] (-760.370) * (-759.656) (-759.263) (-758.076) [-758.036] -- 0:00:52
71000 -- (-759.443) (-763.098) (-759.207) [-758.189] * (-762.350) (-759.509) [-761.299] (-758.351) -- 0:00:52
71500 -- [-758.761] (-759.829) (-758.709) (-760.480) * (-758.362) [-759.005] (-758.737) (-759.558) -- 0:00:51
72000 -- [-760.598] (-758.134) (-760.350) (-757.890) * (-760.044) [-761.331] (-760.160) (-759.982) -- 0:00:51
72500 -- (-759.341) (-758.899) [-759.038] (-758.861) * (-759.407) (-760.570) (-760.444) [-759.421] -- 0:00:51
73000 -- (-759.761) (-764.012) [-758.621] (-759.019) * (-759.031) [-762.962] (-760.168) (-765.001) -- 0:00:50
73500 -- [-758.524] (-758.353) (-759.606) (-759.492) * (-759.805) (-759.943) [-762.220] (-762.411) -- 0:00:50
74000 -- [-758.806] (-759.184) (-759.676) (-759.841) * (-758.862) [-758.813] (-759.828) (-758.267) -- 0:00:50
74500 -- [-757.761] (-759.374) (-758.421) (-757.823) * (-763.927) (-760.986) (-764.482) [-761.557] -- 0:00:49
75000 -- [-757.791] (-758.672) (-762.042) (-758.572) * [-758.739] (-759.348) (-758.817) (-760.179) -- 0:00:49
Average standard deviation of split frequencies: 0.015343
75500 -- (-758.952) (-761.339) [-760.415] (-758.854) * (-759.905) [-758.783] (-760.460) (-759.431) -- 0:00:48
76000 -- (-759.769) (-761.012) (-759.761) [-757.957] * (-761.681) (-761.597) [-758.083] (-760.283) -- 0:00:48
76500 -- (-759.495) (-758.380) [-758.531] (-759.588) * [-759.805] (-759.966) (-757.996) (-760.831) -- 0:00:48
77000 -- (-760.882) (-758.601) [-757.742] (-759.048) * [-758.917] (-764.710) (-761.203) (-759.823) -- 0:00:47
77500 -- (-761.920) [-760.449] (-758.370) (-762.075) * [-759.880] (-759.164) (-757.937) (-759.350) -- 0:00:47
78000 -- (-764.255) [-758.126] (-758.078) (-759.691) * (-760.190) [-760.227] (-758.789) (-758.386) -- 0:00:47
78500 -- (-759.388) [-759.316] (-759.202) (-760.745) * [-759.220] (-762.179) (-758.789) (-759.141) -- 0:00:46
79000 -- [-759.000] (-758.953) (-758.589) (-763.064) * (-761.034) (-761.940) [-758.932] (-759.511) -- 0:00:46
79500 -- [-760.227] (-760.240) (-758.803) (-762.058) * (-758.573) (-761.268) [-758.580] (-759.944) -- 0:00:46
80000 -- (-760.119) [-759.435] (-758.450) (-760.826) * (-758.454) [-761.535] (-758.523) (-758.648) -- 0:00:46
Average standard deviation of split frequencies: 0.017824
80500 -- (-759.153) (-759.765) [-758.165] (-765.035) * [-758.153] (-760.388) (-758.380) (-759.033) -- 0:00:45
81000 -- [-759.810] (-761.612) (-758.377) (-758.619) * (-758.940) (-760.287) (-757.856) [-762.003] -- 0:00:45
81500 -- (-761.720) (-763.012) (-758.160) [-759.093] * (-759.219) (-763.395) [-760.027] (-759.620) -- 0:00:45
82000 -- [-764.441] (-759.491) (-759.929) (-760.675) * (-760.013) (-757.979) [-759.082] (-761.678) -- 0:00:55
82500 -- (-765.472) (-758.874) [-759.791] (-759.972) * (-758.338) (-759.372) (-759.293) [-760.824] -- 0:00:55
83000 -- (-758.127) [-759.480] (-757.859) (-758.997) * (-759.060) (-759.166) [-758.790] (-757.767) -- 0:00:55
83500 -- (-761.539) (-760.354) [-758.623] (-758.995) * [-758.842] (-760.218) (-759.057) (-757.560) -- 0:00:54
84000 -- (-760.535) (-759.272) [-758.366] (-761.136) * (-763.332) (-759.578) (-760.015) [-758.049] -- 0:00:54
84500 -- [-761.247] (-759.570) (-761.767) (-760.383) * (-760.509) (-760.359) (-760.382) [-762.153] -- 0:00:54
85000 -- (-760.243) (-758.955) (-759.511) [-759.098] * [-760.604] (-762.173) (-760.351) (-759.360) -- 0:00:53
Average standard deviation of split frequencies: 0.018637
85500 -- (-759.271) (-762.240) (-758.727) [-762.914] * (-759.335) (-760.416) (-759.780) [-759.475] -- 0:00:53
86000 -- (-759.776) [-758.948] (-759.753) (-759.132) * (-758.915) (-761.022) [-761.447] (-760.550) -- 0:00:53
86500 -- (-759.686) (-759.123) (-759.559) [-760.913] * (-762.108) (-761.058) [-759.024] (-760.982) -- 0:00:52
87000 -- [-760.452] (-764.029) (-761.322) (-760.746) * (-762.090) (-759.841) [-761.775] (-762.191) -- 0:00:52
87500 -- [-762.261] (-761.926) (-761.049) (-760.078) * (-763.525) (-759.181) (-759.116) [-758.005] -- 0:00:52
88000 -- [-761.964] (-759.493) (-761.049) (-761.935) * (-759.218) (-759.642) (-759.438) [-758.162] -- 0:00:51
88500 -- (-759.178) [-761.733] (-760.278) (-760.376) * (-760.087) (-758.346) (-767.321) [-758.841] -- 0:00:51
89000 -- (-760.887) [-760.657] (-760.545) (-761.921) * (-759.530) [-759.542] (-761.909) (-758.411) -- 0:00:51
89500 -- [-761.208] (-761.534) (-759.723) (-760.851) * (-761.707) (-758.176) [-760.211] (-759.593) -- 0:00:50
90000 -- (-758.668) (-759.744) [-761.305] (-765.971) * (-762.650) (-759.711) [-760.398] (-761.333) -- 0:00:50
Average standard deviation of split frequencies: 0.024355
90500 -- (-760.269) [-760.541] (-759.244) (-758.225) * (-761.273) [-759.048] (-760.957) (-760.172) -- 0:00:50
91000 -- (-760.108) [-761.066] (-760.892) (-759.749) * (-764.129) (-758.820) [-762.484] (-759.730) -- 0:00:49
91500 -- (-759.861) (-758.315) (-763.355) [-761.327] * (-766.319) (-761.290) (-759.923) [-759.311] -- 0:00:49
92000 -- (-762.606) (-757.877) (-761.469) [-761.018] * [-757.918] (-759.596) (-757.934) (-759.096) -- 0:00:49
92500 -- (-763.204) (-758.965) [-759.076] (-764.134) * [-759.311] (-764.613) (-758.916) (-758.094) -- 0:00:49
93000 -- (-761.475) [-759.308] (-758.869) (-762.262) * (-759.200) [-764.613] (-761.124) (-758.179) -- 0:00:48
93500 -- (-758.558) [-758.657] (-758.061) (-760.785) * [-758.746] (-762.277) (-759.381) (-761.181) -- 0:00:48
94000 -- (-758.941) (-759.348) (-759.110) [-761.090] * (-759.144) (-758.457) (-760.218) [-757.788] -- 0:00:48
94500 -- (-758.311) (-759.189) (-766.952) [-759.773] * (-763.039) [-759.481] (-760.257) (-758.523) -- 0:00:47
95000 -- (-761.924) (-759.175) [-762.451] (-758.293) * [-758.686] (-758.420) (-759.302) (-759.354) -- 0:00:47
Average standard deviation of split frequencies: 0.024811
95500 -- [-760.427] (-760.056) (-761.922) (-758.712) * (-759.377) (-762.117) [-759.001] (-761.167) -- 0:00:47
96000 -- [-757.812] (-759.358) (-759.070) (-758.734) * (-760.849) (-762.067) [-760.193] (-761.192) -- 0:00:47
96500 -- (-759.805) [-759.933] (-760.219) (-759.626) * (-760.450) (-758.675) (-761.105) [-763.246] -- 0:00:46
97000 -- [-758.869] (-760.329) (-764.708) (-759.074) * (-761.258) (-758.633) [-759.093] (-758.768) -- 0:00:46
97500 -- (-764.355) (-760.797) (-763.785) [-759.063] * (-762.213) (-758.617) [-759.510] (-759.056) -- 0:00:46
98000 -- [-758.826] (-762.099) (-761.669) (-760.979) * (-760.784) (-762.850) (-759.230) [-759.000] -- 0:00:46
98500 -- (-760.913) (-761.465) [-760.969] (-758.508) * (-758.892) (-761.355) [-759.238] (-759.446) -- 0:00:54
99000 -- [-758.349] (-762.625) (-760.366) (-761.015) * (-760.270) (-758.263) (-759.002) [-759.053] -- 0:00:54
99500 -- (-759.275) [-761.853] (-760.397) (-758.428) * (-760.178) (-763.253) (-762.842) [-759.653] -- 0:00:54
100000 -- (-759.475) [-758.481] (-761.741) (-758.408) * (-759.371) (-758.749) (-758.737) [-760.399] -- 0:00:54
Average standard deviation of split frequencies: 0.024117
100500 -- (-759.888) (-759.345) (-759.186) [-758.834] * (-758.264) (-760.370) (-759.259) [-760.068] -- 0:00:53
101000 -- (-763.061) [-758.232] (-760.047) (-763.532) * (-759.948) [-759.467] (-761.246) (-763.350) -- 0:00:53
101500 -- (-763.168) (-758.675) (-758.465) [-759.379] * (-762.527) [-759.121] (-759.968) (-762.090) -- 0:00:53
102000 -- (-763.071) [-761.187] (-758.026) (-760.091) * [-759.085] (-761.687) (-758.734) (-759.059) -- 0:00:52
102500 -- (-762.729) [-758.118] (-759.872) (-762.442) * (-759.740) (-759.068) (-759.037) [-758.615] -- 0:00:52
103000 -- (-761.562) [-762.085] (-762.543) (-757.773) * (-760.740) (-758.724) [-758.358] (-762.218) -- 0:00:52
103500 -- (-764.746) (-762.343) (-758.890) [-758.269] * (-762.491) (-762.422) [-758.559] (-766.888) -- 0:00:51
104000 -- (-759.539) [-761.230] (-758.399) (-759.055) * (-760.456) [-759.145] (-760.461) (-761.514) -- 0:00:51
104500 -- (-759.197) (-763.120) [-760.530] (-757.748) * (-758.834) [-758.627] (-758.787) (-760.336) -- 0:00:51
105000 -- (-757.807) [-761.742] (-760.972) (-764.679) * [-760.809] (-759.899) (-758.053) (-761.772) -- 0:00:51
Average standard deviation of split frequencies: 0.025571
105500 -- (-760.088) [-760.136] (-760.730) (-762.179) * (-760.779) (-758.268) [-758.615] (-761.243) -- 0:00:50
106000 -- (-760.173) (-759.900) (-759.526) [-760.613] * (-760.824) [-759.574] (-759.728) (-759.422) -- 0:00:50
106500 -- (-759.879) (-758.039) [-759.746] (-760.555) * (-759.897) (-760.815) (-758.519) [-759.044] -- 0:00:50
107000 -- (-760.174) [-761.688] (-758.169) (-758.625) * [-758.876] (-759.977) (-759.653) (-760.905) -- 0:00:50
107500 -- (-760.820) (-759.404) (-758.796) [-760.921] * [-764.137] (-762.876) (-761.612) (-765.782) -- 0:00:49
108000 -- (-761.397) (-760.847) [-758.057] (-760.505) * (-758.943) (-757.995) (-758.403) [-760.674] -- 0:00:49
108500 -- (-763.993) (-760.472) (-759.612) [-761.081] * [-758.841] (-758.155) (-759.108) (-759.741) -- 0:00:49
109000 -- (-764.244) [-759.813] (-759.226) (-760.105) * [-760.215] (-759.406) (-761.232) (-759.659) -- 0:00:49
109500 -- (-758.955) [-759.967] (-759.831) (-760.036) * (-761.163) [-759.580] (-771.894) (-758.124) -- 0:00:48
110000 -- [-760.414] (-763.173) (-759.307) (-759.426) * (-763.312) (-761.275) (-771.773) [-758.443] -- 0:00:48
Average standard deviation of split frequencies: 0.025334
110500 -- [-758.764] (-764.972) (-759.221) (-760.098) * (-760.779) (-762.975) (-758.545) [-762.681] -- 0:00:48
111000 -- [-759.707] (-759.718) (-761.803) (-764.659) * (-759.379) [-759.773] (-758.658) (-761.604) -- 0:00:48
111500 -- (-761.168) (-760.225) (-761.152) [-760.378] * (-758.627) (-763.036) [-760.254] (-765.432) -- 0:00:47
112000 -- (-760.581) (-758.780) (-758.835) [-760.159] * (-758.312) (-763.059) [-758.272] (-766.212) -- 0:00:47
112500 -- (-761.153) [-758.362] (-759.689) (-768.053) * (-760.518) (-760.511) (-759.684) [-762.656] -- 0:00:47
113000 -- [-759.622] (-760.075) (-759.353) (-765.207) * (-758.102) (-759.701) [-759.990] (-759.243) -- 0:00:47
113500 -- [-759.105] (-760.278) (-759.425) (-761.108) * (-759.050) (-758.289) [-759.394] (-761.395) -- 0:00:46
114000 -- (-759.741) (-760.323) [-758.094] (-761.233) * (-765.627) (-763.122) [-762.685] (-759.983) -- 0:00:46
114500 -- [-765.099] (-760.009) (-761.408) (-759.509) * (-762.756) (-760.282) (-761.436) [-758.656] -- 0:00:46
115000 -- (-759.438) [-758.790] (-763.012) (-759.256) * (-759.400) [-760.494] (-766.450) (-760.602) -- 0:00:46
Average standard deviation of split frequencies: 0.024144
115500 -- [-759.320] (-758.107) (-759.204) (-763.332) * [-758.424] (-759.088) (-760.593) (-760.895) -- 0:00:53
116000 -- (-759.429) [-759.125] (-759.187) (-760.146) * (-760.116) (-760.250) (-761.267) [-762.358] -- 0:00:53
116500 -- (-758.446) [-760.327] (-758.343) (-759.282) * (-758.954) (-759.076) (-763.166) [-761.719] -- 0:00:53
117000 -- (-759.421) (-757.768) (-759.069) [-757.703] * (-760.855) (-759.127) (-761.206) [-758.945] -- 0:00:52
117500 -- (-758.800) (-761.069) (-758.420) [-761.854] * [-757.953] (-763.644) (-760.399) (-761.430) -- 0:00:52
118000 -- [-758.677] (-759.872) (-761.040) (-760.520) * (-757.702) (-760.505) [-763.335] (-761.251) -- 0:00:52
118500 -- [-760.590] (-757.932) (-759.366) (-759.198) * (-758.715) [-761.840] (-759.811) (-759.450) -- 0:00:52
119000 -- (-760.349) (-762.548) [-758.693] (-761.380) * (-758.924) (-759.315) [-762.380] (-760.258) -- 0:00:51
119500 -- (-761.660) (-761.915) [-758.524] (-760.772) * (-762.299) (-759.812) [-761.276] (-761.229) -- 0:00:51
120000 -- [-761.383] (-760.573) (-760.797) (-764.871) * (-763.501) (-759.325) (-763.509) [-758.562] -- 0:00:51
Average standard deviation of split frequencies: 0.026198
120500 -- (-761.419) (-760.351) [-759.064] (-762.262) * (-765.042) [-761.264] (-758.897) (-759.679) -- 0:00:51
121000 -- [-760.530] (-758.242) (-760.114) (-762.557) * (-760.117) [-760.345] (-760.370) (-759.925) -- 0:00:50
121500 -- (-760.959) [-760.921] (-764.566) (-759.940) * (-763.610) [-759.193] (-759.599) (-759.758) -- 0:00:50
122000 -- (-758.626) (-758.170) (-761.383) [-758.016] * (-761.575) [-759.785] (-762.090) (-758.831) -- 0:00:50
122500 -- (-759.030) (-762.958) [-758.862] (-759.349) * (-761.025) (-759.798) [-760.006] (-758.701) -- 0:00:50
123000 -- (-759.045) [-762.347] (-761.932) (-759.901) * (-759.478) (-760.066) [-761.475] (-760.747) -- 0:00:49
123500 -- (-758.481) [-761.846] (-760.007) (-760.128) * (-760.846) [-759.073] (-759.328) (-758.998) -- 0:00:49
124000 -- (-757.879) (-763.160) (-760.158) [-759.851] * (-760.406) (-759.850) [-760.910] (-758.622) -- 0:00:49
124500 -- [-758.239] (-760.539) (-760.980) (-763.026) * (-758.672) [-759.746] (-759.640) (-761.018) -- 0:00:49
125000 -- (-757.813) [-761.545] (-760.030) (-760.359) * (-761.015) [-758.736] (-761.841) (-760.854) -- 0:00:49
Average standard deviation of split frequencies: 0.025150
125500 -- [-758.996] (-759.786) (-761.113) (-759.728) * (-758.053) [-758.983] (-761.930) (-762.614) -- 0:00:48
126000 -- [-759.019] (-758.173) (-763.872) (-763.846) * (-761.548) (-759.166) (-760.066) [-758.271] -- 0:00:48
126500 -- (-760.356) [-758.227] (-763.131) (-760.860) * (-762.658) [-761.255] (-758.648) (-758.946) -- 0:00:48
127000 -- (-759.256) (-759.371) (-758.871) [-761.532] * (-760.910) [-757.755] (-758.415) (-761.773) -- 0:00:48
127500 -- (-760.793) [-760.047] (-758.488) (-760.752) * (-759.753) (-758.400) [-762.494] (-760.267) -- 0:00:47
128000 -- (-758.964) (-759.253) [-760.582] (-759.828) * (-761.120) [-759.656] (-760.260) (-760.861) -- 0:00:47
128500 -- (-761.215) [-759.987] (-760.022) (-759.569) * (-760.768) [-762.629] (-759.758) (-760.933) -- 0:00:47
129000 -- [-760.526] (-758.776) (-760.692) (-762.828) * (-761.128) [-758.242] (-760.122) (-758.416) -- 0:00:47
129500 -- (-759.803) (-759.321) (-760.752) [-761.592] * [-759.846] (-758.810) (-759.991) (-760.093) -- 0:00:47
130000 -- (-763.200) [-760.428] (-760.578) (-759.637) * (-759.715) (-763.927) [-759.748] (-757.782) -- 0:00:46
Average standard deviation of split frequencies: 0.026739
130500 -- (-759.035) [-759.471] (-760.635) (-758.199) * (-761.790) (-762.499) (-758.701) [-760.324] -- 0:00:46
131000 -- (-758.946) (-759.491) (-761.025) [-758.119] * (-757.494) [-761.121] (-758.448) (-759.966) -- 0:00:46
131500 -- (-759.813) (-760.055) [-758.808] (-758.013) * (-758.310) (-761.271) [-759.489] (-760.331) -- 0:00:46
132000 -- (-760.167) [-759.629] (-768.182) (-760.184) * [-758.600] (-760.441) (-760.708) (-763.085) -- 0:00:52
132500 -- (-764.582) [-763.454] (-758.715) (-759.286) * [-761.740] (-759.057) (-758.349) (-762.909) -- 0:00:52
133000 -- (-763.652) (-762.680) [-759.043] (-761.524) * (-761.314) [-759.498] (-759.619) (-764.903) -- 0:00:52
133500 -- [-759.658] (-759.212) (-759.698) (-761.780) * (-759.474) [-758.370] (-761.455) (-760.045) -- 0:00:51
134000 -- [-760.439] (-761.122) (-759.138) (-759.588) * [-760.005] (-762.955) (-759.329) (-759.117) -- 0:00:51
134500 -- (-761.968) (-761.013) [-761.235] (-762.715) * (-759.828) [-765.557] (-758.487) (-760.461) -- 0:00:51
135000 -- (-762.247) [-762.161] (-761.749) (-761.488) * (-760.313) [-759.032] (-761.112) (-760.594) -- 0:00:51
Average standard deviation of split frequencies: 0.025895
135500 -- (-758.603) [-763.025] (-761.348) (-762.924) * (-761.865) (-761.282) [-758.717] (-760.087) -- 0:00:51
136000 -- [-759.011] (-759.943) (-761.805) (-760.316) * [-759.655] (-760.143) (-760.131) (-761.754) -- 0:00:50
136500 -- (-762.114) [-759.806] (-760.168) (-762.106) * (-759.401) (-759.669) (-757.858) [-763.249] -- 0:00:50
137000 -- (-760.717) (-760.731) [-758.004] (-759.971) * (-759.930) (-761.824) [-759.183] (-763.449) -- 0:00:50
137500 -- (-763.319) [-760.647] (-760.571) (-759.722) * [-758.020] (-761.333) (-757.832) (-759.166) -- 0:00:50
138000 -- (-760.656) [-757.945] (-761.336) (-759.681) * [-758.705] (-759.466) (-758.148) (-758.404) -- 0:00:49
138500 -- (-760.857) [-762.192] (-761.018) (-759.718) * [-760.776] (-760.038) (-759.835) (-758.595) -- 0:00:49
139000 -- (-759.982) (-761.165) [-758.080] (-758.072) * (-758.140) (-762.996) (-759.254) [-758.354] -- 0:00:49
139500 -- (-759.435) [-758.990] (-758.598) (-759.164) * (-761.170) (-764.322) (-762.168) [-758.620] -- 0:00:49
140000 -- [-759.351] (-761.300) (-760.718) (-760.164) * (-758.831) (-764.715) (-760.230) [-762.455] -- 0:00:49
Average standard deviation of split frequencies: 0.024203
140500 -- (-757.987) (-758.386) [-761.589] (-761.919) * [-757.852] (-760.411) (-759.460) (-759.553) -- 0:00:48
141000 -- (-758.389) (-761.700) (-760.345) [-759.963] * (-759.478) (-759.734) (-758.450) [-758.403] -- 0:00:48
141500 -- (-757.784) (-763.600) [-759.301] (-763.559) * (-760.966) (-765.096) [-758.630] (-759.259) -- 0:00:48
142000 -- (-760.438) (-761.340) [-760.515] (-759.099) * (-760.123) [-760.520] (-759.283) (-760.166) -- 0:00:48
142500 -- (-760.708) (-762.544) [-764.181] (-758.774) * [-759.796] (-761.190) (-760.799) (-761.359) -- 0:00:48
143000 -- (-761.452) (-762.464) [-758.427] (-761.323) * (-764.117) (-763.663) (-758.963) [-758.429] -- 0:00:47
143500 -- (-760.626) [-759.766] (-760.323) (-762.947) * (-763.622) (-761.279) [-759.113] (-762.518) -- 0:00:47
144000 -- (-761.286) [-760.496] (-759.857) (-764.319) * (-764.209) (-759.322) [-759.271] (-760.308) -- 0:00:47
144500 -- [-760.213] (-758.838) (-760.105) (-761.885) * (-760.450) (-760.643) [-760.986] (-760.473) -- 0:00:47
145000 -- (-760.086) [-763.550] (-760.202) (-759.562) * (-760.035) (-762.022) [-759.168] (-763.046) -- 0:00:47
Average standard deviation of split frequencies: 0.023791
145500 -- [-759.103] (-761.568) (-762.033) (-758.748) * (-761.331) (-759.567) (-760.756) [-760.105] -- 0:00:46
146000 -- (-759.027) (-764.100) (-762.074) [-763.904] * (-760.077) (-759.350) (-758.881) [-762.619] -- 0:00:46
146500 -- (-759.535) (-760.470) [-760.654] (-759.663) * (-758.782) (-759.387) (-763.345) [-758.965] -- 0:00:46
147000 -- (-759.517) (-759.601) [-762.569] (-759.097) * [-758.098] (-759.781) (-762.258) (-759.986) -- 0:00:46
147500 -- [-757.959] (-758.574) (-760.101) (-759.302) * [-758.113] (-761.781) (-763.878) (-762.406) -- 0:00:46
148000 -- (-763.870) [-758.688] (-758.816) (-758.927) * (-759.758) (-759.091) [-760.716] (-762.111) -- 0:00:46
148500 -- (-762.961) (-760.605) (-758.757) [-760.188] * [-758.992] (-762.634) (-762.577) (-759.602) -- 0:00:45
149000 -- [-761.955] (-760.463) (-758.789) (-760.902) * (-761.682) (-758.180) [-763.142] (-761.108) -- 0:00:51
149500 -- [-759.960] (-759.367) (-760.265) (-760.101) * (-759.158) [-758.689] (-762.225) (-759.747) -- 0:00:51
150000 -- (-761.311) [-760.079] (-759.333) (-760.675) * [-762.170] (-762.584) (-759.854) (-759.449) -- 0:00:51
Average standard deviation of split frequencies: 0.024536
150500 -- (-760.749) (-761.052) (-763.385) [-758.911] * [-758.634] (-760.754) (-761.659) (-758.639) -- 0:00:50
151000 -- (-763.424) (-759.903) [-766.056] (-758.935) * [-758.823] (-763.874) (-761.097) (-759.835) -- 0:00:50
151500 -- [-765.457] (-761.222) (-760.886) (-758.591) * (-760.861) [-761.973] (-759.325) (-765.119) -- 0:00:50
152000 -- (-759.643) (-758.792) (-761.393) [-758.373] * [-759.826] (-758.953) (-761.528) (-763.727) -- 0:00:50
152500 -- (-760.235) (-758.615) (-761.635) [-762.849] * (-759.107) (-760.247) (-760.030) [-759.660] -- 0:00:50
153000 -- (-760.547) [-759.327] (-758.832) (-764.553) * [-759.098] (-759.909) (-761.445) (-764.147) -- 0:00:49
153500 -- (-758.249) (-759.157) [-758.718] (-759.720) * (-759.378) [-764.992] (-767.716) (-763.092) -- 0:00:49
154000 -- [-759.998] (-757.661) (-759.304) (-760.968) * [-758.533] (-762.730) (-761.276) (-761.404) -- 0:00:49
154500 -- [-760.589] (-761.801) (-763.936) (-759.886) * (-764.505) (-759.631) [-761.712] (-758.568) -- 0:00:49
155000 -- [-759.128] (-762.066) (-758.752) (-759.743) * [-760.666] (-769.410) (-762.816) (-759.565) -- 0:00:49
Average standard deviation of split frequencies: 0.024886
155500 -- (-757.746) [-760.569] (-758.439) (-759.934) * (-759.774) (-762.194) [-761.385] (-758.695) -- 0:00:48
156000 -- [-757.742] (-758.082) (-762.410) (-759.711) * (-759.625) (-767.856) (-761.396) [-757.816] -- 0:00:48
156500 -- [-758.141] (-758.556) (-761.548) (-758.334) * (-759.162) (-759.045) [-758.668] (-757.700) -- 0:00:48
157000 -- (-760.226) (-761.676) (-762.270) [-760.603] * (-759.323) (-758.897) (-758.318) [-758.225] -- 0:00:48
157500 -- [-759.948] (-758.608) (-759.898) (-762.617) * [-763.293] (-761.178) (-760.642) (-757.792) -- 0:00:48
158000 -- (-763.398) (-758.614) [-759.677] (-760.731) * (-763.589) [-761.628] (-762.314) (-758.682) -- 0:00:47
158500 -- (-760.146) [-758.467] (-758.620) (-762.953) * (-762.851) (-762.294) [-765.588] (-759.885) -- 0:00:47
159000 -- [-760.997] (-763.262) (-757.875) (-759.062) * (-763.715) (-759.532) (-758.503) [-758.623] -- 0:00:47
159500 -- (-761.541) [-762.915] (-760.144) (-760.334) * (-759.787) (-760.466) (-760.308) [-759.273] -- 0:00:47
160000 -- [-759.034] (-759.037) (-761.866) (-758.134) * (-760.308) (-759.785) (-758.079) [-763.180] -- 0:00:47
Average standard deviation of split frequencies: 0.024776
160500 -- [-758.782] (-760.581) (-760.341) (-760.160) * (-761.482) (-762.366) [-758.578] (-767.923) -- 0:00:47
161000 -- (-757.942) (-760.089) [-760.625] (-760.988) * (-761.361) [-760.367] (-759.519) (-759.761) -- 0:00:46
161500 -- (-761.686) (-764.588) [-758.749] (-760.073) * (-763.314) (-766.788) (-758.401) [-759.831] -- 0:00:46
162000 -- [-760.140] (-763.571) (-758.002) (-760.524) * (-760.118) [-758.813] (-762.355) (-760.190) -- 0:00:46
162500 -- (-763.435) (-762.897) [-757.758] (-761.338) * (-758.544) (-758.049) (-759.544) [-758.697] -- 0:00:46
163000 -- (-761.452) (-758.925) [-758.845] (-759.048) * (-759.553) (-757.870) [-762.009] (-761.266) -- 0:00:46
163500 -- (-758.347) (-759.937) [-761.643] (-759.598) * (-759.589) [-757.926] (-758.845) (-758.203) -- 0:00:46
164000 -- (-760.302) (-761.150) (-764.537) [-767.183] * (-761.420) [-757.925] (-758.558) (-758.653) -- 0:00:45
164500 -- (-761.190) (-758.850) [-761.551] (-761.157) * (-760.260) [-758.501] (-758.245) (-759.290) -- 0:00:45
165000 -- (-760.562) (-759.188) (-759.175) [-760.612] * (-758.810) (-760.697) [-758.133] (-762.100) -- 0:00:45
Average standard deviation of split frequencies: 0.026754
165500 -- (-761.415) (-758.657) [-759.660] (-760.392) * (-761.415) [-759.635] (-760.291) (-770.400) -- 0:00:45
166000 -- (-759.745) (-761.816) (-760.808) [-762.225] * (-759.443) (-757.854) (-758.355) [-761.213] -- 0:00:50
166500 -- (-758.960) [-759.869] (-760.930) (-760.110) * (-760.029) [-758.619] (-758.224) (-758.766) -- 0:00:50
167000 -- (-758.174) (-759.870) (-762.355) [-759.645] * (-758.885) [-757.980] (-763.177) (-762.461) -- 0:00:49
167500 -- (-760.086) (-760.198) (-763.264) [-761.229] * (-761.920) (-760.076) [-759.568] (-763.080) -- 0:00:49
168000 -- (-761.386) (-759.493) [-761.645] (-760.906) * (-759.944) (-758.663) [-760.121] (-760.916) -- 0:00:49
168500 -- (-759.885) (-759.251) [-760.062] (-761.547) * (-758.419) (-760.938) [-765.002] (-761.207) -- 0:00:49
169000 -- [-761.454] (-760.137) (-763.714) (-761.992) * (-758.816) [-759.982] (-761.289) (-762.431) -- 0:00:49
169500 -- (-765.155) (-764.624) [-758.771] (-760.413) * (-760.232) [-758.378] (-760.806) (-762.869) -- 0:00:48
170000 -- [-762.876] (-759.664) (-759.289) (-758.926) * (-759.035) (-758.112) (-767.932) [-761.164] -- 0:00:48
Average standard deviation of split frequencies: 0.025731
170500 -- (-759.276) (-762.048) [-761.401] (-759.383) * (-758.813) (-759.949) (-758.277) [-759.575] -- 0:00:48
171000 -- [-758.383] (-760.477) (-758.944) (-761.345) * (-759.425) [-760.549] (-758.744) (-758.501) -- 0:00:48
171500 -- (-759.059) [-757.760] (-760.029) (-761.486) * (-759.371) (-757.874) [-758.937] (-760.385) -- 0:00:48
172000 -- (-765.327) (-760.351) [-759.949] (-761.948) * [-760.080] (-758.889) (-760.429) (-762.911) -- 0:00:48
172500 -- (-759.133) (-759.944) (-759.385) [-758.330] * (-757.979) (-762.403) [-759.222] (-759.076) -- 0:00:47
173000 -- (-760.255) (-760.086) (-757.753) [-757.498] * (-757.794) [-760.901] (-760.821) (-758.908) -- 0:00:47
173500 -- (-758.767) [-760.925] (-759.376) (-758.393) * (-758.623) (-760.814) (-758.193) [-759.722] -- 0:00:47
174000 -- (-762.027) (-757.886) (-760.891) [-762.167] * [-757.902] (-762.839) (-758.322) (-758.560) -- 0:00:47
174500 -- (-761.481) (-758.842) (-759.319) [-760.919] * [-759.604] (-759.834) (-760.726) (-759.968) -- 0:00:47
175000 -- [-757.636] (-759.528) (-757.829) (-760.222) * (-758.649) (-761.511) [-761.403] (-762.606) -- 0:00:47
Average standard deviation of split frequencies: 0.024552
175500 -- (-759.162) (-762.746) (-758.569) [-757.851] * (-761.801) (-758.763) (-763.066) [-759.078] -- 0:00:46
176000 -- [-758.897] (-760.664) (-759.267) (-759.599) * (-760.425) (-758.531) (-763.036) [-759.901] -- 0:00:46
176500 -- (-760.445) [-760.636] (-762.269) (-759.873) * (-760.235) (-759.534) (-761.417) [-758.484] -- 0:00:46
177000 -- [-758.674] (-766.501) (-760.995) (-758.853) * [-760.616] (-763.262) (-761.742) (-758.290) -- 0:00:46
177500 -- (-759.591) [-764.237] (-760.676) (-758.456) * (-758.692) (-761.138) [-758.159] (-758.266) -- 0:00:46
178000 -- (-762.862) [-761.166] (-761.535) (-759.127) * (-760.426) [-760.285] (-758.868) (-758.682) -- 0:00:46
178500 -- [-758.257] (-762.064) (-759.493) (-758.994) * [-763.523] (-760.899) (-760.525) (-763.532) -- 0:00:46
179000 -- (-761.342) (-761.105) [-759.386] (-759.740) * (-761.287) (-762.950) (-761.690) [-758.470] -- 0:00:45
179500 -- [-759.127] (-759.328) (-758.914) (-759.867) * (-761.048) (-759.898) [-758.100] (-758.459) -- 0:00:45
180000 -- (-759.288) (-760.422) (-759.533) [-761.558] * (-757.672) [-760.913] (-763.651) (-775.370) -- 0:00:45
Average standard deviation of split frequencies: 0.022869
180500 -- [-759.434] (-759.875) (-765.890) (-758.905) * [-758.480] (-761.953) (-757.628) (-760.035) -- 0:00:45
181000 -- [-759.649] (-758.788) (-759.785) (-763.506) * [-760.504] (-764.954) (-758.948) (-761.607) -- 0:00:45
181500 -- (-759.089) (-758.873) (-758.371) [-759.058] * [-760.732] (-760.479) (-760.457) (-760.895) -- 0:00:45
182000 -- (-760.158) (-762.055) [-760.508] (-762.885) * (-761.422) [-760.350] (-760.357) (-758.010) -- 0:00:44
182500 -- [-758.501] (-759.182) (-757.912) (-761.259) * (-759.565) (-760.563) [-759.482] (-759.698) -- 0:00:44
183000 -- (-760.229) (-759.252) [-759.608] (-761.008) * (-758.964) (-758.375) [-759.058] (-760.494) -- 0:00:49
183500 -- [-760.039] (-761.626) (-758.177) (-759.194) * [-759.017] (-762.319) (-760.354) (-759.528) -- 0:00:48
184000 -- [-759.288] (-762.825) (-758.100) (-757.777) * (-760.935) (-762.182) (-759.370) [-758.771] -- 0:00:48
184500 -- (-761.921) (-762.981) (-758.242) [-758.191] * (-759.928) (-759.633) [-760.276] (-763.125) -- 0:00:48
185000 -- (-765.678) (-760.103) [-759.130] (-759.370) * (-759.191) (-759.140) (-758.456) [-759.367] -- 0:00:48
Average standard deviation of split frequencies: 0.021683
185500 -- (-758.956) (-760.196) (-757.899) [-759.217] * [-758.651] (-759.264) (-759.289) (-762.585) -- 0:00:48
186000 -- [-761.891] (-761.590) (-758.498) (-758.058) * (-766.341) (-761.519) (-763.003) [-761.291] -- 0:00:48
186500 -- (-763.433) (-760.556) [-759.652] (-758.200) * (-760.308) (-760.418) (-760.875) [-759.534] -- 0:00:47
187000 -- (-759.952) [-758.207] (-758.862) (-759.779) * (-763.204) (-760.115) [-761.812] (-759.320) -- 0:00:47
187500 -- (-766.356) (-759.663) [-757.604] (-758.677) * (-758.648) (-759.150) (-759.336) [-759.512] -- 0:00:47
188000 -- (-766.103) (-758.918) [-759.337] (-761.699) * (-759.216) (-761.680) (-759.292) [-765.311] -- 0:00:47
188500 -- (-764.498) [-765.129] (-760.513) (-759.013) * [-759.707] (-761.826) (-761.267) (-762.251) -- 0:00:47
189000 -- (-763.194) (-766.027) (-759.270) [-758.416] * (-761.076) (-761.120) [-759.454] (-764.461) -- 0:00:47
189500 -- [-758.789] (-761.136) (-761.180) (-760.995) * [-763.516] (-761.541) (-761.439) (-758.620) -- 0:00:47
190000 -- (-759.814) (-759.519) [-761.615] (-759.899) * (-761.864) (-763.098) [-761.462] (-758.552) -- 0:00:46
Average standard deviation of split frequencies: 0.021670
190500 -- [-759.369] (-761.596) (-760.404) (-761.428) * (-760.509) (-764.956) [-760.710] (-759.688) -- 0:00:46
191000 -- (-764.025) [-759.234] (-760.402) (-760.448) * (-760.640) (-764.890) [-759.629] (-763.147) -- 0:00:46
191500 -- [-759.456] (-759.124) (-759.973) (-757.715) * [-760.151] (-760.526) (-759.510) (-761.971) -- 0:00:46
192000 -- (-760.505) (-758.718) [-760.445] (-758.737) * (-760.588) (-759.425) (-757.968) [-762.452] -- 0:00:46
192500 -- [-761.789] (-758.625) (-761.434) (-760.494) * (-759.927) [-758.520] (-759.598) (-759.773) -- 0:00:46
193000 -- [-760.712] (-766.078) (-760.319) (-763.535) * (-758.483) (-759.137) (-762.061) [-759.195] -- 0:00:45
193500 -- (-759.454) (-761.343) [-759.934] (-759.974) * (-760.394) (-759.123) [-759.568] (-763.683) -- 0:00:45
194000 -- (-762.616) (-760.895) [-758.632] (-760.840) * (-760.329) [-759.077] (-761.646) (-759.542) -- 0:00:45
194500 -- (-758.107) (-759.172) (-760.726) [-758.864] * (-763.544) (-759.829) (-759.126) [-760.246] -- 0:00:45
195000 -- (-760.369) (-759.724) (-760.005) [-759.950] * [-758.765] (-761.473) (-761.364) (-762.368) -- 0:00:45
Average standard deviation of split frequencies: 0.023383
195500 -- [-761.273] (-762.103) (-764.412) (-762.743) * (-759.028) [-760.280] (-761.583) (-765.608) -- 0:00:45
196000 -- (-759.903) (-760.268) (-764.517) [-761.387] * (-757.998) (-758.929) [-757.846] (-758.790) -- 0:00:45
196500 -- (-757.856) (-762.654) (-760.132) [-763.642] * (-759.566) (-758.138) [-758.797] (-760.121) -- 0:00:44
197000 -- (-759.561) [-759.614] (-762.437) (-760.808) * (-760.762) [-763.303] (-758.296) (-760.508) -- 0:00:44
197500 -- (-759.921) (-763.010) (-761.544) [-760.296] * (-760.942) (-760.141) [-761.201] (-762.199) -- 0:00:44
198000 -- (-758.982) (-760.223) (-759.020) [-758.866] * [-762.082] (-763.427) (-760.831) (-761.737) -- 0:00:44
198500 -- [-759.185] (-759.173) (-762.630) (-759.177) * [-760.549] (-758.094) (-758.137) (-760.850) -- 0:00:44
199000 -- (-759.581) (-758.267) (-760.378) [-759.328] * [-762.744] (-758.214) (-758.180) (-762.925) -- 0:00:44
199500 -- (-758.403) (-759.495) [-759.391] (-757.661) * (-763.026) (-760.702) [-766.303] (-759.190) -- 0:00:48
200000 -- [-760.712] (-760.580) (-762.232) (-757.817) * (-757.980) (-762.237) (-765.605) [-758.731] -- 0:00:48
Average standard deviation of split frequencies: 0.023354
200500 -- [-759.374] (-762.206) (-758.689) (-758.869) * (-761.848) (-759.088) (-761.560) [-758.885] -- 0:00:47
201000 -- [-759.122] (-761.070) (-761.093) (-760.644) * (-761.411) [-759.318] (-763.970) (-761.168) -- 0:00:47
201500 -- [-758.162] (-759.346) (-760.544) (-759.842) * (-761.595) (-760.412) (-762.691) [-758.551] -- 0:00:47
202000 -- (-760.113) (-761.038) (-760.161) [-760.804] * (-759.462) [-758.026] (-761.286) (-758.922) -- 0:00:47
202500 -- (-760.179) [-758.875] (-762.715) (-760.151) * (-759.813) (-759.523) (-758.786) [-758.787] -- 0:00:47
203000 -- (-759.577) (-766.532) (-762.334) [-761.103] * [-761.792] (-758.567) (-762.251) (-759.233) -- 0:00:47
203500 -- (-760.385) (-760.138) (-761.133) [-759.009] * (-759.666) (-759.185) [-759.229] (-760.645) -- 0:00:46
204000 -- [-765.638] (-759.109) (-762.141) (-758.662) * (-761.950) [-758.515] (-761.757) (-759.371) -- 0:00:46
204500 -- (-761.513) (-760.842) (-759.923) [-759.698] * (-760.000) (-758.219) (-767.752) [-759.363] -- 0:00:46
205000 -- (-761.458) (-763.614) (-761.794) [-758.661] * (-759.103) (-759.925) [-765.779] (-760.023) -- 0:00:46
Average standard deviation of split frequencies: 0.023691
205500 -- (-760.286) (-759.778) (-762.301) [-757.788] * (-759.033) [-761.242] (-759.360) (-760.193) -- 0:00:46
206000 -- (-761.586) [-758.323] (-759.424) (-759.065) * (-758.819) (-763.047) (-758.990) [-759.129] -- 0:00:46
206500 -- (-761.148) (-759.529) (-760.486) [-761.429] * (-757.798) (-760.916) [-760.721] (-760.116) -- 0:00:46
207000 -- (-760.780) [-758.855] (-761.902) (-761.952) * (-761.077) [-760.098] (-762.587) (-758.939) -- 0:00:45
207500 -- (-759.028) [-759.988] (-763.437) (-767.135) * [-758.871] (-758.571) (-758.491) (-760.784) -- 0:00:45
208000 -- [-757.948] (-762.712) (-758.686) (-768.874) * [-759.019] (-758.985) (-760.714) (-758.597) -- 0:00:45
208500 -- [-759.136] (-758.546) (-761.218) (-764.228) * (-760.011) (-758.759) (-760.283) [-759.049] -- 0:00:45
209000 -- (-760.632) (-760.275) (-758.021) [-759.995] * [-758.912] (-764.500) (-760.805) (-758.894) -- 0:00:45
209500 -- [-759.099] (-759.217) (-757.784) (-762.384) * (-758.817) (-758.520) [-761.927] (-758.964) -- 0:00:45
210000 -- [-759.091] (-762.354) (-758.561) (-758.935) * (-759.416) (-758.441) (-761.031) [-761.538] -- 0:00:45
Average standard deviation of split frequencies: 0.022114
210500 -- [-762.178] (-757.894) (-761.657) (-759.098) * (-759.223) [-760.369] (-758.469) (-761.012) -- 0:00:45
211000 -- (-759.570) (-759.124) [-760.627] (-762.253) * (-758.984) [-760.990] (-759.338) (-761.605) -- 0:00:44
211500 -- (-758.449) (-763.231) (-761.937) [-761.431] * (-760.499) (-761.575) [-762.399] (-763.134) -- 0:00:44
212000 -- (-758.481) (-758.193) [-759.052] (-762.375) * [-759.117] (-760.328) (-761.398) (-758.912) -- 0:00:44
212500 -- (-758.316) (-759.868) [-759.418] (-759.887) * (-758.393) (-758.176) [-759.184] (-759.412) -- 0:00:44
213000 -- (-759.872) (-766.332) [-759.788] (-758.772) * [-759.203] (-759.484) (-759.461) (-757.654) -- 0:00:44
213500 -- (-758.578) (-760.184) [-763.372] (-758.853) * (-762.001) [-762.593] (-759.943) (-759.144) -- 0:00:44
214000 -- [-760.295] (-769.419) (-763.692) (-759.496) * (-760.730) [-758.975] (-764.036) (-760.147) -- 0:00:44
214500 -- [-758.989] (-759.564) (-758.358) (-757.945) * [-760.279] (-758.649) (-759.874) (-761.432) -- 0:00:43
215000 -- [-760.533] (-759.493) (-758.581) (-759.888) * (-760.965) [-758.277] (-763.439) (-758.541) -- 0:00:43
Average standard deviation of split frequencies: 0.023493
215500 -- [-760.291] (-758.336) (-758.559) (-762.505) * (-758.728) (-758.537) [-760.051] (-758.160) -- 0:00:43
216000 -- (-766.619) [-761.295] (-765.482) (-759.308) * [-759.595] (-760.267) (-760.831) (-759.042) -- 0:00:43
216500 -- [-762.237] (-758.280) (-766.385) (-762.691) * (-760.729) (-759.804) (-761.193) [-758.403] -- 0:00:47
217000 -- (-759.224) (-758.015) [-761.858] (-758.450) * (-758.288) (-762.127) (-758.698) [-759.578] -- 0:00:46
217500 -- (-758.524) (-759.334) (-759.028) [-761.603] * [-759.729] (-758.027) (-761.171) (-758.333) -- 0:00:46
218000 -- (-761.856) (-762.332) (-758.587) [-761.155] * (-762.966) (-757.607) [-762.335] (-760.417) -- 0:00:46
218500 -- [-763.080] (-758.350) (-759.288) (-762.733) * (-758.594) (-760.230) [-758.617] (-759.472) -- 0:00:46
219000 -- (-760.876) [-759.036] (-758.739) (-762.420) * (-758.285) (-763.129) (-760.134) [-763.215] -- 0:00:46
219500 -- (-757.818) (-758.661) (-759.357) [-758.719] * [-760.207] (-761.999) (-760.112) (-761.270) -- 0:00:46
220000 -- (-760.811) (-760.498) [-758.629] (-760.822) * (-763.659) (-764.608) [-759.132] (-760.689) -- 0:00:46
Average standard deviation of split frequencies: 0.022242
220500 -- [-758.857] (-761.482) (-758.609) (-760.804) * [-759.513] (-759.316) (-760.196) (-759.153) -- 0:00:45
221000 -- (-759.587) (-759.760) [-759.221] (-761.384) * (-758.592) (-760.538) [-760.814] (-758.396) -- 0:00:45
221500 -- (-757.849) (-759.859) [-760.312] (-759.007) * [-758.661] (-760.144) (-766.930) (-757.903) -- 0:00:45
222000 -- [-757.900] (-759.124) (-760.141) (-758.294) * (-758.700) [-762.596] (-760.506) (-760.871) -- 0:00:45
222500 -- (-759.140) (-759.062) [-759.797] (-759.333) * (-758.258) (-760.716) (-757.998) [-761.998] -- 0:00:45
223000 -- (-759.613) (-760.155) (-759.142) [-759.688] * [-760.400] (-759.962) (-759.481) (-764.200) -- 0:00:45
223500 -- (-759.708) [-758.182] (-757.844) (-757.865) * (-759.597) (-760.225) (-758.300) [-760.176] -- 0:00:45
224000 -- (-763.689) [-758.783] (-759.575) (-760.178) * (-760.017) [-759.739] (-762.202) (-761.608) -- 0:00:45
224500 -- (-763.760) (-758.740) (-758.989) [-761.248] * (-759.865) [-759.965] (-763.875) (-759.487) -- 0:00:44
225000 -- (-764.339) (-758.461) (-758.423) [-758.563] * (-759.027) (-760.015) (-762.425) [-760.313] -- 0:00:44
Average standard deviation of split frequencies: 0.021670
225500 -- (-760.158) [-759.490] (-760.208) (-759.089) * (-758.567) (-760.171) (-758.992) [-762.375] -- 0:00:44
226000 -- (-760.055) [-765.592] (-761.739) (-762.330) * (-758.332) (-764.002) [-759.406] (-758.426) -- 0:00:44
226500 -- (-765.819) (-759.911) [-758.298] (-758.958) * (-757.774) (-758.659) [-758.170] (-759.906) -- 0:00:44
227000 -- (-762.308) (-760.677) [-765.521] (-760.075) * [-759.272] (-759.191) (-760.327) (-761.096) -- 0:00:44
227500 -- (-759.280) [-761.234] (-758.562) (-760.013) * (-760.844) (-758.311) [-758.999] (-762.727) -- 0:00:44
228000 -- (-761.066) (-759.892) (-758.473) [-759.629] * (-758.528) (-759.557) [-758.769] (-759.612) -- 0:00:44
228500 -- (-762.672) (-761.668) [-758.309] (-759.569) * (-758.441) (-760.189) (-759.071) [-759.291] -- 0:00:43
229000 -- (-762.248) (-758.315) (-758.284) [-759.163] * (-759.417) (-758.813) (-761.411) [-758.239] -- 0:00:43
229500 -- (-760.746) (-759.792) (-758.931) [-762.211] * (-759.567) (-758.933) (-760.313) [-758.032] -- 0:00:43
230000 -- (-762.180) (-759.645) [-758.404] (-761.866) * (-759.527) (-763.458) (-760.437) [-759.183] -- 0:00:43
Average standard deviation of split frequencies: 0.019528
230500 -- (-759.856) (-758.050) [-761.382] (-762.770) * [-763.240] (-762.888) (-757.911) (-759.392) -- 0:00:43
231000 -- (-759.694) (-762.381) [-758.991] (-762.943) * (-761.025) [-761.899] (-760.714) (-761.208) -- 0:00:43
231500 -- (-760.007) (-761.756) [-760.489] (-759.755) * [-758.252] (-762.868) (-761.796) (-760.501) -- 0:00:43
232000 -- [-761.631] (-758.890) (-760.152) (-760.211) * [-759.555] (-763.153) (-759.836) (-762.965) -- 0:00:43
232500 -- (-759.704) (-760.909) [-757.856] (-759.530) * [-758.830] (-761.907) (-759.929) (-758.597) -- 0:00:42
233000 -- (-758.397) [-758.724] (-758.923) (-760.558) * (-759.353) (-766.096) [-758.283] (-758.492) -- 0:00:46
233500 -- (-758.245) (-760.033) [-760.452] (-761.625) * (-759.973) (-763.915) (-760.231) [-759.116] -- 0:00:45
234000 -- (-759.158) (-762.554) [-759.250] (-759.088) * (-760.423) (-759.922) (-760.025) [-758.001] -- 0:00:45
234500 -- (-760.864) [-761.985] (-759.503) (-759.890) * (-761.230) (-762.868) (-761.112) [-763.577] -- 0:00:45
235000 -- (-759.931) (-759.286) (-758.832) [-758.564] * (-762.271) (-761.368) (-759.802) [-758.994] -- 0:00:45
Average standard deviation of split frequencies: 0.018088
235500 -- [-758.999] (-758.501) (-758.872) (-760.057) * (-761.831) (-761.781) (-759.453) [-759.102] -- 0:00:45
236000 -- (-759.626) [-759.382] (-761.015) (-760.624) * (-759.822) [-759.891] (-760.449) (-757.728) -- 0:00:45
236500 -- (-760.593) (-759.051) (-759.398) [-759.500] * [-762.877] (-759.807) (-762.768) (-759.083) -- 0:00:45
237000 -- (-760.811) (-759.274) (-762.831) [-761.846] * (-758.461) (-760.413) (-759.553) [-760.192] -- 0:00:45
237500 -- (-760.801) [-759.896] (-760.940) (-763.344) * (-763.105) (-760.607) [-757.697] (-763.160) -- 0:00:44
238000 -- (-764.174) [-759.111] (-761.724) (-758.930) * (-765.045) [-759.504] (-764.124) (-762.366) -- 0:00:44
238500 -- (-763.039) (-759.211) [-759.078] (-760.723) * [-761.170] (-760.072) (-760.474) (-759.900) -- 0:00:44
239000 -- (-766.746) (-760.488) [-759.587] (-760.689) * [-758.912] (-759.842) (-760.757) (-770.072) -- 0:00:44
239500 -- (-758.831) (-760.015) (-762.307) [-761.510] * (-759.412) (-760.280) (-766.313) [-760.951] -- 0:00:44
240000 -- (-758.877) (-760.416) [-760.294] (-760.973) * (-758.564) (-758.039) (-758.332) [-762.413] -- 0:00:44
Average standard deviation of split frequencies: 0.016894
240500 -- (-758.147) (-758.217) [-758.669] (-759.790) * (-762.158) (-760.625) (-758.302) [-760.087] -- 0:00:44
241000 -- (-760.685) [-762.341] (-760.552) (-758.700) * (-758.755) (-761.019) [-760.222] (-759.496) -- 0:00:44
241500 -- (-758.669) (-758.022) [-762.228] (-760.321) * (-760.436) (-761.087) [-760.930] (-759.810) -- 0:00:43
242000 -- [-759.594] (-763.840) (-759.325) (-759.895) * (-762.238) (-761.323) [-761.487] (-758.944) -- 0:00:43
242500 -- (-760.551) [-758.418] (-759.753) (-758.101) * (-758.085) [-760.641] (-761.128) (-759.738) -- 0:00:43
243000 -- [-759.706] (-761.299) (-757.994) (-759.846) * (-758.941) (-757.855) (-759.757) [-762.400] -- 0:00:43
243500 -- [-760.132] (-763.929) (-758.506) (-762.007) * (-758.506) [-758.880] (-761.314) (-762.710) -- 0:00:43
244000 -- [-758.231] (-760.618) (-762.341) (-764.049) * (-758.801) (-760.539) [-759.230] (-761.326) -- 0:00:43
244500 -- (-759.081) (-759.064) (-759.717) [-760.865] * [-759.610] (-760.954) (-758.663) (-759.280) -- 0:00:43
245000 -- (-758.257) (-759.317) (-760.451) [-758.268] * (-759.246) (-757.840) [-758.010] (-760.284) -- 0:00:43
Average standard deviation of split frequencies: 0.015809
245500 -- (-759.674) [-758.881] (-761.819) (-758.288) * [-759.887] (-759.830) (-760.088) (-759.628) -- 0:00:43
246000 -- (-759.287) (-761.274) [-760.500] (-757.722) * (-762.275) (-762.140) (-761.341) [-761.900] -- 0:00:42
246500 -- (-762.736) (-759.039) (-762.707) [-761.280] * (-759.070) (-760.148) [-763.936] (-764.798) -- 0:00:42
247000 -- [-760.964] (-758.537) (-762.406) (-760.600) * (-759.908) [-762.354] (-763.703) (-760.958) -- 0:00:42
247500 -- (-763.195) [-758.856] (-761.362) (-760.385) * [-758.578] (-760.490) (-762.780) (-759.678) -- 0:00:42
248000 -- (-763.341) (-760.306) [-758.405] (-761.975) * (-764.633) [-760.929] (-761.803) (-758.762) -- 0:00:42
248500 -- (-758.310) [-763.998] (-758.666) (-761.258) * (-759.633) (-759.312) (-758.936) [-759.057] -- 0:00:42
249000 -- (-760.579) [-759.490] (-758.062) (-761.407) * (-758.741) (-760.816) (-762.759) [-760.996] -- 0:00:42
249500 -- [-762.418] (-761.233) (-758.367) (-760.739) * [-759.365] (-760.343) (-761.770) (-761.021) -- 0:00:42
250000 -- [-762.686] (-764.127) (-758.710) (-762.652) * (-763.157) (-759.937) [-760.807] (-758.439) -- 0:00:42
Average standard deviation of split frequencies: 0.016808
250500 -- (-762.075) [-762.190] (-758.993) (-758.984) * (-759.706) (-760.469) (-758.521) [-763.109] -- 0:00:44
251000 -- [-757.983] (-760.260) (-761.824) (-759.244) * (-761.210) (-758.323) [-760.417] (-759.238) -- 0:00:44
251500 -- (-758.424) (-761.991) [-758.927] (-760.746) * (-758.143) (-758.260) (-760.623) [-760.237] -- 0:00:44
252000 -- (-759.026) [-759.009] (-759.649) (-758.299) * (-758.850) (-760.884) [-761.027] (-759.733) -- 0:00:44
252500 -- (-757.612) (-761.524) (-761.462) [-758.172] * (-759.953) (-758.511) (-760.634) [-758.110] -- 0:00:44
253000 -- (-759.363) (-758.919) [-761.427] (-758.356) * (-759.092) (-759.869) [-762.413] (-758.480) -- 0:00:44
253500 -- (-760.193) [-757.794] (-761.921) (-761.175) * (-761.693) [-758.917] (-762.256) (-758.314) -- 0:00:44
254000 -- (-760.883) (-757.984) (-760.028) [-759.775] * (-760.307) [-762.484] (-758.678) (-758.743) -- 0:00:44
254500 -- (-758.360) (-762.754) (-759.440) [-760.311] * [-758.466] (-760.602) (-758.820) (-758.974) -- 0:00:43
255000 -- [-761.335] (-758.113) (-759.166) (-760.277) * (-757.713) (-759.184) [-761.228] (-758.694) -- 0:00:43
Average standard deviation of split frequencies: 0.016688
255500 -- [-759.259] (-758.196) (-761.697) (-766.386) * (-760.528) (-759.901) [-759.382] (-759.433) -- 0:00:43
256000 -- [-763.707] (-759.641) (-761.809) (-762.284) * (-761.860) (-758.681) [-757.876] (-760.579) -- 0:00:43
256500 -- [-759.698] (-760.296) (-763.825) (-759.595) * (-760.166) (-758.222) [-757.770] (-761.615) -- 0:00:43
257000 -- [-759.844] (-762.217) (-761.244) (-759.585) * [-761.414] (-759.337) (-759.085) (-760.169) -- 0:00:43
257500 -- (-759.961) (-763.755) [-758.787] (-762.848) * (-758.319) (-760.384) (-757.815) [-757.898] -- 0:00:43
258000 -- (-760.385) (-760.813) [-761.762] (-761.675) * (-760.133) (-758.907) [-759.735] (-758.070) -- 0:00:43
258500 -- (-760.133) (-760.030) [-762.841] (-761.322) * (-758.160) (-759.202) (-758.443) [-758.234] -- 0:00:43
259000 -- (-760.090) (-758.868) [-758.716] (-759.529) * [-758.852] (-759.952) (-758.982) (-760.772) -- 0:00:42
259500 -- (-759.675) [-758.604] (-760.964) (-761.384) * (-760.921) (-758.464) [-758.725] (-758.616) -- 0:00:42
260000 -- (-761.032) (-764.445) [-758.268] (-761.796) * [-760.481] (-760.459) (-760.232) (-759.158) -- 0:00:42
Average standard deviation of split frequencies: 0.016954
260500 -- [-760.276] (-761.581) (-759.999) (-758.608) * (-764.518) (-760.682) [-760.015] (-761.142) -- 0:00:42
261000 -- [-759.646] (-762.937) (-762.995) (-766.441) * (-759.597) (-759.468) [-758.145] (-761.403) -- 0:00:42
261500 -- [-762.152] (-760.248) (-760.222) (-761.697) * (-761.754) (-759.550) [-759.342] (-758.988) -- 0:00:42
262000 -- (-760.593) [-758.102] (-761.083) (-764.567) * (-759.743) (-762.264) (-759.657) [-759.900] -- 0:00:42
262500 -- (-761.116) [-758.835] (-758.806) (-758.943) * (-760.008) [-761.765] (-761.430) (-761.090) -- 0:00:42
263000 -- (-763.120) (-757.853) [-762.980] (-760.180) * [-760.579] (-761.393) (-765.269) (-760.939) -- 0:00:42
263500 -- [-758.951] (-762.077) (-761.144) (-762.276) * (-763.262) [-759.143] (-764.480) (-759.926) -- 0:00:41
264000 -- (-760.299) [-760.536] (-759.109) (-759.996) * (-760.507) (-764.115) [-764.446] (-760.557) -- 0:00:41
264500 -- (-758.374) (-761.143) [-758.226] (-766.459) * (-760.419) (-761.850) [-760.344] (-761.233) -- 0:00:41
265000 -- (-762.265) (-759.887) [-758.662] (-761.960) * (-759.605) (-762.310) [-761.037] (-761.710) -- 0:00:41
Average standard deviation of split frequencies: 0.015324
265500 -- [-760.229] (-758.838) (-758.662) (-759.642) * (-759.291) [-762.271] (-760.153) (-761.742) -- 0:00:41
266000 -- (-763.177) (-758.004) [-759.379] (-759.197) * (-761.454) (-761.090) [-759.392] (-760.790) -- 0:00:41
266500 -- (-762.220) (-760.932) (-758.620) [-758.295] * (-761.706) [-759.108] (-761.738) (-760.886) -- 0:00:41
267000 -- (-760.184) [-760.343] (-758.320) (-758.467) * [-758.933] (-758.578) (-761.123) (-759.691) -- 0:00:43
267500 -- [-761.308] (-760.723) (-758.362) (-761.456) * [-758.884] (-758.277) (-760.523) (-761.444) -- 0:00:43
268000 -- (-762.111) (-759.178) (-759.785) [-760.680] * [-758.959] (-763.062) (-764.151) (-762.142) -- 0:00:43
268500 -- (-760.105) (-759.402) [-759.346] (-758.138) * (-761.756) [-761.072] (-759.719) (-760.913) -- 0:00:43
269000 -- [-759.253] (-760.373) (-762.129) (-758.619) * [-759.912] (-759.004) (-760.439) (-760.428) -- 0:00:43
269500 -- [-763.030] (-761.012) (-761.175) (-758.547) * (-762.673) [-763.132] (-762.237) (-760.561) -- 0:00:43
270000 -- (-758.279) (-763.271) (-761.205) [-759.608] * (-758.820) (-760.459) [-758.529] (-757.697) -- 0:00:43
Average standard deviation of split frequencies: 0.016219
270500 -- (-759.524) (-759.665) (-758.959) [-759.959] * (-759.159) (-760.800) [-758.563] (-758.334) -- 0:00:43
271000 -- (-759.271) (-759.079) (-758.027) [-759.403] * (-761.481) (-759.945) [-758.592] (-760.068) -- 0:00:43
271500 -- (-759.420) [-759.497] (-764.629) (-762.370) * (-763.831) [-763.228] (-758.887) (-759.889) -- 0:00:42
272000 -- (-761.419) [-760.310] (-760.494) (-761.092) * (-760.726) (-760.866) [-758.379] (-758.904) -- 0:00:42
272500 -- (-762.213) [-759.557] (-761.786) (-759.550) * (-761.963) [-760.600] (-761.949) (-758.763) -- 0:00:42
273000 -- (-758.973) (-759.590) [-761.523] (-763.639) * [-760.213] (-759.100) (-758.913) (-758.718) -- 0:00:42
273500 -- (-759.203) (-759.657) (-762.482) [-758.726] * (-759.499) (-758.177) (-759.730) [-760.094] -- 0:00:42
274000 -- (-766.423) [-759.228] (-762.793) (-760.706) * (-759.823) [-757.727] (-758.681) (-759.801) -- 0:00:42
274500 -- (-760.228) [-760.305] (-762.927) (-760.934) * (-758.667) [-757.573] (-760.025) (-762.255) -- 0:00:42
275000 -- (-759.151) (-758.689) [-760.507] (-762.780) * [-758.053] (-758.509) (-760.613) (-759.314) -- 0:00:42
Average standard deviation of split frequencies: 0.015585
275500 -- (-760.878) (-761.279) (-762.800) [-757.799] * (-758.012) (-757.897) (-760.887) [-759.747] -- 0:00:42
276000 -- (-760.470) (-759.092) (-765.983) [-760.030] * (-760.136) (-759.372) [-759.234] (-760.409) -- 0:00:41
276500 -- [-758.054] (-759.152) (-758.197) (-758.079) * (-761.455) (-758.035) (-758.731) [-758.698] -- 0:00:41
277000 -- (-761.460) (-761.288) (-759.568) [-759.317] * [-759.942] (-758.702) (-760.500) (-765.268) -- 0:00:41
277500 -- (-761.712) (-762.357) (-762.330) [-758.770] * [-758.294] (-760.504) (-759.232) (-761.968) -- 0:00:41
278000 -- (-766.007) (-759.958) [-760.092] (-759.405) * (-761.661) [-759.145] (-759.095) (-761.136) -- 0:00:41
278500 -- (-760.720) [-760.537] (-760.181) (-759.840) * (-758.959) (-760.204) [-761.057] (-760.063) -- 0:00:41
279000 -- (-761.419) [-758.564] (-761.179) (-760.180) * (-761.293) (-762.326) (-760.461) [-760.827] -- 0:00:41
279500 -- [-759.421] (-760.633) (-759.702) (-757.884) * (-758.443) (-758.688) [-763.339] (-760.035) -- 0:00:41
280000 -- (-759.384) (-760.919) [-758.364] (-758.767) * (-758.255) (-760.028) (-765.965) [-760.022] -- 0:00:41
Average standard deviation of split frequencies: 0.015326
280500 -- [-757.861] (-760.202) (-759.717) (-760.026) * (-759.490) (-761.526) [-764.819] (-758.225) -- 0:00:41
281000 -- [-758.259] (-761.668) (-757.870) (-761.608) * [-760.637] (-759.668) (-764.211) (-758.503) -- 0:00:40
281500 -- (-759.583) (-761.779) [-760.247] (-760.392) * [-763.577] (-761.559) (-760.085) (-757.828) -- 0:00:40
282000 -- (-760.692) (-762.113) (-760.111) [-758.744] * [-764.508] (-760.266) (-758.272) (-757.876) -- 0:00:40
282500 -- [-761.649] (-762.201) (-762.093) (-759.455) * (-759.313) (-760.071) [-759.045] (-760.919) -- 0:00:40
283000 -- (-758.290) (-764.952) [-762.222] (-761.981) * [-758.181] (-759.277) (-758.732) (-758.385) -- 0:00:40
283500 -- [-757.808] (-759.063) (-759.487) (-759.866) * (-758.415) [-757.970] (-758.917) (-759.495) -- 0:00:40
284000 -- [-757.933] (-759.072) (-759.941) (-758.657) * (-761.187) [-758.980] (-758.657) (-758.658) -- 0:00:42
284500 -- [-758.264] (-758.178) (-759.163) (-759.579) * (-763.081) (-760.068) [-759.023] (-761.160) -- 0:00:42
285000 -- (-759.921) [-759.909] (-760.916) (-759.455) * [-758.913] (-759.077) (-763.959) (-759.581) -- 0:00:42
Average standard deviation of split frequencies: 0.015453
285500 -- [-759.193] (-759.361) (-758.147) (-760.095) * (-758.434) [-758.871] (-764.518) (-762.939) -- 0:00:42
286000 -- (-764.472) (-759.194) [-757.862] (-759.084) * [-759.608] (-758.998) (-766.374) (-760.435) -- 0:00:42
286500 -- [-763.319] (-758.852) (-758.730) (-762.797) * (-758.028) [-759.209] (-760.102) (-759.803) -- 0:00:42
287000 -- (-764.052) (-759.059) (-761.913) [-759.942] * (-758.754) (-758.407) [-759.964] (-766.958) -- 0:00:42
287500 -- (-760.290) (-759.333) (-758.956) [-759.262] * (-761.032) (-758.662) (-761.546) [-762.341] -- 0:00:42
288000 -- [-760.705] (-759.419) (-762.653) (-760.182) * (-760.635) (-758.688) (-759.540) [-761.739] -- 0:00:42
288500 -- (-759.263) (-758.573) [-759.969] (-762.538) * [-759.072] (-759.481) (-761.443) (-758.840) -- 0:00:41
289000 -- [-762.806] (-759.629) (-759.543) (-759.715) * (-762.217) (-758.078) [-763.109] (-759.323) -- 0:00:41
289500 -- [-764.737] (-758.252) (-758.946) (-761.953) * (-759.269) (-759.268) [-758.344] (-759.197) -- 0:00:41
290000 -- (-764.429) (-760.808) [-760.391] (-758.853) * [-759.737] (-758.893) (-761.455) (-759.250) -- 0:00:41
Average standard deviation of split frequencies: 0.017333
290500 -- (-759.847) (-761.482) [-761.168] (-758.765) * (-758.356) (-759.017) (-767.046) [-758.256] -- 0:00:41
291000 -- (-760.025) (-760.358) (-760.728) [-759.190] * (-761.096) [-759.156] (-761.591) (-759.657) -- 0:00:41
291500 -- (-761.768) (-760.025) [-758.938] (-761.459) * (-759.924) (-759.983) [-760.410] (-761.820) -- 0:00:41
292000 -- [-759.832] (-758.806) (-758.902) (-763.070) * (-760.703) [-759.732] (-758.213) (-759.876) -- 0:00:41
292500 -- (-761.233) [-760.916] (-760.692) (-761.026) * [-762.367] (-759.811) (-759.391) (-761.008) -- 0:00:41
293000 -- [-761.499] (-760.217) (-760.293) (-760.818) * [-760.874] (-761.079) (-758.790) (-758.683) -- 0:00:41
293500 -- (-761.050) [-760.285] (-759.765) (-760.231) * (-758.265) (-759.511) (-760.712) [-760.710] -- 0:00:40
294000 -- (-759.227) [-759.496] (-759.993) (-760.183) * (-760.260) [-761.836] (-760.481) (-758.211) -- 0:00:40
294500 -- (-758.776) (-759.124) (-758.521) [-759.735] * (-759.658) (-759.718) (-759.058) [-758.719] -- 0:00:40
295000 -- (-762.068) (-759.294) [-759.179] (-761.420) * [-759.732] (-759.528) (-762.809) (-759.219) -- 0:00:40
Average standard deviation of split frequencies: 0.016488
295500 -- (-760.223) (-763.908) (-757.648) [-761.235] * [-762.161] (-759.816) (-760.842) (-757.840) -- 0:00:40
296000 -- (-757.669) (-758.329) (-757.972) [-759.174] * (-759.679) (-761.714) (-759.544) [-759.670] -- 0:00:40
296500 -- (-758.684) (-759.015) [-762.018] (-758.276) * (-766.491) [-758.610] (-760.380) (-759.043) -- 0:00:40
297000 -- (-759.095) (-759.759) [-760.001] (-759.235) * (-758.508) [-759.642] (-759.604) (-760.341) -- 0:00:40
297500 -- (-760.188) (-760.139) (-762.993) [-759.181] * [-759.152] (-758.924) (-760.237) (-760.104) -- 0:00:40
298000 -- (-762.339) (-759.440) [-759.035] (-764.412) * (-760.652) [-758.605] (-760.981) (-759.434) -- 0:00:40
298500 -- (-758.328) [-761.030] (-758.210) (-761.232) * [-758.472] (-760.163) (-763.160) (-760.549) -- 0:00:39
299000 -- [-759.027] (-762.499) (-761.486) (-758.103) * (-758.410) (-760.886) [-760.723] (-760.389) -- 0:00:39
299500 -- (-758.945) (-761.574) [-759.954] (-758.161) * (-760.282) [-759.704] (-760.668) (-761.449) -- 0:00:39
300000 -- (-758.523) (-760.912) (-760.623) [-759.319] * (-759.505) [-758.233] (-758.937) (-758.561) -- 0:00:39
Average standard deviation of split frequencies: 0.015189
300500 -- (-761.888) (-762.169) [-760.151] (-761.818) * (-760.908) (-759.971) [-759.185] (-759.414) -- 0:00:41
301000 -- (-759.091) [-761.934] (-760.658) (-761.801) * (-759.893) (-758.841) (-758.686) [-759.627] -- 0:00:41
301500 -- (-758.962) [-758.290] (-757.872) (-760.701) * [-759.888] (-758.337) (-759.688) (-760.938) -- 0:00:41
302000 -- [-759.497] (-759.647) (-757.870) (-761.350) * (-765.189) [-760.147] (-759.368) (-761.789) -- 0:00:41
302500 -- (-762.388) (-761.080) [-758.392] (-762.135) * (-767.958) [-760.740] (-760.740) (-762.424) -- 0:00:41
303000 -- (-761.885) [-759.341] (-759.827) (-758.716) * (-765.006) (-760.122) [-759.966] (-760.888) -- 0:00:41
303500 -- [-761.586] (-759.142) (-761.752) (-760.050) * (-762.512) (-761.667) [-764.853] (-761.296) -- 0:00:41
304000 -- [-765.306] (-758.685) (-759.263) (-759.075) * [-759.078] (-761.182) (-761.365) (-759.664) -- 0:00:41
304500 -- [-761.817] (-760.661) (-758.783) (-759.440) * (-760.603) (-761.103) (-762.097) [-760.961] -- 0:00:41
305000 -- (-759.565) (-762.358) (-762.636) [-759.211] * [-761.601] (-759.823) (-759.103) (-760.541) -- 0:00:41
Average standard deviation of split frequencies: 0.014828
305500 -- (-759.418) (-761.175) [-763.099] (-758.078) * (-759.280) (-759.837) [-761.505] (-760.858) -- 0:00:40
306000 -- (-759.413) (-758.960) [-761.316] (-759.124) * (-758.753) (-761.624) [-762.269] (-762.802) -- 0:00:40
306500 -- (-762.163) (-759.116) (-762.062) [-758.314] * (-763.170) (-759.095) (-760.697) [-765.101] -- 0:00:40
307000 -- [-759.608] (-759.550) (-757.796) (-761.269) * (-758.739) [-758.659] (-758.795) (-764.633) -- 0:00:40
307500 -- (-763.756) (-760.267) (-760.163) [-762.084] * (-760.046) (-758.504) [-760.124] (-759.988) -- 0:00:40
308000 -- (-759.472) (-761.123) (-760.124) [-762.307] * (-758.761) (-762.832) (-760.957) [-761.401] -- 0:00:40
308500 -- (-758.510) (-759.975) [-759.256] (-761.435) * (-767.017) (-763.064) (-760.559) [-758.766] -- 0:00:40
309000 -- [-761.907] (-759.384) (-760.241) (-761.518) * [-759.964] (-759.538) (-760.553) (-759.779) -- 0:00:40
309500 -- [-757.897] (-759.424) (-763.959) (-760.581) * (-759.850) (-760.486) [-760.108] (-760.902) -- 0:00:40
310000 -- [-759.701] (-759.275) (-761.541) (-758.134) * (-759.775) (-761.016) [-762.384] (-760.932) -- 0:00:40
Average standard deviation of split frequencies: 0.016156
310500 -- (-760.447) [-760.408] (-760.132) (-760.107) * (-760.013) (-762.840) [-760.931] (-758.283) -- 0:00:39
311000 -- (-759.371) [-761.391] (-760.161) (-759.171) * (-758.094) [-763.061] (-758.640) (-760.185) -- 0:00:39
311500 -- (-760.331) (-759.034) (-759.251) [-760.550] * (-760.124) [-760.451] (-758.403) (-759.094) -- 0:00:39
312000 -- (-761.660) (-757.825) (-764.994) [-759.002] * [-758.835] (-763.740) (-759.554) (-760.814) -- 0:00:39
312500 -- [-760.807] (-760.696) (-759.594) (-759.084) * (-760.875) (-760.975) [-759.611] (-759.018) -- 0:00:39
313000 -- [-759.255] (-759.060) (-759.484) (-759.867) * (-764.796) (-759.590) (-761.358) [-758.642] -- 0:00:39
313500 -- [-758.296] (-761.011) (-761.897) (-761.981) * (-765.866) [-760.648] (-759.849) (-759.831) -- 0:00:39
314000 -- [-758.865] (-759.874) (-758.476) (-762.882) * (-760.937) (-759.540) [-760.169] (-765.026) -- 0:00:39
314500 -- [-759.258] (-759.970) (-759.023) (-759.980) * (-758.845) (-759.633) (-758.721) [-759.751] -- 0:00:39
315000 -- (-760.489) (-760.247) (-758.393) [-759.709] * (-758.563) (-761.012) [-759.441] (-765.389) -- 0:00:39
Average standard deviation of split frequencies: 0.014338
315500 -- (-763.868) [-762.562] (-765.491) (-761.515) * [-758.705] (-758.166) (-760.882) (-763.933) -- 0:00:39
316000 -- (-759.536) [-762.178] (-760.732) (-763.193) * [-760.502] (-759.198) (-765.307) (-760.655) -- 0:00:38
316500 -- [-758.354] (-759.333) (-759.141) (-763.989) * (-758.836) [-761.215] (-760.718) (-760.794) -- 0:00:38
317000 -- (-759.058) [-758.898] (-759.292) (-762.230) * (-759.298) (-761.222) [-761.641] (-762.125) -- 0:00:38
317500 -- (-763.705) (-759.818) [-758.124] (-760.126) * [-758.452] (-762.874) (-759.995) (-775.644) -- 0:00:40
318000 -- [-758.876] (-759.504) (-758.049) (-760.265) * [-758.453] (-759.477) (-762.538) (-767.496) -- 0:00:40
318500 -- (-760.695) [-760.429] (-759.569) (-758.680) * (-761.237) (-760.634) (-759.030) [-761.121] -- 0:00:40
319000 -- (-762.054) (-757.848) [-761.010] (-764.127) * (-760.894) (-760.098) [-760.914] (-759.349) -- 0:00:40
319500 -- (-763.724) (-761.543) (-760.745) [-762.891] * (-760.402) (-758.300) [-758.114] (-759.389) -- 0:00:40
320000 -- (-762.853) [-757.640] (-759.515) (-760.815) * [-760.738] (-761.005) (-761.893) (-758.804) -- 0:00:40
Average standard deviation of split frequencies: 0.013577
320500 -- (-762.570) (-757.759) [-760.850] (-759.289) * (-765.234) (-760.586) (-759.843) [-760.294] -- 0:00:40
321000 -- [-760.559] (-759.012) (-759.823) (-758.540) * (-762.553) (-759.720) (-765.961) [-759.554] -- 0:00:40
321500 -- (-759.182) (-759.866) (-762.102) [-759.043] * (-761.068) (-760.580) [-760.860] (-760.215) -- 0:00:40
322000 -- (-761.972) [-758.705] (-767.265) (-758.538) * (-766.144) (-765.716) (-768.671) [-759.891] -- 0:00:40
322500 -- (-757.896) (-758.848) [-760.935] (-758.997) * (-762.633) (-762.797) (-758.632) [-759.039] -- 0:00:39
323000 -- (-763.995) (-758.848) [-758.295] (-759.231) * (-761.636) (-761.589) [-757.826] (-761.583) -- 0:00:39
323500 -- (-764.387) (-758.714) (-760.470) [-758.426] * [-761.088] (-759.762) (-765.035) (-761.536) -- 0:00:39
324000 -- [-758.837] (-759.217) (-760.149) (-758.507) * [-761.209] (-759.207) (-759.515) (-760.750) -- 0:00:39
324500 -- (-760.907) (-759.722) [-760.308] (-762.155) * [-763.046] (-762.245) (-758.301) (-760.488) -- 0:00:39
325000 -- [-761.226] (-759.618) (-758.802) (-761.836) * (-760.661) [-761.140] (-758.800) (-758.445) -- 0:00:39
Average standard deviation of split frequencies: 0.013095
325500 -- (-758.360) [-761.606] (-758.610) (-761.820) * (-761.713) (-760.700) [-758.172] (-758.351) -- 0:00:39
326000 -- (-758.904) (-760.192) [-758.881] (-761.078) * (-758.064) [-758.990] (-758.993) (-762.400) -- 0:00:39
326500 -- [-758.790] (-760.384) (-761.728) (-760.676) * (-758.209) (-759.439) (-759.555) [-761.989] -- 0:00:39
327000 -- [-758.438] (-761.305) (-760.963) (-762.889) * (-758.551) (-759.438) (-761.588) [-761.570] -- 0:00:39
327500 -- (-760.051) (-762.499) (-761.423) [-758.920] * (-759.150) (-760.115) [-757.776] (-759.893) -- 0:00:39
328000 -- (-759.671) [-757.924] (-759.241) (-759.830) * (-760.613) (-761.398) [-758.320] (-759.506) -- 0:00:38
328500 -- (-758.594) [-760.107] (-758.608) (-759.720) * [-757.998] (-760.772) (-759.453) (-759.970) -- 0:00:38
329000 -- (-761.893) (-758.841) [-758.170] (-760.088) * (-758.104) (-760.136) [-761.494] (-760.799) -- 0:00:38
329500 -- (-762.355) (-761.882) (-758.024) [-758.037] * (-759.437) (-762.348) [-759.228] (-760.290) -- 0:00:38
330000 -- (-759.787) [-760.043] (-760.943) (-759.915) * (-760.490) (-767.879) (-762.482) [-765.431] -- 0:00:38
Average standard deviation of split frequencies: 0.012672
330500 -- (-758.394) [-760.193] (-761.289) (-760.320) * (-762.989) (-764.855) [-758.642] (-761.337) -- 0:00:38
331000 -- [-760.645] (-757.941) (-758.255) (-758.905) * (-760.806) [-762.371] (-760.433) (-763.364) -- 0:00:38
331500 -- (-761.168) (-758.207) [-765.095] (-759.765) * (-758.061) [-764.694] (-762.029) (-758.759) -- 0:00:38
332000 -- (-759.176) [-757.995] (-763.591) (-759.382) * (-760.497) (-762.125) [-761.544] (-763.909) -- 0:00:38
332500 -- (-760.959) (-760.597) [-758.996] (-759.192) * (-760.488) (-759.637) [-761.038] (-758.907) -- 0:00:38
333000 -- (-759.375) [-759.646] (-758.781) (-759.417) * [-758.137] (-758.561) (-759.675) (-761.698) -- 0:00:38
333500 -- (-759.790) (-758.649) [-758.802] (-763.859) * (-761.154) (-758.488) (-759.032) [-760.770] -- 0:00:37
334000 -- (-758.216) [-761.167] (-759.155) (-763.312) * (-758.255) (-761.239) (-763.009) [-761.014] -- 0:00:39
334500 -- (-758.100) (-760.657) (-760.569) [-761.598] * [-758.310] (-761.732) (-759.213) (-762.903) -- 0:00:39
335000 -- (-758.505) (-759.932) [-761.986] (-761.054) * (-758.348) (-763.188) (-761.352) [-760.813] -- 0:00:39
Average standard deviation of split frequencies: 0.014731
335500 -- [-758.633] (-758.436) (-761.988) (-759.987) * [-759.291] (-758.285) (-758.488) (-758.189) -- 0:00:39
336000 -- (-758.416) (-758.362) [-759.946] (-762.198) * (-759.050) (-760.975) (-762.123) [-758.447] -- 0:00:39
336500 -- (-760.843) [-759.385] (-761.658) (-759.282) * (-763.985) (-760.339) [-760.179] (-758.709) -- 0:00:39
337000 -- (-760.231) (-760.159) [-761.685] (-760.886) * [-759.743] (-758.626) (-760.698) (-759.479) -- 0:00:39
337500 -- (-759.097) (-759.778) [-759.711] (-759.389) * (-761.322) (-761.896) (-761.340) [-760.457] -- 0:00:39
338000 -- [-758.309] (-763.599) (-759.704) (-760.094) * [-761.000] (-760.925) (-760.273) (-758.824) -- 0:00:39
338500 -- (-760.863) (-759.801) [-758.055] (-759.907) * [-759.345] (-758.125) (-761.256) (-758.397) -- 0:00:39
339000 -- (-758.804) (-765.161) [-758.440] (-760.000) * (-757.921) [-759.500] (-759.228) (-757.966) -- 0:00:38
339500 -- (-757.607) (-761.646) [-758.734] (-758.654) * (-758.204) (-760.128) [-758.066] (-757.962) -- 0:00:38
340000 -- (-762.969) [-761.456] (-759.081) (-760.563) * (-759.287) (-758.625) [-760.093] (-759.926) -- 0:00:38
Average standard deviation of split frequencies: 0.014407
340500 -- (-762.827) (-758.651) [-759.239] (-760.327) * [-759.567] (-761.869) (-759.512) (-769.118) -- 0:00:38
341000 -- [-758.097] (-765.405) (-759.021) (-760.403) * [-758.512] (-760.395) (-759.115) (-762.290) -- 0:00:38
341500 -- (-759.758) (-759.270) (-758.954) [-761.391] * [-760.917] (-764.847) (-760.169) (-762.178) -- 0:00:38
342000 -- (-757.971) (-760.752) (-761.231) [-758.555] * (-762.222) [-759.693] (-759.418) (-760.106) -- 0:00:38
342500 -- (-758.386) [-761.349] (-763.914) (-762.503) * [-758.402] (-760.122) (-760.903) (-762.369) -- 0:00:38
343000 -- (-760.142) (-759.812) [-760.930] (-761.055) * (-759.061) (-760.271) [-759.573] (-761.090) -- 0:00:38
343500 -- [-759.737] (-765.921) (-762.255) (-764.419) * (-759.888) [-758.933] (-759.219) (-759.189) -- 0:00:38
344000 -- (-762.887) (-760.307) [-758.251] (-758.218) * [-759.440] (-760.615) (-760.697) (-760.228) -- 0:00:38
344500 -- [-759.998] (-759.811) (-760.846) (-758.010) * (-759.877) (-759.424) (-759.466) [-763.693] -- 0:00:38
345000 -- (-759.362) (-761.217) [-759.121] (-758.806) * (-758.530) (-761.765) (-758.256) [-758.403] -- 0:00:37
Average standard deviation of split frequencies: 0.015138
345500 -- (-763.717) (-760.393) [-760.545] (-759.248) * (-762.311) [-760.012] (-759.179) (-759.063) -- 0:00:37
346000 -- (-761.068) (-762.037) (-762.453) [-759.261] * (-761.179) (-761.421) (-759.514) [-764.670] -- 0:00:37
346500 -- (-761.261) (-764.552) (-759.597) [-760.754] * (-763.058) (-760.044) [-761.089] (-760.185) -- 0:00:37
347000 -- (-759.153) (-759.310) (-759.525) [-761.993] * (-759.130) [-761.336] (-762.894) (-760.077) -- 0:00:37
347500 -- [-759.176] (-759.176) (-762.895) (-763.806) * (-759.935) (-759.096) (-760.640) [-763.404] -- 0:00:37
348000 -- [-758.958] (-758.938) (-760.664) (-758.568) * [-759.436] (-759.803) (-759.137) (-760.213) -- 0:00:37
348500 -- (-758.451) [-758.775] (-760.019) (-758.155) * (-761.226) [-761.414] (-764.908) (-758.077) -- 0:00:37
349000 -- (-761.380) (-759.164) (-765.217) [-759.054] * (-758.520) [-760.609] (-763.559) (-759.953) -- 0:00:37
349500 -- (-762.656) [-759.688] (-764.162) (-759.152) * (-758.514) (-759.631) (-761.583) [-757.954] -- 0:00:37
350000 -- (-761.698) (-764.840) (-762.041) [-759.817] * [-759.697] (-758.602) (-759.285) (-759.401) -- 0:00:39
Average standard deviation of split frequencies: 0.013779
350500 -- (-764.323) (-758.845) [-760.157] (-761.759) * (-759.288) (-759.984) [-760.002] (-762.276) -- 0:00:38
351000 -- (-762.436) [-759.568] (-760.920) (-760.800) * (-760.483) [-763.135] (-759.510) (-761.132) -- 0:00:38
351500 -- (-759.383) (-761.682) (-761.683) [-758.345] * (-757.909) (-758.878) (-760.851) [-759.255] -- 0:00:38
352000 -- (-765.404) (-758.592) (-762.078) [-759.881] * (-759.361) (-759.087) [-760.930] (-759.574) -- 0:00:38
352500 -- [-761.834] (-759.037) (-759.373) (-758.139) * (-760.326) (-761.039) (-762.067) [-758.087] -- 0:00:38
353000 -- (-758.076) (-765.293) (-758.080) [-761.925] * (-761.791) [-762.833] (-760.966) (-759.770) -- 0:00:38
353500 -- (-758.301) [-761.089] (-759.206) (-761.573) * (-759.386) (-760.190) [-760.459] (-759.752) -- 0:00:38
354000 -- (-760.066) (-759.511) [-758.692] (-759.853) * (-759.548) [-761.151] (-759.895) (-758.437) -- 0:00:38
354500 -- (-759.765) (-758.443) [-757.822] (-759.969) * (-759.896) (-759.919) [-760.094] (-759.208) -- 0:00:38
355000 -- (-761.712) [-761.588] (-758.343) (-760.005) * (-759.590) (-759.478) [-757.996] (-759.174) -- 0:00:38
Average standard deviation of split frequencies: 0.012889
355500 -- (-760.920) (-761.126) [-760.025] (-760.229) * (-762.457) (-759.587) [-760.090] (-759.902) -- 0:00:38
356000 -- (-761.221) (-772.333) (-760.544) [-757.470] * [-758.343] (-759.546) (-759.386) (-758.034) -- 0:00:37
356500 -- (-760.708) (-760.792) [-759.601] (-757.804) * (-763.299) (-760.172) (-759.513) [-758.135] -- 0:00:37
357000 -- (-760.598) [-762.451] (-760.029) (-759.725) * (-759.625) (-760.524) (-759.493) [-758.860] -- 0:00:37
357500 -- (-761.406) (-764.943) (-760.632) [-761.802] * [-761.050] (-760.822) (-759.845) (-759.069) -- 0:00:37
358000 -- [-761.683] (-760.421) (-762.372) (-758.919) * (-761.638) [-759.610] (-761.504) (-759.023) -- 0:00:37
358500 -- (-760.411) (-760.135) [-758.420] (-757.974) * (-758.759) [-759.393] (-759.174) (-761.167) -- 0:00:37
359000 -- (-758.696) (-761.115) (-760.994) [-759.029] * [-761.615] (-760.946) (-757.898) (-761.632) -- 0:00:37
359500 -- (-759.718) (-761.188) [-758.637] (-758.767) * [-761.050] (-759.910) (-760.302) (-762.302) -- 0:00:37
360000 -- (-763.774) [-760.819] (-763.657) (-759.490) * (-758.887) (-757.851) [-760.895] (-765.794) -- 0:00:37
Average standard deviation of split frequencies: 0.013070
360500 -- (-760.748) (-757.955) [-760.781] (-760.277) * (-758.765) [-757.908] (-765.377) (-760.838) -- 0:00:37
361000 -- (-758.511) (-759.915) (-758.381) [-759.202] * (-760.505) (-762.990) (-766.687) [-762.840] -- 0:00:37
361500 -- (-758.036) [-757.777] (-760.472) (-758.783) * (-758.194) (-768.921) (-765.649) [-760.170] -- 0:00:37
362000 -- [-759.008] (-758.248) (-760.632) (-760.765) * (-760.057) [-759.918] (-761.081) (-760.184) -- 0:00:37
362500 -- (-761.491) (-758.440) (-762.603) [-759.225] * (-761.742) (-761.257) (-762.471) [-758.422] -- 0:00:36
363000 -- (-758.954) (-758.142) [-761.657] (-758.201) * [-759.204] (-758.297) (-763.129) (-759.577) -- 0:00:36
363500 -- (-759.273) (-760.247) (-759.007) [-761.621] * (-761.046) (-758.197) (-761.504) [-759.950] -- 0:00:36
364000 -- (-760.526) (-759.738) (-761.168) [-762.890] * (-758.733) (-759.436) [-759.090] (-762.302) -- 0:00:36
364500 -- (-759.764) [-760.342] (-762.322) (-760.349) * (-760.502) (-760.007) (-757.990) [-762.461] -- 0:00:36
365000 -- [-758.398] (-762.536) (-758.409) (-760.457) * (-762.931) (-762.056) (-757.903) [-759.259] -- 0:00:36
Average standard deviation of split frequencies: 0.012880
365500 -- [-759.305] (-762.569) (-759.802) (-758.877) * (-760.480) (-759.446) [-760.342] (-763.090) -- 0:00:36
366000 -- (-760.725) (-759.885) [-761.637] (-760.600) * (-759.421) (-761.295) (-762.526) [-759.518] -- 0:00:38
366500 -- (-758.907) (-760.896) (-762.026) [-759.741] * [-759.192] (-760.275) (-760.763) (-758.609) -- 0:00:38
367000 -- (-759.925) (-763.755) (-762.972) [-762.712] * [-759.784] (-760.015) (-761.910) (-759.879) -- 0:00:37
367500 -- [-758.511] (-759.500) (-761.682) (-759.987) * (-762.837) (-759.486) (-761.308) [-760.206] -- 0:00:37
368000 -- (-759.359) (-758.843) (-760.374) [-760.854] * (-762.554) [-758.352] (-758.586) (-759.131) -- 0:00:37
368500 -- (-760.053) (-759.607) [-759.330] (-760.686) * (-765.612) (-759.711) [-759.091] (-759.821) -- 0:00:37
369000 -- (-757.831) (-760.655) (-760.387) [-760.184] * (-761.614) (-759.868) (-760.323) [-759.858] -- 0:00:37
369500 -- (-758.053) (-762.073) (-761.273) [-759.236] * (-760.842) [-760.656] (-762.862) (-759.381) -- 0:00:37
370000 -- (-759.011) (-762.335) [-761.293] (-759.103) * (-759.693) (-761.798) [-759.583] (-760.811) -- 0:00:37
Average standard deviation of split frequencies: 0.012379
370500 -- [-759.029] (-760.301) (-762.669) (-760.052) * [-759.919] (-761.805) (-758.379) (-758.360) -- 0:00:37
371000 -- (-761.578) [-759.248] (-760.119) (-759.672) * (-762.714) (-758.707) (-759.030) [-758.932] -- 0:00:37
371500 -- (-761.005) (-758.979) (-759.069) [-759.645] * (-762.341) (-758.829) (-759.761) [-758.539] -- 0:00:37
372000 -- [-761.065] (-761.935) (-760.103) (-759.872) * (-764.238) [-758.555] (-757.978) (-759.809) -- 0:00:37
372500 -- (-760.366) (-762.499) (-758.462) [-758.913] * (-766.671) (-759.177) (-760.445) [-758.904] -- 0:00:37
373000 -- (-760.532) [-761.292] (-758.289) (-758.821) * (-763.906) [-763.982] (-760.206) (-758.242) -- 0:00:36
373500 -- (-760.003) (-760.655) (-759.029) [-760.126] * (-762.300) (-760.057) (-757.633) [-758.351] -- 0:00:36
374000 -- (-758.182) (-760.971) (-759.573) [-759.671] * (-758.342) (-760.307) (-760.423) [-760.480] -- 0:00:36
374500 -- (-758.775) [-761.932] (-764.681) (-760.731) * (-760.549) (-758.495) (-760.081) [-763.658] -- 0:00:36
375000 -- (-759.777) (-762.624) (-760.285) [-760.009] * (-764.708) (-761.295) (-766.102) [-761.152] -- 0:00:36
Average standard deviation of split frequencies: 0.013039
375500 -- [-759.766] (-760.846) (-758.964) (-758.818) * [-758.992] (-761.744) (-760.425) (-761.410) -- 0:00:36
376000 -- [-762.526] (-760.507) (-760.753) (-759.077) * [-759.880] (-761.628) (-759.690) (-760.305) -- 0:00:36
376500 -- (-762.726) (-758.114) [-759.512] (-760.680) * [-760.599] (-759.988) (-759.982) (-760.515) -- 0:00:36
377000 -- (-765.821) [-759.702] (-758.569) (-761.079) * (-760.511) (-760.786) (-762.027) [-759.385] -- 0:00:36
377500 -- [-761.729] (-763.804) (-759.653) (-759.587) * (-759.587) (-761.316) (-761.661) [-760.711] -- 0:00:36
378000 -- (-761.683) [-758.988] (-760.859) (-759.521) * (-761.683) (-762.171) [-759.613] (-760.945) -- 0:00:36
378500 -- [-763.113] (-760.897) (-764.689) (-761.717) * [-759.583] (-759.545) (-758.140) (-762.439) -- 0:00:36
379000 -- (-761.417) (-763.088) (-761.424) [-758.198] * [-759.421] (-759.545) (-758.910) (-766.541) -- 0:00:36
379500 -- [-760.200] (-757.992) (-758.843) (-763.042) * (-761.559) [-760.623] (-762.916) (-760.549) -- 0:00:35
380000 -- (-758.340) (-760.248) [-759.436] (-760.841) * (-760.960) (-760.644) (-759.240) [-758.227] -- 0:00:35
Average standard deviation of split frequencies: 0.012053
380500 -- [-760.307] (-759.333) (-760.245) (-764.160) * (-759.176) [-759.024] (-758.918) (-759.240) -- 0:00:35
381000 -- (-758.300) (-758.578) (-759.002) [-763.033] * [-759.517] (-759.652) (-759.469) (-760.540) -- 0:00:35
381500 -- [-758.545] (-758.163) (-760.683) (-761.400) * (-760.433) [-759.197] (-758.083) (-759.695) -- 0:00:37
382000 -- (-758.330) (-759.868) (-759.033) [-760.584] * [-759.927] (-758.913) (-758.823) (-760.374) -- 0:00:37
382500 -- [-759.130] (-759.658) (-763.953) (-765.220) * (-758.602) (-759.440) [-758.184] (-760.812) -- 0:00:37
383000 -- [-758.128] (-759.335) (-760.461) (-759.172) * (-759.761) [-759.858] (-760.210) (-763.933) -- 0:00:37
383500 -- (-759.132) (-760.268) (-759.339) [-759.321] * [-759.401] (-760.107) (-759.234) (-763.043) -- 0:00:36
384000 -- (-758.772) [-760.346] (-758.211) (-760.243) * (-759.461) [-760.861] (-761.280) (-760.519) -- 0:00:36
384500 -- [-758.028] (-758.826) (-759.258) (-761.998) * [-758.885] (-766.181) (-760.546) (-758.919) -- 0:00:36
385000 -- (-760.257) [-759.092] (-759.181) (-759.984) * (-758.545) (-758.375) (-765.438) [-759.774] -- 0:00:36
Average standard deviation of split frequencies: 0.011925
385500 -- (-760.209) (-759.504) [-758.284] (-760.610) * [-759.339] (-758.046) (-761.383) (-759.513) -- 0:00:36
386000 -- (-759.498) (-763.355) [-759.537] (-759.935) * [-762.131] (-759.794) (-760.931) (-761.747) -- 0:00:36
386500 -- (-763.255) (-763.475) (-759.563) [-761.541] * [-760.207] (-764.067) (-758.970) (-761.006) -- 0:00:36
387000 -- [-761.813] (-759.532) (-762.210) (-759.012) * [-759.672] (-758.230) (-759.011) (-760.144) -- 0:00:36
387500 -- (-760.954) (-762.753) (-762.443) [-758.343] * (-759.268) (-759.987) [-759.740] (-765.139) -- 0:00:36
388000 -- (-765.577) [-762.289] (-758.570) (-759.242) * (-760.312) (-759.508) (-761.345) [-760.907] -- 0:00:36
388500 -- (-761.012) [-764.103] (-760.436) (-761.436) * (-760.155) [-763.506] (-761.824) (-761.896) -- 0:00:36
389000 -- [-757.961] (-763.100) (-758.464) (-758.456) * (-762.668) [-759.072] (-763.941) (-763.732) -- 0:00:36
389500 -- [-758.475] (-761.877) (-761.350) (-758.458) * (-762.624) (-759.700) [-760.424] (-760.210) -- 0:00:36
390000 -- (-761.950) (-762.515) [-764.303] (-759.711) * (-759.150) [-760.593] (-762.688) (-759.352) -- 0:00:35
Average standard deviation of split frequencies: 0.012444
390500 -- (-760.555) [-760.420] (-759.630) (-760.943) * [-759.752] (-759.988) (-762.525) (-758.876) -- 0:00:35
391000 -- (-759.123) (-765.284) (-759.650) [-758.617] * [-760.577] (-761.436) (-759.382) (-758.613) -- 0:00:35
391500 -- (-763.038) [-764.500] (-759.377) (-759.858) * (-759.053) (-760.685) (-760.918) [-758.047] -- 0:00:35
392000 -- [-762.663] (-760.136) (-760.701) (-759.611) * (-760.459) [-759.865] (-758.011) (-761.153) -- 0:00:35
392500 -- (-759.889) [-757.719] (-769.427) (-759.174) * [-759.871] (-761.105) (-762.787) (-758.279) -- 0:00:35
393000 -- (-760.258) (-758.054) [-758.880] (-762.358) * (-757.665) [-759.028] (-759.486) (-758.218) -- 0:00:35
393500 -- (-759.146) [-758.828] (-763.992) (-758.864) * (-759.238) (-761.677) [-759.147] (-759.106) -- 0:00:35
394000 -- (-759.705) (-759.334) [-758.922] (-759.578) * (-759.435) (-760.842) (-758.105) [-759.065] -- 0:00:35
394500 -- (-759.848) (-760.552) (-758.392) [-759.877] * (-761.490) [-763.085] (-760.283) (-760.098) -- 0:00:35
395000 -- (-758.855) (-763.473) [-759.374] (-760.510) * (-758.241) (-759.186) (-762.879) [-758.205] -- 0:00:35
Average standard deviation of split frequencies: 0.012574
395500 -- (-761.326) (-759.783) (-759.651) [-760.594] * (-760.036) (-759.699) (-757.867) [-758.205] -- 0:00:35
396000 -- (-758.369) (-760.671) (-758.913) [-759.717] * [-760.568] (-760.021) (-759.276) (-758.298) -- 0:00:35
396500 -- (-761.716) [-760.520] (-758.697) (-760.066) * (-762.077) [-759.312] (-759.118) (-758.622) -- 0:00:35
397000 -- (-760.266) (-762.701) (-762.283) [-758.599] * (-765.295) (-759.481) [-759.830] (-762.650) -- 0:00:34
397500 -- (-759.199) [-759.513] (-758.453) (-760.502) * [-762.691] (-761.443) (-761.311) (-757.780) -- 0:00:36
398000 -- (-761.904) [-760.630] (-758.977) (-758.957) * (-759.882) [-759.722] (-764.798) (-758.977) -- 0:00:36
398500 -- (-760.360) (-759.773) [-760.713] (-758.698) * (-761.941) [-758.827] (-759.948) (-759.826) -- 0:00:36
399000 -- [-759.215] (-760.033) (-758.152) (-763.506) * (-762.828) [-758.136] (-765.774) (-761.864) -- 0:00:36
399500 -- [-760.555] (-758.689) (-761.656) (-759.573) * [-762.379] (-758.248) (-760.036) (-762.152) -- 0:00:36
400000 -- (-759.121) (-762.801) [-760.212] (-760.963) * (-759.492) [-760.172] (-759.148) (-763.544) -- 0:00:36
Average standard deviation of split frequencies: 0.012354
400500 -- (-758.150) [-762.022] (-760.023) (-759.129) * (-758.957) (-758.911) (-760.977) [-760.647] -- 0:00:35
401000 -- (-760.253) [-761.133] (-762.672) (-761.182) * (-759.649) (-763.875) (-758.810) [-758.507] -- 0:00:35
401500 -- (-761.230) (-759.191) (-765.373) [-759.765] * [-758.740] (-761.322) (-758.135) (-762.274) -- 0:00:35
402000 -- (-762.124) (-760.486) (-761.848) [-757.874] * (-759.946) (-761.787) (-758.439) [-760.647] -- 0:00:35
402500 -- [-761.626] (-760.513) (-766.999) (-759.936) * (-758.510) [-762.411] (-759.253) (-758.921) -- 0:00:35
403000 -- (-763.127) (-759.323) [-759.491] (-760.846) * (-758.651) (-760.185) [-757.719] (-761.964) -- 0:00:35
403500 -- (-758.108) [-758.329] (-758.349) (-759.631) * [-759.115] (-762.262) (-760.195) (-759.189) -- 0:00:35
404000 -- (-759.088) (-759.454) [-761.977] (-759.882) * (-762.787) (-759.005) (-760.034) [-757.687] -- 0:00:35
404500 -- (-758.611) [-759.717] (-761.649) (-764.729) * (-757.979) [-760.058] (-759.228) (-760.866) -- 0:00:35
405000 -- (-759.079) [-759.740] (-760.593) (-759.917) * (-759.152) (-759.017) (-759.554) [-759.717] -- 0:00:35
Average standard deviation of split frequencies: 0.012482
405500 -- (-761.954) (-758.696) (-759.642) [-759.532] * (-758.221) [-758.505] (-760.038) (-758.049) -- 0:00:35
406000 -- (-760.275) (-757.888) (-758.935) [-758.855] * [-758.656] (-759.943) (-759.718) (-762.154) -- 0:00:35
406500 -- (-764.498) [-759.505] (-759.092) (-761.900) * (-758.874) (-761.974) [-759.428] (-758.463) -- 0:00:35
407000 -- (-759.885) (-759.296) (-760.110) [-762.613] * (-760.107) [-763.129] (-759.568) (-760.554) -- 0:00:34
407500 -- [-762.713] (-760.092) (-760.744) (-761.626) * (-761.477) (-762.610) (-758.909) [-758.904] -- 0:00:34
408000 -- (-761.436) [-758.944] (-765.051) (-759.425) * (-761.803) (-763.901) (-758.217) [-760.094] -- 0:00:34
408500 -- (-758.735) (-763.828) [-759.776] (-758.896) * (-764.149) [-758.339] (-759.939) (-761.013) -- 0:00:34
409000 -- (-760.603) (-761.758) [-758.131] (-760.930) * (-758.108) [-759.842] (-759.407) (-758.659) -- 0:00:34
409500 -- (-760.671) [-759.993] (-761.658) (-766.157) * (-758.113) (-761.337) (-758.800) [-760.888] -- 0:00:34
410000 -- (-759.578) (-760.678) (-757.625) [-759.131] * [-758.102] (-761.907) (-757.961) (-760.469) -- 0:00:34
Average standard deviation of split frequencies: 0.012125
410500 -- [-758.219] (-762.857) (-759.722) (-760.868) * (-758.994) (-759.257) (-760.057) [-759.260] -- 0:00:34
411000 -- [-759.049] (-758.490) (-761.501) (-760.528) * (-759.617) [-758.935] (-760.426) (-760.893) -- 0:00:34
411500 -- (-760.413) [-759.958] (-759.020) (-758.488) * (-759.071) [-760.715] (-758.769) (-760.274) -- 0:00:34
412000 -- [-759.672] (-757.722) (-759.256) (-758.515) * (-767.158) (-759.831) (-759.331) [-761.643] -- 0:00:34
412500 -- [-763.943] (-760.905) (-758.347) (-760.480) * (-761.876) (-759.021) (-761.666) [-758.241] -- 0:00:34
413000 -- (-760.569) (-758.426) (-763.537) [-758.739] * [-762.623] (-758.660) (-758.921) (-763.238) -- 0:00:34
413500 -- (-759.752) (-760.352) [-758.683] (-760.804) * (-758.760) (-762.005) [-758.983] (-763.635) -- 0:00:35
414000 -- [-759.851] (-759.933) (-758.422) (-760.096) * [-759.493] (-764.601) (-760.868) (-758.285) -- 0:00:35
414500 -- (-759.910) (-759.829) (-761.165) [-757.911] * (-759.407) (-763.586) (-762.562) [-761.579] -- 0:00:35
415000 -- (-762.005) (-760.347) (-761.515) [-758.020] * [-758.106] (-761.377) (-761.959) (-760.234) -- 0:00:35
Average standard deviation of split frequencies: 0.012182
415500 -- (-766.039) [-761.541] (-762.491) (-760.853) * (-758.172) [-758.925] (-759.213) (-763.586) -- 0:00:35
416000 -- (-768.384) [-758.550] (-758.402) (-760.700) * (-757.886) [-758.832] (-759.830) (-760.896) -- 0:00:35
416500 -- (-764.710) (-764.378) [-762.452] (-760.031) * [-759.062] (-759.947) (-763.116) (-761.693) -- 0:00:35
417000 -- (-761.883) [-762.808] (-759.999) (-761.546) * (-760.757) (-761.849) (-760.373) [-762.558] -- 0:00:34
417500 -- (-760.949) (-757.787) [-758.297] (-762.139) * (-767.685) [-762.871] (-759.593) (-762.739) -- 0:00:34
418000 -- [-764.270] (-758.386) (-759.765) (-760.389) * (-762.492) (-758.980) (-761.386) [-759.987] -- 0:00:34
418500 -- (-762.204) (-758.266) (-759.799) [-759.587] * (-761.810) (-759.991) (-762.021) [-761.388] -- 0:00:34
419000 -- (-758.373) [-763.606] (-759.371) (-761.261) * [-763.953] (-761.270) (-759.488) (-761.983) -- 0:00:34
419500 -- (-760.940) (-763.647) [-760.681] (-760.350) * (-761.485) (-761.795) [-758.359] (-762.176) -- 0:00:34
420000 -- [-759.731] (-760.122) (-758.765) (-758.520) * (-764.141) (-760.147) (-761.096) [-758.052] -- 0:00:34
Average standard deviation of split frequencies: 0.012261
420500 -- (-760.663) (-761.130) [-758.873] (-760.108) * (-762.580) [-758.268] (-760.604) (-758.124) -- 0:00:34
421000 -- [-759.246] (-759.264) (-763.699) (-762.911) * [-758.270] (-763.215) (-761.133) (-758.162) -- 0:00:34
421500 -- (-759.259) (-759.118) [-763.575] (-759.832) * (-758.247) (-765.045) [-759.482] (-759.880) -- 0:00:34
422000 -- (-758.602) (-760.462) (-762.797) [-759.649] * [-758.732] (-759.501) (-760.541) (-760.954) -- 0:00:34
422500 -- (-758.193) [-759.276] (-759.193) (-759.622) * (-758.916) (-758.476) [-761.583] (-759.611) -- 0:00:34
423000 -- (-759.559) (-759.108) [-764.150] (-760.486) * (-761.277) [-760.054] (-759.207) (-760.210) -- 0:00:34
423500 -- (-759.847) [-758.746] (-760.773) (-763.849) * (-759.934) (-762.786) [-760.421] (-758.690) -- 0:00:34
424000 -- [-758.684] (-762.165) (-760.356) (-759.465) * (-759.044) [-759.058] (-758.645) (-761.732) -- 0:00:33
424500 -- (-759.302) (-759.928) (-759.638) [-759.527] * (-759.400) (-758.707) [-760.861] (-760.729) -- 0:00:33
425000 -- [-761.223] (-761.528) (-759.395) (-760.178) * [-758.336] (-759.874) (-760.341) (-759.003) -- 0:00:33
Average standard deviation of split frequencies: 0.012563
425500 -- (-759.836) (-759.140) (-761.815) [-761.331] * (-761.044) (-760.843) [-758.680] (-759.181) -- 0:00:33
426000 -- (-761.439) [-758.220] (-760.477) (-759.373) * (-761.049) (-761.773) (-760.177) [-758.513] -- 0:00:33
426500 -- (-758.313) (-760.522) (-760.781) [-759.816] * (-761.307) (-761.090) (-763.543) [-759.862] -- 0:00:33
427000 -- [-760.630] (-758.663) (-760.719) (-760.863) * (-760.043) (-760.475) (-760.891) [-759.831] -- 0:00:33
427500 -- (-764.373) (-759.559) [-762.207] (-760.563) * (-759.229) (-762.506) [-758.737] (-758.062) -- 0:00:33
428000 -- (-762.077) (-759.874) (-762.425) [-760.020] * (-760.035) (-773.505) (-760.610) [-758.142] -- 0:00:33
428500 -- [-759.448] (-762.181) (-767.443) (-760.118) * [-758.959] (-760.728) (-760.673) (-762.423) -- 0:00:33
429000 -- [-761.252] (-762.949) (-765.671) (-758.423) * (-758.291) [-760.131] (-760.255) (-760.322) -- 0:00:33
429500 -- (-758.109) [-760.448] (-762.121) (-758.670) * (-760.693) (-759.948) [-758.889] (-762.828) -- 0:00:33
430000 -- (-762.967) (-759.475) (-759.198) [-760.329] * (-759.289) (-759.807) [-761.985] (-758.838) -- 0:00:33
Average standard deviation of split frequencies: 0.012656
430500 -- (-759.019) (-760.035) [-760.594] (-758.546) * (-761.404) (-761.884) (-758.556) [-758.724] -- 0:00:34
431000 -- (-760.325) [-760.286] (-759.315) (-759.905) * (-762.481) (-762.363) [-758.769] (-758.146) -- 0:00:34
431500 -- (-759.017) [-761.759] (-759.674) (-761.721) * (-761.882) (-759.342) (-761.281) [-759.330] -- 0:00:34
432000 -- [-761.574] (-763.338) (-760.327) (-762.005) * (-763.579) (-758.728) [-759.334] (-759.610) -- 0:00:34
432500 -- (-762.015) (-761.725) [-759.947] (-758.029) * (-759.706) (-758.803) (-759.307) [-759.398] -- 0:00:34
433000 -- [-759.080] (-761.032) (-760.198) (-760.848) * [-758.835] (-759.484) (-767.213) (-760.759) -- 0:00:34
433500 -- (-758.718) [-758.450] (-761.190) (-758.523) * (-758.828) (-760.728) (-760.919) [-758.170] -- 0:00:33
434000 -- (-759.408) (-759.153) (-763.258) [-758.563] * (-760.727) (-759.511) [-759.989] (-761.328) -- 0:00:33
434500 -- (-762.731) (-760.378) (-760.507) [-758.776] * (-759.277) (-759.670) (-764.997) [-759.237] -- 0:00:33
435000 -- (-759.906) (-759.253) [-758.872] (-759.141) * (-759.291) (-759.415) (-760.572) [-759.552] -- 0:00:33
Average standard deviation of split frequencies: 0.012084
435500 -- [-759.097] (-761.859) (-759.204) (-759.711) * [-759.992] (-760.091) (-758.263) (-758.358) -- 0:00:33
436000 -- [-760.405] (-760.085) (-762.105) (-758.446) * (-759.192) (-758.665) (-760.195) [-758.330] -- 0:00:33
436500 -- [-762.206] (-761.309) (-762.322) (-761.604) * (-758.147) [-758.983] (-761.355) (-758.258) -- 0:00:33
437000 -- [-759.960] (-762.778) (-757.927) (-761.187) * (-760.325) (-760.847) (-759.314) [-760.579] -- 0:00:33
437500 -- [-760.669] (-758.217) (-759.392) (-759.720) * (-760.362) [-758.084] (-759.308) (-760.290) -- 0:00:33
438000 -- (-759.867) [-759.987] (-760.845) (-758.655) * (-760.483) (-763.340) [-758.531] (-760.195) -- 0:00:33
438500 -- (-760.119) [-760.534] (-759.636) (-758.863) * (-761.075) (-760.469) [-758.541] (-758.467) -- 0:00:33
439000 -- (-760.206) [-758.627] (-759.903) (-760.365) * (-759.935) (-760.256) (-758.758) [-760.653] -- 0:00:33
439500 -- [-762.289] (-761.728) (-760.709) (-758.595) * (-759.787) (-758.883) (-759.152) [-759.265] -- 0:00:33
440000 -- (-761.280) (-759.439) (-762.588) [-759.450] * [-759.861] (-759.855) (-765.539) (-762.018) -- 0:00:33
Average standard deviation of split frequencies: 0.012904
440500 -- (-758.567) [-761.336] (-764.130) (-759.773) * (-759.062) (-759.179) (-762.141) [-759.728] -- 0:00:33
441000 -- (-760.619) (-758.978) [-759.302] (-759.250) * (-762.802) [-759.596] (-758.033) (-760.033) -- 0:00:32
441500 -- [-759.356] (-759.727) (-759.191) (-759.905) * (-760.556) (-761.918) (-759.526) [-762.365] -- 0:00:32
442000 -- (-763.007) [-759.744] (-758.696) (-760.628) * (-763.825) [-761.767] (-761.044) (-760.523) -- 0:00:32
442500 -- (-766.389) [-758.666] (-760.036) (-760.786) * [-762.808] (-762.893) (-759.336) (-759.289) -- 0:00:32
443000 -- (-760.053) (-758.352) (-758.894) [-757.643] * (-767.178) (-764.305) [-760.908] (-758.474) -- 0:00:32
443500 -- (-764.838) (-761.262) [-758.387] (-760.090) * (-759.990) (-760.894) [-762.469] (-758.213) -- 0:00:32
444000 -- (-759.502) (-762.655) (-758.236) [-759.746] * (-759.302) [-763.595] (-759.481) (-758.532) -- 0:00:32
444500 -- (-763.112) [-760.131] (-759.396) (-761.946) * (-760.959) (-764.915) (-758.419) [-761.466] -- 0:00:32
445000 -- [-758.694] (-758.147) (-759.870) (-764.265) * (-759.672) [-760.677] (-761.780) (-759.909) -- 0:00:32
Average standard deviation of split frequencies: 0.012808
445500 -- (-762.020) (-759.361) [-761.299] (-759.042) * (-761.931) (-761.224) [-760.648] (-763.069) -- 0:00:32
446000 -- [-764.480] (-757.611) (-761.327) (-758.648) * (-759.350) (-761.593) (-759.068) [-762.612] -- 0:00:32
446500 -- (-758.805) (-760.676) [-763.013] (-760.773) * [-758.192] (-763.430) (-761.978) (-759.831) -- 0:00:32
447000 -- (-758.244) [-759.825] (-762.720) (-758.208) * (-757.536) (-760.575) [-762.490] (-761.489) -- 0:00:33
447500 -- [-759.307] (-758.953) (-760.915) (-758.224) * (-757.961) (-758.885) (-762.398) [-761.041] -- 0:00:33
448000 -- (-763.327) (-758.135) [-758.902] (-760.796) * (-759.413) [-760.524] (-760.348) (-759.757) -- 0:00:33
448500 -- [-761.003] (-758.068) (-759.229) (-760.169) * (-763.508) (-759.285) (-761.673) [-758.338] -- 0:00:33
449000 -- [-762.120] (-758.068) (-759.032) (-757.909) * [-759.523] (-760.645) (-759.556) (-762.832) -- 0:00:33
449500 -- (-758.885) [-759.578] (-762.617) (-758.797) * (-758.806) [-758.529] (-759.721) (-760.017) -- 0:00:33
450000 -- (-758.581) (-758.354) [-760.067] (-758.164) * (-765.727) [-758.431] (-759.204) (-760.542) -- 0:00:33
Average standard deviation of split frequencies: 0.012121
450500 -- (-760.755) (-758.575) (-759.774) [-758.991] * [-760.196] (-759.046) (-759.644) (-759.153) -- 0:00:32
451000 -- (-759.147) (-760.689) [-760.085] (-762.245) * [-762.084] (-758.479) (-758.349) (-758.684) -- 0:00:32
451500 -- [-759.460] (-758.837) (-761.942) (-759.929) * (-762.580) [-760.553] (-759.259) (-762.282) -- 0:00:32
452000 -- (-760.041) (-761.110) [-761.498] (-763.858) * (-759.160) (-762.659) [-763.774] (-762.491) -- 0:00:32
452500 -- (-761.363) (-760.743) [-760.165] (-763.547) * (-761.016) [-760.737] (-762.691) (-759.078) -- 0:00:32
453000 -- (-757.882) (-760.049) (-761.013) [-759.933] * (-761.564) (-759.960) (-759.261) [-759.211] -- 0:00:32
453500 -- [-758.071] (-758.288) (-760.240) (-759.580) * [-761.239] (-760.651) (-761.138) (-761.341) -- 0:00:32
454000 -- (-759.458) [-758.115] (-759.672) (-758.492) * (-763.172) [-758.505] (-760.415) (-759.520) -- 0:00:32
454500 -- (-757.754) (-759.302) (-762.372) [-758.727] * (-760.806) (-762.570) [-760.147] (-759.831) -- 0:00:32
455000 -- (-758.130) (-758.920) [-762.048] (-759.605) * (-758.695) (-763.962) (-760.058) [-758.676] -- 0:00:32
Average standard deviation of split frequencies: 0.012599
455500 -- [-759.247] (-759.109) (-763.264) (-760.326) * (-758.793) (-763.695) [-759.275] (-760.078) -- 0:00:32
456000 -- (-758.463) (-759.267) [-761.550] (-759.292) * (-759.333) (-761.506) [-759.504] (-760.346) -- 0:00:32
456500 -- [-758.073] (-759.466) (-759.951) (-758.268) * (-760.044) [-758.558] (-761.090) (-760.698) -- 0:00:32
457000 -- [-758.865] (-758.566) (-760.766) (-762.691) * (-763.556) (-758.106) (-761.722) [-761.365] -- 0:00:32
457500 -- (-760.370) (-759.151) (-764.290) [-761.282] * (-763.394) [-758.116] (-759.512) (-758.843) -- 0:00:32
458000 -- [-759.350] (-758.840) (-761.143) (-761.329) * (-760.315) (-760.178) [-761.521] (-765.228) -- 0:00:31
458500 -- (-761.299) [-760.217] (-759.415) (-763.228) * (-767.082) [-758.740] (-759.360) (-761.921) -- 0:00:31
459000 -- (-760.440) (-758.569) (-759.829) [-763.249] * (-762.425) (-759.447) [-760.089] (-758.478) -- 0:00:31
459500 -- (-759.292) (-759.671) (-762.931) [-761.979] * (-759.841) (-760.718) (-762.660) [-761.178] -- 0:00:31
460000 -- (-759.782) [-760.280] (-761.929) (-760.786) * (-760.482) (-758.345) [-762.161] (-760.121) -- 0:00:31
Average standard deviation of split frequencies: 0.012216
460500 -- (-761.925) (-758.220) (-758.089) [-762.677] * (-759.373) [-758.120] (-758.110) (-759.493) -- 0:00:31
461000 -- (-758.722) (-760.133) [-758.799] (-758.022) * (-758.841) [-761.553] (-757.816) (-759.278) -- 0:00:31
461500 -- (-759.627) (-762.197) (-759.092) [-759.154] * [-759.902] (-758.165) (-763.593) (-759.860) -- 0:00:31
462000 -- (-759.045) [-758.331] (-758.791) (-759.885) * (-760.226) (-760.527) (-761.681) [-762.166] -- 0:00:31
462500 -- (-761.674) (-757.974) (-759.083) [-758.458] * (-762.469) (-761.015) [-761.793] (-762.309) -- 0:00:31
463000 -- (-759.737) (-758.661) (-759.344) [-760.731] * (-761.964) (-763.416) (-759.406) [-762.508] -- 0:00:31
463500 -- (-759.606) [-760.324] (-759.846) (-759.214) * (-759.333) (-764.432) (-761.964) [-760.181] -- 0:00:31
464000 -- (-758.617) (-759.992) (-763.417) [-757.478] * (-759.603) (-765.246) [-760.475] (-759.217) -- 0:00:32
464500 -- (-759.870) [-758.330] (-759.906) (-761.593) * [-757.673] (-761.603) (-764.408) (-758.868) -- 0:00:32
465000 -- (-760.686) (-761.060) (-761.006) [-759.347] * (-759.190) (-758.842) (-761.962) [-762.364] -- 0:00:32
Average standard deviation of split frequencies: 0.012734
465500 -- [-762.448] (-760.019) (-759.136) (-762.461) * (-759.620) (-759.771) (-760.850) [-758.755] -- 0:00:32
466000 -- [-759.965] (-761.457) (-758.406) (-765.189) * [-758.242] (-763.973) (-759.489) (-759.162) -- 0:00:32
466500 -- (-764.445) [-759.768] (-758.756) (-760.749) * [-758.596] (-766.044) (-757.586) (-759.366) -- 0:00:32
467000 -- (-759.944) (-759.853) [-760.832] (-758.858) * (-758.364) (-761.482) (-759.600) [-760.320] -- 0:00:31
467500 -- (-760.773) (-759.690) [-759.673] (-758.665) * (-762.042) [-759.798] (-759.020) (-764.915) -- 0:00:31
468000 -- (-762.269) [-760.330] (-760.973) (-758.236) * [-762.069] (-759.247) (-760.668) (-762.588) -- 0:00:31
468500 -- (-760.898) (-762.348) (-758.488) [-758.492] * (-758.747) (-758.843) (-759.585) [-759.455] -- 0:00:31
469000 -- (-760.349) [-759.790] (-762.246) (-763.411) * (-759.469) (-758.586) (-761.634) [-759.858] -- 0:00:31
469500 -- [-761.664] (-759.692) (-760.538) (-761.438) * [-758.979] (-759.164) (-765.063) (-758.766) -- 0:00:31
470000 -- (-763.131) (-759.315) (-764.525) [-763.458] * [-760.281] (-760.155) (-761.333) (-760.879) -- 0:00:31
Average standard deviation of split frequencies: 0.011783
470500 -- (-760.766) (-760.126) (-758.945) [-759.864] * [-760.489] (-759.279) (-763.352) (-759.147) -- 0:00:31
471000 -- (-759.059) (-759.085) [-759.406] (-761.911) * (-760.097) [-760.711] (-761.713) (-763.129) -- 0:00:31
471500 -- (-759.413) (-759.054) [-760.654] (-761.311) * [-758.555] (-759.325) (-759.902) (-758.338) -- 0:00:31
472000 -- (-759.400) (-761.921) (-760.827) [-758.047] * (-758.933) (-760.102) (-760.789) [-758.341] -- 0:00:31
472500 -- (-758.295) [-758.476] (-758.487) (-764.268) * (-759.004) [-761.318] (-760.884) (-759.268) -- 0:00:31
473000 -- (-758.645) (-760.088) (-758.079) [-762.678] * (-758.443) [-760.582] (-759.914) (-763.924) -- 0:00:31
473500 -- (-759.387) (-759.840) [-759.311] (-766.811) * [-757.815] (-758.968) (-765.473) (-760.177) -- 0:00:31
474000 -- (-758.977) (-759.185) (-764.061) [-760.234] * (-762.598) [-764.066] (-759.128) (-758.857) -- 0:00:31
474500 -- (-759.276) [-758.518] (-761.180) (-761.679) * (-764.123) (-760.002) [-759.570] (-761.143) -- 0:00:31
475000 -- (-760.119) (-758.190) [-760.059] (-761.239) * [-760.897] (-758.985) (-763.402) (-762.994) -- 0:00:30
Average standard deviation of split frequencies: 0.011822
475500 -- (-760.701) (-761.563) (-759.414) [-759.680] * (-763.474) (-760.139) [-759.162] (-764.533) -- 0:00:30
476000 -- [-757.816] (-759.521) (-758.498) (-761.254) * (-764.700) (-759.879) (-762.427) [-761.056] -- 0:00:30
476500 -- [-758.184] (-758.576) (-759.835) (-758.768) * (-760.977) [-759.883] (-759.514) (-760.481) -- 0:00:30
477000 -- (-762.637) (-758.997) [-759.049] (-760.862) * (-758.937) (-762.180) (-765.292) [-762.432] -- 0:00:30
477500 -- (-760.738) (-761.543) [-758.551] (-760.575) * (-764.221) [-759.295] (-759.788) (-760.718) -- 0:00:30
478000 -- (-762.601) (-761.626) [-758.383] (-763.222) * (-760.004) [-759.934] (-760.839) (-762.840) -- 0:00:30
478500 -- [-761.079] (-762.281) (-761.110) (-761.904) * (-760.626) (-761.275) [-758.769] (-763.340) -- 0:00:30
479000 -- [-758.703] (-762.263) (-760.781) (-764.255) * [-760.101] (-760.746) (-758.738) (-763.537) -- 0:00:30
479500 -- [-759.215] (-760.986) (-759.929) (-760.747) * (-760.197) (-757.750) [-763.137] (-763.182) -- 0:00:30
480000 -- (-761.553) (-760.116) (-760.945) [-760.043] * (-762.312) [-760.298] (-759.885) (-762.390) -- 0:00:30
Average standard deviation of split frequencies: 0.011707
480500 -- (-758.528) [-761.106] (-764.749) (-759.802) * (-763.125) [-761.126] (-759.624) (-760.061) -- 0:00:30
481000 -- [-758.644] (-759.780) (-758.392) (-758.373) * [-761.569] (-759.280) (-760.925) (-760.439) -- 0:00:31
481500 -- [-759.692] (-761.052) (-760.632) (-762.482) * (-764.974) [-758.791] (-757.836) (-758.545) -- 0:00:31
482000 -- (-759.267) (-760.456) (-762.339) [-757.856] * (-768.074) (-758.571) [-759.085] (-759.483) -- 0:00:31
482500 -- (-763.650) [-760.351] (-762.824) (-757.848) * (-764.634) (-764.311) [-759.327] (-759.698) -- 0:00:31
483000 -- (-762.887) (-768.467) [-758.817] (-766.503) * (-766.097) [-761.733] (-758.212) (-759.934) -- 0:00:31
483500 -- [-762.075] (-760.665) (-759.780) (-760.705) * (-763.727) (-761.594) (-762.026) [-758.944] -- 0:00:30
484000 -- (-765.482) (-759.633) [-758.209] (-758.635) * [-759.428] (-762.509) (-760.051) (-758.383) -- 0:00:30
484500 -- (-761.003) (-761.865) [-764.413] (-760.569) * (-760.179) (-758.391) [-758.945] (-759.630) -- 0:00:30
485000 -- (-762.853) [-759.191] (-763.445) (-759.362) * (-757.901) [-758.283] (-758.903) (-758.741) -- 0:00:30
Average standard deviation of split frequencies: 0.011047
485500 -- [-757.670] (-758.563) (-759.889) (-760.014) * [-758.115] (-762.467) (-759.970) (-759.020) -- 0:00:30
486000 -- (-760.226) (-759.252) [-759.243] (-761.804) * (-759.452) [-760.986] (-759.336) (-758.540) -- 0:00:30
486500 -- (-760.614) (-758.078) [-759.237] (-760.908) * (-762.482) (-759.852) (-759.448) [-761.313] -- 0:00:30
487000 -- [-759.222] (-758.590) (-760.245) (-760.970) * [-759.478] (-760.214) (-758.615) (-759.535) -- 0:00:30
487500 -- (-762.618) (-759.320) (-761.177) [-759.005] * (-760.246) (-760.103) (-760.501) [-759.500] -- 0:00:30
488000 -- [-757.882] (-762.228) (-758.879) (-758.997) * (-762.754) [-759.658] (-760.719) (-758.968) -- 0:00:30
488500 -- (-764.762) (-760.161) [-758.289] (-759.795) * (-760.496) [-760.697] (-762.411) (-760.274) -- 0:00:30
489000 -- (-760.175) [-760.917] (-759.430) (-759.227) * (-759.676) [-761.877] (-758.602) (-759.308) -- 0:00:30
489500 -- [-759.394] (-760.936) (-762.307) (-758.288) * (-758.406) (-762.348) (-761.928) [-762.877] -- 0:00:30
490000 -- (-760.698) [-760.294] (-763.882) (-758.348) * [-761.711] (-760.540) (-758.834) (-760.119) -- 0:00:30
Average standard deviation of split frequencies: 0.010782
490500 -- (-763.194) [-759.524] (-760.274) (-759.493) * [-760.173] (-758.494) (-760.444) (-758.703) -- 0:00:30
491000 -- (-761.015) (-760.367) (-764.175) [-761.627] * (-759.498) (-759.566) (-760.153) [-759.949] -- 0:00:30
491500 -- [-763.541] (-758.933) (-759.688) (-761.389) * [-762.048] (-761.259) (-763.357) (-765.522) -- 0:00:30
492000 -- (-759.785) (-759.627) (-760.898) [-759.373] * (-760.678) [-757.999] (-762.670) (-762.127) -- 0:00:29
492500 -- [-761.491] (-758.566) (-763.408) (-758.640) * (-763.216) [-759.456] (-758.311) (-759.676) -- 0:00:29
493000 -- (-761.675) (-759.827) [-759.568] (-760.305) * (-759.998) [-759.391] (-759.026) (-759.102) -- 0:00:29
493500 -- (-762.064) (-761.145) [-758.761] (-758.921) * (-759.554) (-762.447) (-758.594) [-759.016] -- 0:00:29
494000 -- (-769.538) [-758.822] (-760.389) (-759.255) * (-763.452) (-762.439) [-764.203] (-761.815) -- 0:00:29
494500 -- [-761.074] (-761.350) (-759.108) (-760.809) * (-760.924) [-763.111] (-759.287) (-760.689) -- 0:00:29
495000 -- (-761.545) (-758.562) (-760.226) [-758.432] * (-759.414) [-758.918] (-758.893) (-760.331) -- 0:00:29
Average standard deviation of split frequencies: 0.010678
495500 -- (-759.554) (-760.192) [-758.971] (-759.870) * (-760.494) [-760.145] (-758.353) (-760.046) -- 0:00:29
496000 -- [-758.397] (-758.487) (-760.810) (-760.266) * (-759.556) [-759.058] (-759.430) (-761.924) -- 0:00:29
496500 -- [-758.206] (-760.233) (-760.274) (-759.769) * (-760.737) (-758.729) [-758.490] (-760.724) -- 0:00:29
497000 -- (-760.812) (-762.641) [-760.020] (-758.407) * (-757.899) [-759.098] (-764.648) (-759.969) -- 0:00:29
497500 -- (-762.451) [-762.936] (-761.862) (-759.811) * (-760.258) (-758.944) [-760.291] (-759.837) -- 0:00:29
498000 -- (-760.019) [-760.546] (-759.703) (-758.843) * (-760.660) (-759.016) (-759.772) [-760.288] -- 0:00:30
498500 -- (-759.659) [-760.639] (-759.893) (-762.727) * [-760.065] (-762.104) (-760.268) (-759.009) -- 0:00:30
499000 -- (-759.282) [-759.423] (-759.400) (-758.940) * (-759.715) (-760.849) [-760.685] (-762.297) -- 0:00:30
499500 -- (-758.308) (-758.473) (-763.556) [-760.547] * [-759.515] (-760.105) (-762.473) (-762.875) -- 0:00:30
500000 -- [-758.636] (-761.317) (-758.730) (-758.885) * (-758.430) [-760.092] (-760.661) (-760.287) -- 0:00:30
Average standard deviation of split frequencies: 0.010534
500500 -- [-762.919] (-759.930) (-759.046) (-758.882) * (-758.283) (-760.077) (-762.469) [-759.072] -- 0:00:29
501000 -- [-762.434] (-757.948) (-759.597) (-761.008) * (-761.229) [-765.802] (-759.005) (-758.068) -- 0:00:29
501500 -- [-759.164] (-760.454) (-762.171) (-761.457) * [-758.344] (-758.895) (-758.722) (-758.318) -- 0:00:29
502000 -- (-760.180) (-760.264) [-758.513] (-759.687) * (-760.554) (-762.891) (-763.274) [-759.126] -- 0:00:29
502500 -- (-758.675) [-758.856] (-759.183) (-761.910) * [-758.795] (-760.628) (-765.367) (-761.165) -- 0:00:29
503000 -- (-761.838) (-760.085) (-758.399) [-760.032] * [-758.454] (-758.016) (-759.227) (-760.526) -- 0:00:29
503500 -- (-759.082) (-759.897) [-758.755] (-763.113) * (-757.912) (-759.236) [-758.646] (-758.661) -- 0:00:29
504000 -- [-758.328] (-760.324) (-762.231) (-761.351) * (-764.825) [-759.028] (-758.248) (-758.098) -- 0:00:29
504500 -- [-758.170] (-760.888) (-759.871) (-760.195) * (-760.150) (-758.122) [-758.506] (-758.138) -- 0:00:29
505000 -- [-758.428] (-761.572) (-758.476) (-761.219) * (-759.836) (-759.371) (-759.301) [-758.149] -- 0:00:29
Average standard deviation of split frequencies: 0.010973
505500 -- (-759.046) (-759.971) [-763.607] (-760.197) * (-759.674) (-758.434) (-759.619) [-759.823] -- 0:00:29
506000 -- [-759.547] (-759.245) (-761.186) (-759.512) * (-760.939) (-759.865) [-758.866] (-758.973) -- 0:00:29
506500 -- (-759.483) (-761.388) (-770.090) [-759.366] * [-759.211] (-758.438) (-759.480) (-761.287) -- 0:00:29
507000 -- (-759.098) (-761.074) (-763.887) [-760.696] * (-759.491) (-760.003) (-761.350) [-760.762] -- 0:00:29
507500 -- (-759.847) (-759.629) (-760.887) [-759.584] * [-759.272] (-759.677) (-762.271) (-759.417) -- 0:00:29
508000 -- (-758.701) [-761.112] (-761.594) (-762.577) * (-758.599) (-759.575) (-758.916) [-759.420] -- 0:00:29
508500 -- (-758.011) [-758.342] (-760.331) (-758.166) * [-758.321] (-758.947) (-761.709) (-758.924) -- 0:00:28
509000 -- (-758.649) [-757.759] (-758.142) (-760.683) * [-758.316] (-762.985) (-762.471) (-761.844) -- 0:00:28
509500 -- (-762.183) (-758.857) (-757.923) [-759.503] * [-759.321] (-760.635) (-759.514) (-759.556) -- 0:00:28
510000 -- (-760.306) (-759.417) [-758.521] (-760.068) * [-758.752] (-758.548) (-764.928) (-758.185) -- 0:00:28
Average standard deviation of split frequencies: 0.011466
510500 -- (-760.181) [-759.519] (-761.004) (-759.791) * (-760.974) [-760.216] (-759.245) (-758.121) -- 0:00:28
511000 -- (-758.989) [-757.926] (-758.426) (-763.787) * (-759.453) (-762.197) (-759.539) [-759.773] -- 0:00:28
511500 -- (-759.041) [-760.013] (-761.723) (-763.805) * (-759.001) (-760.605) [-759.398] (-760.010) -- 0:00:28
512000 -- [-760.194] (-759.645) (-758.297) (-760.613) * (-761.503) (-762.065) [-760.093] (-759.367) -- 0:00:28
512500 -- (-761.136) (-758.177) [-758.307] (-759.032) * (-764.375) (-759.862) (-759.373) [-760.359] -- 0:00:28
513000 -- (-761.711) (-758.642) [-758.769] (-758.867) * (-759.552) (-762.822) (-758.711) [-759.395] -- 0:00:28
513500 -- (-759.616) [-759.873] (-758.769) (-758.180) * [-759.334] (-762.397) (-760.098) (-759.016) -- 0:00:28
514000 -- (-759.594) (-762.797) [-758.375] (-759.609) * (-758.248) [-758.705] (-763.988) (-759.479) -- 0:00:28
514500 -- [-759.852] (-759.480) (-758.536) (-761.090) * (-760.475) (-763.448) [-759.750] (-759.137) -- 0:00:29
515000 -- (-758.262) (-759.714) [-762.190] (-758.971) * (-758.944) [-761.583] (-761.685) (-760.058) -- 0:00:29
Average standard deviation of split frequencies: 0.011662
515500 -- (-763.596) (-759.746) [-762.681] (-761.277) * (-760.165) (-760.204) (-760.285) [-757.795] -- 0:00:29
516000 -- (-759.857) (-758.527) [-760.750] (-759.809) * (-759.184) (-759.129) [-760.323] (-760.883) -- 0:00:29
516500 -- [-760.275] (-758.718) (-758.706) (-760.343) * (-760.722) [-759.727] (-762.854) (-760.234) -- 0:00:29
517000 -- (-759.843) (-759.372) (-762.749) [-758.935] * (-758.512) (-759.687) [-762.758] (-764.440) -- 0:00:28
517500 -- [-760.797] (-758.827) (-762.066) (-758.294) * [-759.403] (-761.018) (-759.978) (-763.389) -- 0:00:28
518000 -- (-761.524) (-761.561) [-761.556] (-759.081) * [-758.791] (-759.394) (-759.041) (-760.635) -- 0:00:28
518500 -- (-758.434) (-761.164) [-759.247] (-758.950) * (-759.913) (-763.748) [-758.483] (-759.710) -- 0:00:28
519000 -- [-760.118] (-759.510) (-759.974) (-761.465) * [-759.166] (-762.698) (-759.605) (-758.568) -- 0:00:28
519500 -- [-759.960] (-760.877) (-759.421) (-761.400) * [-760.055] (-760.502) (-761.856) (-766.465) -- 0:00:28
520000 -- (-758.910) (-765.116) [-760.016] (-758.312) * (-759.886) (-759.039) [-760.929] (-763.122) -- 0:00:28
Average standard deviation of split frequencies: 0.011519
520500 -- (-759.280) [-760.900] (-758.411) (-760.202) * (-759.653) (-759.269) [-763.468] (-762.135) -- 0:00:28
521000 -- (-760.780) [-759.247] (-759.657) (-761.019) * (-760.226) (-758.547) [-760.819] (-760.436) -- 0:00:28
521500 -- (-761.443) (-761.310) (-760.237) [-759.200] * (-759.749) [-759.026] (-758.795) (-761.309) -- 0:00:28
522000 -- (-762.552) (-761.618) (-759.659) [-760.001] * [-759.229] (-761.727) (-758.682) (-762.594) -- 0:00:28
522500 -- (-759.396) (-762.947) (-759.604) [-760.239] * (-759.019) (-760.392) (-757.826) [-760.186] -- 0:00:28
523000 -- (-759.611) (-763.166) [-757.868] (-759.090) * (-759.505) [-761.393] (-761.780) (-761.697) -- 0:00:28
523500 -- [-759.459] (-761.699) (-758.382) (-759.680) * (-760.014) (-759.298) [-758.393] (-758.682) -- 0:00:28
524000 -- (-760.325) (-760.717) [-758.732] (-762.390) * [-758.032] (-761.208) (-758.554) (-760.068) -- 0:00:28
524500 -- (-758.379) [-758.855] (-758.631) (-760.506) * (-758.198) (-761.601) (-759.254) [-758.461] -- 0:00:28
525000 -- (-761.833) (-760.068) (-760.158) [-761.410] * (-759.731) (-760.423) (-759.309) [-759.813] -- 0:00:28
Average standard deviation of split frequencies: 0.011302
525500 -- [-760.219] (-758.036) (-760.930) (-757.929) * (-758.926) (-761.893) [-758.271] (-758.487) -- 0:00:27
526000 -- (-758.962) (-759.887) (-761.935) [-759.524] * (-759.962) [-759.261] (-759.375) (-757.781) -- 0:00:27
526500 -- (-760.320) (-759.865) (-757.787) [-763.965] * (-758.425) (-760.827) (-761.094) [-759.654] -- 0:00:27
527000 -- (-760.775) (-763.168) (-764.418) [-759.884] * [-758.933] (-764.234) (-760.379) (-760.188) -- 0:00:27
527500 -- (-758.099) [-759.772] (-762.695) (-765.895) * [-760.017] (-760.115) (-758.154) (-762.313) -- 0:00:27
528000 -- (-765.419) (-757.994) [-759.160] (-763.687) * (-758.910) [-758.365] (-757.775) (-761.863) -- 0:00:27
528500 -- (-763.537) (-758.568) [-759.438] (-760.021) * (-759.192) (-759.165) (-759.076) [-759.329] -- 0:00:27
529000 -- [-760.143] (-759.429) (-759.863) (-757.891) * (-759.423) [-759.526] (-761.244) (-759.149) -- 0:00:27
529500 -- (-760.956) (-760.079) (-761.870) [-758.457] * [-759.259] (-758.861) (-763.476) (-759.111) -- 0:00:27
530000 -- (-759.151) (-761.055) (-759.350) [-759.100] * (-759.207) (-764.142) [-762.393] (-762.452) -- 0:00:27
Average standard deviation of split frequencies: 0.011026
530500 -- (-759.742) [-763.466] (-760.937) (-761.997) * [-761.961] (-759.395) (-760.470) (-759.427) -- 0:00:28
531000 -- (-761.898) [-759.925] (-759.473) (-759.206) * (-763.593) [-759.185] (-760.259) (-757.716) -- 0:00:28
531500 -- (-761.519) (-758.871) (-759.901) [-758.578] * (-758.977) (-758.179) [-759.143] (-761.480) -- 0:00:28
532000 -- (-758.777) (-757.620) (-759.152) [-758.641] * (-759.156) (-758.523) [-760.607] (-765.742) -- 0:00:28
532500 -- (-758.238) (-759.799) (-761.013) [-757.752] * [-759.395] (-761.679) (-760.346) (-760.566) -- 0:00:28
533000 -- (-757.842) [-759.480] (-759.490) (-758.267) * (-760.449) (-759.531) (-759.255) [-759.018] -- 0:00:28
533500 -- (-761.920) [-758.270] (-759.517) (-763.220) * (-758.995) (-760.534) (-758.741) [-757.727] -- 0:00:27
534000 -- [-761.518] (-762.396) (-762.944) (-761.183) * (-761.122) (-758.453) (-760.996) [-759.226] -- 0:00:27
534500 -- (-758.955) (-758.277) [-763.230] (-761.139) * (-760.795) [-758.962] (-762.161) (-757.873) -- 0:00:27
535000 -- (-758.348) [-760.248] (-762.038) (-759.118) * (-760.368) (-758.108) (-764.543) [-758.490] -- 0:00:27
Average standard deviation of split frequencies: 0.010192
535500 -- (-758.224) (-759.778) [-759.643] (-758.585) * (-758.592) (-758.528) [-759.849] (-758.107) -- 0:00:27
536000 -- (-758.432) (-761.867) [-761.012] (-758.914) * [-758.216] (-760.279) (-758.958) (-757.770) -- 0:00:27
536500 -- (-762.237) (-761.277) (-761.012) [-759.764] * (-758.312) [-759.854] (-760.468) (-758.205) -- 0:00:27
537000 -- [-758.635] (-762.112) (-759.035) (-758.284) * (-762.850) (-760.634) (-760.124) [-759.153] -- 0:00:27
537500 -- [-757.838] (-759.706) (-764.589) (-763.760) * (-761.606) [-758.858] (-759.242) (-759.517) -- 0:00:27
538000 -- (-760.459) (-759.028) [-761.506] (-759.420) * (-758.745) (-765.690) [-761.451] (-758.732) -- 0:00:27
538500 -- (-757.889) (-758.717) [-758.851] (-759.301) * [-763.104] (-761.076) (-761.102) (-761.113) -- 0:00:27
539000 -- (-759.422) (-762.690) [-758.469] (-759.163) * [-759.476] (-761.108) (-759.580) (-760.872) -- 0:00:27
539500 -- (-759.856) (-764.555) (-759.127) [-760.956] * (-761.062) (-758.830) (-761.779) [-760.528] -- 0:00:27
540000 -- (-759.719) [-759.500] (-758.882) (-762.904) * (-757.807) (-758.378) [-762.434] (-758.252) -- 0:00:27
Average standard deviation of split frequencies: 0.010124
540500 -- (-759.483) [-759.399] (-758.835) (-758.685) * (-761.093) (-761.012) (-758.945) [-758.160] -- 0:00:27
541000 -- (-758.397) (-760.887) (-759.593) [-759.063] * [-759.663] (-760.622) (-758.457) (-760.423) -- 0:00:27
541500 -- (-764.806) (-759.451) (-759.148) [-759.995] * [-764.232] (-761.121) (-758.958) (-763.541) -- 0:00:27
542000 -- (-764.446) (-761.108) (-758.295) [-757.691] * (-760.540) (-759.281) [-757.988] (-769.258) -- 0:00:27
542500 -- (-760.813) [-761.772] (-760.752) (-765.895) * (-761.513) (-759.985) [-758.310] (-759.339) -- 0:00:26
543000 -- (-758.973) (-758.952) [-760.533] (-763.669) * [-761.828] (-761.861) (-758.835) (-761.034) -- 0:00:26
543500 -- [-760.138] (-758.853) (-760.707) (-762.951) * (-761.170) (-763.086) (-759.744) [-760.882] -- 0:00:26
544000 -- (-760.932) [-760.907] (-761.666) (-762.189) * (-763.331) (-759.036) [-758.564] (-760.589) -- 0:00:26
544500 -- (-760.157) (-762.642) (-764.571) [-761.769] * (-763.785) [-758.304] (-759.737) (-759.300) -- 0:00:26
545000 -- (-766.907) [-760.800] (-761.939) (-758.384) * (-760.822) (-761.748) [-758.450] (-759.496) -- 0:00:26
Average standard deviation of split frequencies: 0.010217
545500 -- [-759.225] (-761.842) (-757.949) (-759.146) * (-763.096) (-759.995) [-760.834] (-760.796) -- 0:00:26
546000 -- [-758.196] (-760.493) (-758.713) (-759.708) * [-761.082] (-759.989) (-758.325) (-761.903) -- 0:00:26
546500 -- (-761.661) (-760.639) [-763.570] (-760.776) * [-759.957] (-760.861) (-760.404) (-760.876) -- 0:00:26
547000 -- [-761.876] (-760.857) (-759.573) (-761.865) * (-757.702) (-759.891) [-759.904] (-759.564) -- 0:00:27
547500 -- (-764.280) (-759.868) (-759.467) [-760.880] * [-758.322] (-761.480) (-759.172) (-762.483) -- 0:00:27
548000 -- (-759.639) (-758.888) (-760.189) [-761.723] * (-758.011) [-762.007] (-759.770) (-760.169) -- 0:00:27
548500 -- (-761.003) [-758.567] (-759.351) (-759.339) * (-758.587) [-761.369] (-758.856) (-762.401) -- 0:00:27
549000 -- [-758.848] (-760.007) (-759.885) (-762.317) * (-760.843) [-760.008] (-762.481) (-758.695) -- 0:00:27
549500 -- (-759.689) [-759.108] (-758.757) (-763.029) * (-761.329) [-759.540] (-760.357) (-760.150) -- 0:00:27
550000 -- (-760.683) (-760.611) [-762.119] (-760.791) * [-758.775] (-762.261) (-760.298) (-762.743) -- 0:00:27
Average standard deviation of split frequencies: 0.010827
550500 -- (-761.358) (-760.091) [-760.968] (-759.071) * (-758.800) (-758.257) (-758.929) [-760.228] -- 0:00:26
551000 -- (-768.286) [-759.900] (-760.158) (-758.795) * (-762.979) (-761.153) (-761.703) [-761.694] -- 0:00:26
551500 -- (-759.572) [-759.708] (-758.845) (-759.520) * (-765.840) [-761.214] (-758.474) (-763.825) -- 0:00:26
552000 -- (-760.314) (-759.381) [-759.064] (-758.187) * (-759.360) [-758.631] (-759.634) (-760.688) -- 0:00:26
552500 -- (-759.749) (-760.014) (-757.909) [-758.305] * (-760.071) (-758.315) [-758.635] (-760.809) -- 0:00:26
553000 -- (-760.833) (-761.621) (-759.933) [-760.644] * [-760.891] (-760.213) (-762.370) (-761.334) -- 0:00:26
553500 -- [-759.611] (-759.982) (-762.703) (-759.024) * (-764.667) (-758.502) [-762.104] (-765.177) -- 0:00:26
554000 -- (-763.437) (-759.045) [-760.016] (-760.028) * [-759.719] (-761.930) (-758.986) (-757.959) -- 0:00:26
554500 -- (-760.214) [-758.888] (-758.825) (-760.153) * (-764.092) [-759.531] (-760.359) (-762.901) -- 0:00:26
555000 -- (-763.874) (-760.241) (-760.086) [-761.485] * (-761.892) [-761.079] (-760.297) (-759.324) -- 0:00:26
Average standard deviation of split frequencies: 0.010916
555500 -- (-759.213) (-759.879) (-759.691) [-760.195] * (-759.185) (-759.610) [-761.538] (-760.178) -- 0:00:26
556000 -- [-761.427] (-758.938) (-759.743) (-759.564) * (-762.120) [-759.428] (-762.776) (-761.795) -- 0:00:26
556500 -- (-758.811) (-760.375) (-759.264) [-758.883] * (-765.884) (-761.114) [-764.274] (-759.120) -- 0:00:26
557000 -- [-759.035] (-758.437) (-758.351) (-760.403) * (-761.069) (-759.249) (-761.927) [-760.551] -- 0:00:26
557500 -- (-759.484) [-758.436] (-766.901) (-759.795) * [-759.174] (-760.411) (-761.752) (-758.517) -- 0:00:26
558000 -- (-761.518) [-758.539] (-760.783) (-760.630) * (-759.711) (-758.464) (-758.932) [-758.454] -- 0:00:26
558500 -- (-760.307) [-762.629] (-759.571) (-760.811) * (-762.641) [-759.150] (-758.404) (-759.016) -- 0:00:26
559000 -- (-760.696) (-759.945) (-759.927) [-763.738] * [-761.489] (-760.702) (-759.329) (-758.164) -- 0:00:26
559500 -- (-764.486) (-767.112) (-761.297) [-761.509] * (-762.455) (-757.906) (-759.995) [-758.344] -- 0:00:25
560000 -- (-762.199) (-759.513) [-760.104] (-758.113) * (-761.735) (-759.633) [-759.977] (-758.557) -- 0:00:25
Average standard deviation of split frequencies: 0.010720
560500 -- (-758.322) (-758.544) (-759.807) [-758.142] * [-769.002] (-757.808) (-766.602) (-758.073) -- 0:00:25
561000 -- [-760.800] (-761.964) (-759.692) (-759.125) * (-764.986) [-759.115] (-762.936) (-757.638) -- 0:00:25
561500 -- (-760.015) (-760.631) [-758.910] (-759.679) * (-767.248) [-760.131] (-761.801) (-758.285) -- 0:00:25
562000 -- (-761.878) [-759.259] (-759.116) (-761.705) * [-760.307] (-759.493) (-758.898) (-761.865) -- 0:00:25
562500 -- (-761.684) (-758.414) (-759.329) [-760.538] * (-762.941) (-760.606) (-759.144) [-761.015] -- 0:00:25
563000 -- (-760.068) (-758.917) [-758.639] (-761.261) * (-760.836) (-761.335) [-762.576] (-760.719) -- 0:00:25
563500 -- (-759.755) [-758.387] (-758.736) (-760.540) * (-758.458) [-760.097] (-760.444) (-759.051) -- 0:00:25
564000 -- (-757.711) [-758.417] (-758.242) (-761.555) * (-758.239) (-760.703) [-760.728] (-758.306) -- 0:00:26
564500 -- (-757.820) [-758.175] (-760.183) (-760.255) * [-758.234] (-759.542) (-758.414) (-763.657) -- 0:00:26
565000 -- (-759.552) (-761.020) (-759.438) [-759.547] * [-758.361] (-759.801) (-759.881) (-761.086) -- 0:00:26
Average standard deviation of split frequencies: 0.011366
565500 -- (-758.851) (-760.268) (-758.680) [-760.691] * [-757.479] (-761.338) (-759.792) (-758.697) -- 0:00:26
566000 -- (-758.158) (-764.326) [-761.341] (-757.803) * (-762.163) (-759.709) [-760.074] (-759.677) -- 0:00:26
566500 -- (-761.132) [-758.666] (-761.729) (-757.792) * [-760.396] (-762.702) (-758.810) (-760.148) -- 0:00:26
567000 -- [-762.754] (-758.635) (-759.722) (-761.175) * (-760.018) [-759.635] (-758.318) (-760.173) -- 0:00:25
567500 -- [-758.684] (-759.561) (-759.584) (-759.847) * (-765.928) (-761.216) [-759.913] (-760.559) -- 0:00:25
568000 -- (-759.176) (-758.997) (-759.799) [-759.959] * (-761.652) (-760.614) (-760.009) [-759.968] -- 0:00:25
568500 -- (-758.731) (-762.881) [-759.717] (-758.036) * (-763.483) [-757.946] (-759.010) (-760.744) -- 0:00:25
569000 -- [-760.343] (-765.106) (-759.418) (-759.605) * (-763.902) (-757.906) (-760.397) [-757.706] -- 0:00:25
569500 -- (-760.729) (-761.281) (-763.258) [-757.761] * (-763.517) (-760.456) (-759.061) [-759.568] -- 0:00:25
570000 -- (-761.676) (-762.213) [-757.863] (-760.045) * (-763.239) [-758.479] (-758.757) (-762.284) -- 0:00:25
Average standard deviation of split frequencies: 0.011565
570500 -- (-758.345) (-762.664) [-758.161] (-760.941) * [-762.001] (-764.096) (-762.277) (-761.455) -- 0:00:25
571000 -- (-757.876) (-760.145) [-760.488] (-758.861) * [-759.135] (-763.003) (-762.960) (-760.181) -- 0:00:25
571500 -- [-761.746] (-758.978) (-758.138) (-761.765) * (-758.797) (-762.249) (-762.147) [-758.732] -- 0:00:25
572000 -- (-760.937) (-760.361) (-758.132) [-761.001] * (-759.402) (-760.814) [-765.228] (-759.793) -- 0:00:25
572500 -- (-759.387) [-760.224] (-764.436) (-761.765) * (-760.575) [-758.319] (-759.982) (-760.842) -- 0:00:25
573000 -- [-762.165] (-762.126) (-758.745) (-757.779) * (-758.270) (-758.555) (-759.137) [-758.982] -- 0:00:25
573500 -- [-761.266] (-759.726) (-761.002) (-759.181) * (-758.409) (-767.032) (-761.650) [-758.880] -- 0:00:25
574000 -- [-758.059] (-761.996) (-759.566) (-759.128) * (-759.077) (-759.677) [-761.474] (-758.208) -- 0:00:25
574500 -- [-759.506] (-760.012) (-759.176) (-763.059) * (-759.411) [-757.884] (-759.527) (-760.723) -- 0:00:25
575000 -- [-758.586] (-759.566) (-759.938) (-761.297) * (-759.127) [-760.705] (-758.472) (-759.904) -- 0:00:25
Average standard deviation of split frequencies: 0.010776
575500 -- [-758.721] (-761.150) (-760.457) (-758.990) * (-758.348) (-760.678) [-758.681] (-759.588) -- 0:00:25
576000 -- (-761.693) [-758.341] (-764.544) (-761.673) * [-758.369] (-763.346) (-758.420) (-760.168) -- 0:00:25
576500 -- [-759.411] (-759.442) (-762.088) (-761.691) * (-758.906) [-761.921] (-758.879) (-760.925) -- 0:00:24
577000 -- [-759.393] (-758.460) (-761.038) (-759.675) * (-757.907) [-765.200] (-758.414) (-758.656) -- 0:00:24
577500 -- (-760.387) (-760.391) [-758.763] (-766.869) * [-758.324] (-766.720) (-759.681) (-763.121) -- 0:00:24
578000 -- (-761.056) (-759.151) (-759.095) [-757.899] * (-759.022) (-759.185) [-760.288] (-762.101) -- 0:00:24
578500 -- (-759.471) (-759.271) (-758.146) [-759.522] * (-762.343) [-759.198] (-760.114) (-760.263) -- 0:00:24
579000 -- (-762.306) (-759.614) [-764.532] (-759.300) * (-759.618) (-758.993) [-759.571] (-761.573) -- 0:00:24
579500 -- (-758.119) (-759.193) [-757.988] (-758.899) * [-759.211] (-760.367) (-758.987) (-758.631) -- 0:00:24
580000 -- (-760.433) [-761.867] (-759.273) (-762.660) * (-759.492) (-757.742) (-759.227) [-759.774] -- 0:00:24
Average standard deviation of split frequencies: 0.011270
580500 -- [-760.450] (-760.086) (-761.163) (-760.668) * (-758.744) (-759.122) (-760.118) [-759.319] -- 0:00:24
581000 -- (-761.688) (-760.777) [-759.912] (-758.210) * (-760.059) [-760.456] (-759.634) (-761.326) -- 0:00:25
581500 -- [-759.773] (-759.365) (-758.065) (-760.874) * (-760.506) [-759.925] (-760.126) (-759.467) -- 0:00:25
582000 -- (-760.891) (-759.262) [-757.613] (-761.614) * (-758.351) [-759.460] (-761.819) (-765.373) -- 0:00:25
582500 -- (-762.906) [-758.521] (-759.706) (-764.724) * (-761.236) (-760.316) [-758.778] (-761.687) -- 0:00:25
583000 -- (-759.376) (-762.245) (-762.458) [-761.858] * (-758.045) (-760.585) [-759.185] (-759.183) -- 0:00:25
583500 -- [-759.830] (-760.497) (-760.111) (-759.092) * (-757.960) [-759.959] (-760.374) (-758.075) -- 0:00:24
584000 -- (-759.387) (-761.534) [-760.245] (-760.880) * (-764.199) (-759.621) [-760.474] (-759.284) -- 0:00:24
584500 -- [-760.272] (-758.878) (-758.599) (-759.344) * [-762.505] (-759.281) (-760.182) (-763.631) -- 0:00:24
585000 -- (-759.192) (-762.013) [-758.732] (-759.664) * [-762.796] (-759.872) (-759.493) (-760.068) -- 0:00:24
Average standard deviation of split frequencies: 0.010789
585500 -- (-763.113) [-758.686] (-757.649) (-760.685) * (-763.719) (-758.687) [-758.658] (-758.214) -- 0:00:24
586000 -- (-759.954) (-761.590) [-757.732] (-758.889) * (-759.606) (-759.219) (-758.694) [-758.574] -- 0:00:24
586500 -- (-759.839) [-758.930] (-758.115) (-760.060) * (-761.749) (-758.647) [-759.104] (-758.967) -- 0:00:24
587000 -- (-759.293) [-760.423] (-758.499) (-761.545) * (-761.311) (-760.177) (-759.255) [-757.831] -- 0:00:24
587500 -- (-759.182) (-762.394) (-762.339) [-759.532] * (-763.045) (-760.824) [-759.406] (-758.841) -- 0:00:24
588000 -- (-758.667) [-762.220] (-759.832) (-759.790) * (-767.181) (-757.986) [-758.665] (-760.883) -- 0:00:24
588500 -- (-758.158) (-758.068) [-760.252] (-759.535) * (-760.396) (-758.439) [-758.837] (-762.151) -- 0:00:24
589000 -- (-761.186) [-758.790] (-759.055) (-760.378) * (-761.099) (-758.837) (-757.670) [-761.904] -- 0:00:24
589500 -- (-760.963) [-760.081] (-763.370) (-761.544) * (-767.725) [-758.425] (-758.734) (-760.563) -- 0:00:24
590000 -- [-759.947] (-760.792) (-759.223) (-761.138) * (-764.361) (-758.433) [-758.668] (-759.342) -- 0:00:24
Average standard deviation of split frequencies: 0.010798
590500 -- (-759.462) (-761.666) (-758.954) [-760.665] * (-763.435) (-759.056) [-759.806] (-759.227) -- 0:00:24
591000 -- (-762.952) (-764.330) [-757.642] (-758.667) * (-759.060) (-760.467) (-760.925) [-758.954] -- 0:00:24
591500 -- [-759.836] (-771.413) (-758.546) (-759.084) * (-758.269) [-760.955] (-764.165) (-759.930) -- 0:00:24
592000 -- [-759.617] (-762.751) (-760.605) (-757.820) * (-759.641) (-758.979) [-759.723] (-757.847) -- 0:00:24
592500 -- [-758.119] (-760.377) (-759.891) (-762.216) * [-758.344] (-758.502) (-758.022) (-757.992) -- 0:00:24
593000 -- (-757.914) [-759.121] (-759.592) (-765.171) * (-761.169) [-759.493] (-760.081) (-760.942) -- 0:00:24
593500 -- (-760.947) (-758.644) [-757.741] (-758.089) * (-757.785) (-760.000) [-758.961] (-761.651) -- 0:00:23
594000 -- [-760.586] (-759.553) (-758.925) (-757.707) * (-758.382) (-761.825) (-761.140) [-764.571] -- 0:00:23
594500 -- (-760.565) (-759.624) [-758.434] (-762.269) * (-759.854) (-763.597) [-758.492] (-761.567) -- 0:00:23
595000 -- [-760.419] (-762.071) (-758.373) (-761.679) * (-760.475) (-760.663) (-761.224) [-759.139] -- 0:00:23
Average standard deviation of split frequencies: 0.010655
595500 -- (-760.012) (-762.938) (-765.105) [-759.465] * [-760.646] (-759.714) (-761.680) (-763.348) -- 0:00:23
596000 -- [-761.213] (-767.232) (-759.740) (-758.017) * (-763.517) (-761.835) [-761.261] (-758.683) -- 0:00:23
596500 -- [-759.589] (-766.134) (-765.195) (-760.023) * (-759.801) [-764.986] (-764.305) (-759.467) -- 0:00:23
597000 -- (-760.489) (-760.488) (-759.441) [-760.602] * [-758.633] (-765.359) (-762.182) (-758.443) -- 0:00:23
597500 -- [-761.470] (-758.829) (-758.557) (-766.389) * (-761.324) (-758.315) (-758.815) [-758.997] -- 0:00:24
598000 -- (-762.495) (-761.284) (-761.309) [-758.920] * [-760.933] (-762.983) (-762.459) (-760.344) -- 0:00:24
598500 -- [-768.633] (-760.913) (-760.917) (-759.280) * (-760.544) [-760.434] (-760.373) (-758.581) -- 0:00:24
599000 -- (-766.599) [-759.249] (-762.740) (-760.683) * (-760.153) (-759.383) [-760.449] (-762.903) -- 0:00:24
599500 -- (-760.326) [-758.969] (-758.972) (-762.615) * (-758.180) [-758.869] (-760.068) (-759.506) -- 0:00:24
600000 -- (-760.785) [-760.288] (-769.073) (-759.823) * (-760.958) (-759.223) (-759.562) [-758.694] -- 0:00:24
Average standard deviation of split frequencies: 0.011031
600500 -- (-758.773) (-757.899) [-761.928] (-760.262) * (-759.642) [-760.380] (-759.180) (-761.837) -- 0:00:23
601000 -- [-761.548] (-759.574) (-760.405) (-761.448) * (-760.672) (-758.801) (-760.932) [-764.615] -- 0:00:23
601500 -- (-758.933) (-760.752) [-759.007] (-761.784) * (-759.777) [-761.314] (-760.653) (-759.915) -- 0:00:23
602000 -- (-758.117) (-760.993) [-758.300] (-766.226) * (-762.262) (-758.433) [-761.879] (-760.056) -- 0:00:23
602500 -- (-760.479) (-765.116) [-758.632] (-759.307) * (-764.538) [-759.886] (-760.774) (-761.704) -- 0:00:23
603000 -- [-760.332] (-763.357) (-760.416) (-766.674) * (-757.651) [-761.614] (-759.490) (-762.239) -- 0:00:23
603500 -- (-759.599) (-766.589) [-760.174] (-758.539) * (-759.122) (-760.498) (-765.059) [-758.955] -- 0:00:23
604000 -- (-762.317) (-760.526) (-760.949) [-758.275] * [-757.973] (-758.838) (-759.022) (-759.034) -- 0:00:23
604500 -- [-758.305] (-758.616) (-758.312) (-759.352) * (-762.843) (-761.738) [-758.954] (-761.439) -- 0:00:23
605000 -- (-758.541) (-757.890) [-759.507] (-762.092) * [-758.437] (-766.689) (-759.028) (-759.571) -- 0:00:23
Average standard deviation of split frequencies: 0.011409
605500 -- (-758.880) (-757.791) (-759.423) [-758.058] * (-759.909) [-758.462] (-759.372) (-760.807) -- 0:00:23
606000 -- [-758.865] (-760.873) (-760.031) (-759.365) * (-765.446) [-758.544] (-759.332) (-767.399) -- 0:00:23
606500 -- (-759.865) [-760.451] (-762.251) (-758.496) * (-760.135) [-759.751] (-759.832) (-765.152) -- 0:00:23
607000 -- (-760.476) (-759.590) (-763.242) [-760.373] * [-758.953] (-762.145) (-763.029) (-759.296) -- 0:00:23
607500 -- (-758.450) [-760.604] (-764.374) (-758.533) * (-758.111) (-758.696) (-760.071) [-759.529] -- 0:00:23
608000 -- (-758.705) [-759.818] (-760.241) (-760.424) * (-759.305) [-760.415] (-760.496) (-761.819) -- 0:00:23
608500 -- [-758.608] (-761.910) (-762.232) (-760.076) * (-759.797) [-760.275] (-760.073) (-762.427) -- 0:00:23
609000 -- (-758.514) (-763.007) [-761.147] (-761.337) * [-757.851] (-762.048) (-759.341) (-759.799) -- 0:00:23
609500 -- (-759.637) (-761.328) (-762.514) [-757.959] * (-759.232) (-758.800) (-758.758) [-757.924] -- 0:00:23
610000 -- [-759.744] (-760.792) (-762.429) (-761.685) * (-759.713) (-758.075) [-758.727] (-760.610) -- 0:00:23
Average standard deviation of split frequencies: 0.011022
610500 -- (-760.568) (-758.194) [-761.894] (-758.630) * [-759.129] (-758.075) (-760.199) (-760.032) -- 0:00:22
611000 -- [-759.359] (-759.310) (-758.928) (-759.413) * (-760.837) [-759.068] (-759.056) (-763.293) -- 0:00:22
611500 -- (-760.899) (-761.694) (-758.836) [-760.579] * [-758.199] (-761.987) (-760.045) (-760.714) -- 0:00:22
612000 -- [-758.258] (-764.185) (-758.118) (-759.025) * [-759.631] (-763.108) (-758.733) (-760.086) -- 0:00:22
612500 -- [-758.299] (-761.706) (-759.847) (-760.323) * (-760.674) [-760.239] (-758.491) (-764.261) -- 0:00:22
613000 -- (-760.615) (-760.442) (-761.328) [-758.747] * [-758.777] (-757.812) (-758.724) (-763.688) -- 0:00:22
613500 -- [-759.466] (-762.857) (-759.533) (-765.841) * (-758.787) (-757.847) [-758.658] (-763.163) -- 0:00:22
614000 -- [-760.490] (-765.770) (-759.891) (-760.969) * (-759.562) (-759.656) (-759.253) [-760.289] -- 0:00:22
614500 -- (-760.026) (-761.792) (-758.902) [-759.018] * [-758.413] (-760.834) (-761.091) (-759.286) -- 0:00:23
615000 -- (-759.052) [-760.725] (-757.895) (-761.891) * (-757.838) [-759.026] (-762.018) (-758.978) -- 0:00:23
Average standard deviation of split frequencies: 0.010624
615500 -- (-757.895) (-760.390) (-758.183) [-760.642] * (-760.281) [-758.120] (-758.860) (-762.114) -- 0:00:23
616000 -- (-763.255) (-758.977) [-761.141] (-759.793) * (-761.234) (-760.516) [-760.490] (-757.603) -- 0:00:23
616500 -- (-761.001) (-758.963) (-761.688) [-758.912] * (-761.767) (-761.843) (-759.561) [-761.845] -- 0:00:23
617000 -- (-759.224) (-760.016) [-760.702] (-760.611) * (-759.833) (-760.664) [-758.584] (-766.922) -- 0:00:22
617500 -- [-760.374] (-759.135) (-758.332) (-759.510) * (-759.451) [-761.044] (-758.420) (-758.429) -- 0:00:22
618000 -- (-760.089) (-759.735) (-760.629) [-758.665] * (-759.581) [-760.050] (-759.177) (-758.442) -- 0:00:22
618500 -- (-760.478) (-759.648) [-762.472] (-758.410) * (-760.577) [-762.945] (-760.214) (-762.821) -- 0:00:22
619000 -- (-762.864) (-758.301) [-759.589] (-759.799) * (-763.173) (-759.166) [-760.110] (-760.129) -- 0:00:22
619500 -- (-762.634) (-759.233) (-761.664) [-760.124] * (-759.913) (-760.856) (-763.808) [-760.785] -- 0:00:22
620000 -- (-760.905) (-758.900) (-758.141) [-763.326] * (-758.040) [-759.748] (-758.309) (-759.822) -- 0:00:22
Average standard deviation of split frequencies: 0.010186
620500 -- (-759.684) (-758.656) (-761.006) [-757.626] * (-759.026) [-758.303] (-759.865) (-760.228) -- 0:00:22
621000 -- [-761.068] (-758.415) (-758.164) (-759.158) * [-761.604] (-758.007) (-758.640) (-761.216) -- 0:00:22
621500 -- (-759.066) (-759.673) [-758.995] (-761.375) * (-760.266) (-760.377) (-758.328) [-761.689] -- 0:00:22
622000 -- [-765.030] (-763.593) (-758.008) (-761.419) * [-761.001] (-759.594) (-760.352) (-761.128) -- 0:00:22
622500 -- (-761.153) [-761.502] (-762.119) (-758.770) * [-757.915] (-760.641) (-760.339) (-759.490) -- 0:00:22
623000 -- (-759.537) [-759.684] (-761.402) (-760.456) * (-759.886) (-761.732) [-759.787] (-759.896) -- 0:00:22
623500 -- (-757.962) [-757.854] (-762.039) (-759.983) * (-759.908) [-759.930] (-759.906) (-762.573) -- 0:00:22
624000 -- [-761.004] (-760.491) (-758.345) (-759.110) * (-759.502) (-764.062) (-760.062) [-762.279] -- 0:00:22
624500 -- (-759.017) (-759.026) (-761.521) [-759.544] * (-762.874) (-759.029) (-761.222) [-760.419] -- 0:00:22
625000 -- (-766.387) [-758.826] (-765.597) (-761.832) * [-758.846] (-761.888) (-759.381) (-758.101) -- 0:00:22
Average standard deviation of split frequencies: 0.009413
625500 -- (-764.059) (-758.341) [-759.883] (-763.351) * [-760.099] (-761.866) (-759.418) (-767.634) -- 0:00:22
626000 -- (-763.780) (-759.904) (-757.975) [-758.826] * (-758.140) [-759.477] (-758.746) (-759.261) -- 0:00:22
626500 -- (-758.209) (-759.610) [-760.158] (-757.842) * (-759.298) (-762.505) [-758.205] (-762.098) -- 0:00:22
627000 -- (-758.236) (-757.633) [-759.412] (-758.537) * (-760.544) (-758.336) [-758.972] (-758.392) -- 0:00:22
627500 -- (-759.300) (-760.677) [-758.235] (-760.503) * [-758.912] (-760.908) (-757.926) (-762.543) -- 0:00:21
628000 -- (-765.680) (-759.024) [-759.067] (-760.512) * (-759.961) (-763.293) (-760.333) [-758.937] -- 0:00:21
628500 -- [-759.537] (-760.581) (-760.223) (-761.126) * (-759.363) (-760.015) (-758.588) [-758.575] -- 0:00:21
629000 -- [-759.102] (-760.293) (-759.067) (-759.123) * (-759.379) (-759.281) [-758.136] (-760.351) -- 0:00:21
629500 -- (-758.301) [-760.220] (-761.272) (-765.293) * [-761.674] (-759.278) (-759.542) (-760.686) -- 0:00:21
630000 -- (-759.779) (-759.344) (-760.614) [-761.233] * (-760.423) (-758.129) [-758.628] (-761.551) -- 0:00:21
Average standard deviation of split frequencies: 0.009497
630500 -- (-758.186) (-759.943) (-758.890) [-760.080] * (-758.521) (-761.945) (-758.537) [-758.013] -- 0:00:21
631000 -- (-761.508) [-759.566] (-759.684) (-758.461) * (-759.652) [-760.237] (-758.852) (-760.930) -- 0:00:22
631500 -- (-763.003) (-761.258) (-759.452) [-760.489] * (-759.001) (-763.024) [-759.878] (-758.400) -- 0:00:22
632000 -- [-762.991] (-758.910) (-766.092) (-759.041) * [-759.992] (-765.525) (-760.397) (-761.816) -- 0:00:22
632500 -- (-765.201) [-760.502] (-761.768) (-760.082) * (-761.269) (-759.687) [-758.405] (-758.071) -- 0:00:22
633000 -- [-762.014] (-762.008) (-758.968) (-761.192) * [-760.646] (-759.892) (-759.539) (-761.752) -- 0:00:22
633500 -- [-758.344] (-761.552) (-759.923) (-761.112) * (-760.288) (-759.893) [-758.510] (-761.084) -- 0:00:21
634000 -- (-758.777) [-758.705] (-763.231) (-760.439) * (-760.829) (-759.670) [-758.745] (-760.923) -- 0:00:21
634500 -- (-760.026) (-759.226) [-759.015] (-760.380) * (-759.955) (-761.445) (-758.654) [-759.679] -- 0:00:21
635000 -- (-759.523) (-758.370) (-757.741) [-758.902] * [-759.666] (-768.039) (-764.255) (-758.829) -- 0:00:21
Average standard deviation of split frequencies: 0.009636
635500 -- (-761.912) (-760.730) [-759.602] (-760.358) * (-758.816) (-759.528) (-761.158) [-761.224] -- 0:00:21
636000 -- (-758.989) (-759.890) (-760.525) [-758.446] * (-759.635) (-759.063) [-760.861] (-759.846) -- 0:00:21
636500 -- (-761.503) (-759.696) (-758.798) [-758.867] * (-760.117) [-758.679] (-761.490) (-762.437) -- 0:00:21
637000 -- (-761.813) (-759.098) (-758.088) [-759.982] * (-759.181) [-758.710] (-763.849) (-761.799) -- 0:00:21
637500 -- (-763.714) (-761.253) [-759.618] (-760.565) * (-759.154) (-760.332) [-761.299] (-760.118) -- 0:00:21
638000 -- [-761.064] (-761.468) (-759.741) (-759.357) * (-765.593) (-761.266) [-759.769] (-761.384) -- 0:00:21
638500 -- (-760.073) (-760.678) [-760.408] (-764.468) * (-760.257) [-760.072] (-760.744) (-760.297) -- 0:00:21
639000 -- (-762.656) (-760.650) [-760.854] (-760.518) * (-762.041) (-765.729) [-759.441] (-762.518) -- 0:00:21
639500 -- (-761.614) [-762.058] (-764.148) (-763.572) * (-758.059) (-759.662) (-759.531) [-759.279] -- 0:00:21
640000 -- [-760.954] (-758.931) (-758.459) (-758.947) * (-761.016) (-759.838) [-758.013] (-762.374) -- 0:00:21
Average standard deviation of split frequencies: 0.009695
640500 -- (-758.928) [-758.364] (-761.434) (-758.677) * (-759.770) [-758.695] (-760.374) (-759.283) -- 0:00:21
641000 -- (-760.375) (-760.008) (-759.719) [-759.784] * (-760.856) (-761.646) [-758.738] (-762.453) -- 0:00:21
641500 -- (-759.219) (-761.300) (-761.660) [-758.939] * (-760.307) [-758.175] (-758.800) (-761.367) -- 0:00:21
642000 -- [-759.290] (-766.284) (-762.178) (-759.984) * (-761.887) (-759.903) [-759.374] (-759.526) -- 0:00:21
642500 -- (-759.163) (-759.358) (-760.250) [-758.591] * (-759.276) (-764.195) [-759.224] (-761.437) -- 0:00:21
643000 -- (-759.340) [-759.663] (-761.044) (-759.552) * (-763.757) (-761.047) [-760.423] (-758.318) -- 0:00:21
643500 -- [-761.695] (-761.420) (-759.071) (-765.821) * (-760.124) (-758.658) (-761.221) [-759.254] -- 0:00:21
644000 -- (-761.167) [-760.138] (-759.036) (-759.860) * (-764.238) [-759.882] (-768.073) (-758.270) -- 0:00:21
644500 -- (-759.527) (-759.964) (-762.983) [-759.612] * (-761.424) (-761.280) (-764.032) [-759.953] -- 0:00:20
645000 -- [-762.952] (-761.001) (-759.990) (-760.416) * (-761.617) (-760.439) (-764.072) [-759.090] -- 0:00:20
Average standard deviation of split frequencies: 0.009787
645500 -- (-761.181) (-758.761) (-759.990) [-762.164] * (-762.633) [-759.233] (-760.978) (-759.730) -- 0:00:20
646000 -- (-761.489) [-761.727] (-759.213) (-759.916) * (-759.008) (-765.750) [-759.728] (-759.604) -- 0:00:20
646500 -- (-758.733) (-760.246) (-758.778) [-761.989] * [-760.048] (-760.187) (-761.402) (-758.503) -- 0:00:20
647000 -- (-761.098) [-761.780] (-760.243) (-760.740) * [-760.622] (-759.117) (-759.276) (-759.093) -- 0:00:20
647500 -- (-762.455) (-761.355) [-762.621] (-758.682) * [-759.294] (-768.315) (-761.281) (-759.115) -- 0:00:21
648000 -- (-762.832) (-760.244) [-758.719] (-758.972) * [-759.466] (-759.381) (-759.903) (-760.268) -- 0:00:21
648500 -- (-759.991) (-763.262) [-759.208] (-759.854) * (-761.611) [-758.731] (-758.926) (-762.228) -- 0:00:21
649000 -- (-759.412) [-759.546] (-761.360) (-757.809) * (-759.888) (-758.595) [-758.454] (-759.763) -- 0:00:21
649500 -- (-761.243) (-762.181) [-760.361] (-759.516) * (-758.863) (-762.597) [-761.448] (-757.787) -- 0:00:21
650000 -- (-762.964) [-762.219] (-760.732) (-761.448) * (-760.593) (-759.783) [-758.085] (-759.970) -- 0:00:21
Average standard deviation of split frequencies: 0.009717
650500 -- (-761.381) (-759.870) (-760.586) [-760.409] * (-761.205) (-760.562) [-758.014] (-759.989) -- 0:00:20
651000 -- (-758.116) (-762.254) (-760.584) [-761.272] * [-759.484] (-760.735) (-759.775) (-761.500) -- 0:00:20
651500 -- [-759.398] (-759.316) (-758.695) (-760.685) * (-760.830) [-759.146] (-758.967) (-761.661) -- 0:00:20
652000 -- [-760.684] (-761.804) (-758.243) (-759.403) * [-759.761] (-760.410) (-762.148) (-761.521) -- 0:00:20
652500 -- (-765.606) [-762.640] (-759.134) (-759.591) * (-759.022) [-761.704] (-760.150) (-761.664) -- 0:00:20
653000 -- (-761.729) [-758.150] (-760.594) (-759.443) * (-760.147) (-762.592) [-762.223] (-763.310) -- 0:00:20
653500 -- (-759.224) [-759.155] (-761.549) (-759.032) * [-763.165] (-762.270) (-760.662) (-763.986) -- 0:00:20
654000 -- (-760.122) (-758.288) (-763.370) [-759.704] * (-761.057) (-763.399) [-758.404] (-759.904) -- 0:00:20
654500 -- (-761.402) (-761.369) (-760.909) [-759.548] * (-760.657) [-759.283] (-758.439) (-762.818) -- 0:00:20
655000 -- (-758.884) (-761.369) (-761.317) [-758.764] * (-764.549) [-759.034] (-758.437) (-759.284) -- 0:00:20
Average standard deviation of split frequencies: 0.009257
655500 -- (-757.780) [-760.262] (-760.314) (-767.337) * (-768.342) (-759.620) (-757.861) [-759.254] -- 0:00:20
656000 -- (-758.912) [-760.656] (-759.854) (-763.152) * (-759.556) (-758.152) (-762.522) [-761.633] -- 0:00:20
656500 -- (-761.310) (-761.497) [-759.772] (-759.639) * [-759.244] (-764.244) (-761.573) (-759.935) -- 0:00:20
657000 -- [-765.579] (-758.933) (-758.900) (-761.503) * (-758.852) [-760.228] (-761.378) (-758.342) -- 0:00:20
657500 -- [-760.190] (-760.032) (-759.622) (-759.689) * (-760.268) [-760.229] (-760.345) (-762.417) -- 0:00:20
658000 -- (-762.825) (-761.800) (-758.681) [-758.453] * [-758.322] (-760.807) (-759.593) (-758.087) -- 0:00:20
658500 -- (-762.220) [-758.017] (-759.884) (-761.081) * [-763.309] (-760.672) (-758.922) (-761.883) -- 0:00:20
659000 -- [-760.637] (-759.089) (-759.206) (-761.200) * [-758.470] (-759.819) (-759.335) (-761.808) -- 0:00:20
659500 -- (-758.807) [-759.830] (-758.323) (-759.405) * (-762.267) (-758.888) [-757.725] (-758.854) -- 0:00:20
660000 -- (-758.687) [-763.559] (-759.268) (-759.800) * (-759.299) (-759.128) [-757.730] (-759.670) -- 0:00:20
Average standard deviation of split frequencies: 0.008352
660500 -- (-758.479) [-759.124] (-762.234) (-758.939) * (-760.033) (-758.653) [-759.874] (-760.973) -- 0:00:20
661000 -- (-758.141) (-757.976) [-761.100] (-758.522) * (-763.329) [-757.946] (-761.701) (-761.416) -- 0:00:20
661500 -- (-758.151) [-759.723] (-762.802) (-762.165) * (-758.336) (-758.454) [-757.701] (-762.449) -- 0:00:19
662000 -- (-759.293) (-760.634) (-758.140) [-760.935] * (-758.534) (-758.612) [-758.368] (-760.165) -- 0:00:19
662500 -- (-763.042) (-759.556) [-758.481] (-761.438) * (-762.843) [-759.315] (-757.695) (-759.410) -- 0:00:19
663000 -- (-762.149) (-758.439) (-759.023) [-762.055] * [-762.207] (-760.052) (-757.579) (-767.550) -- 0:00:19
663500 -- (-759.211) [-758.682] (-759.219) (-767.689) * (-761.776) (-764.868) [-759.993] (-763.947) -- 0:00:19
664000 -- [-759.069] (-760.606) (-761.937) (-759.995) * (-757.764) (-763.591) (-762.363) [-761.657] -- 0:00:19
664500 -- (-762.427) [-758.876] (-758.448) (-762.312) * (-759.995) [-762.471] (-761.595) (-759.090) -- 0:00:20
665000 -- (-763.505) [-757.839] (-761.358) (-757.928) * (-760.837) (-758.683) (-760.405) [-758.485] -- 0:00:20
Average standard deviation of split frequencies: 0.008411
665500 -- (-761.434) (-758.573) [-759.927] (-758.898) * (-766.925) (-759.871) [-759.530] (-758.503) -- 0:00:20
666000 -- (-762.153) [-758.633] (-760.753) (-759.100) * (-764.158) (-760.430) (-760.568) [-759.832] -- 0:00:20
666500 -- (-760.105) (-761.914) [-761.895] (-758.966) * (-759.431) (-764.174) (-758.668) [-760.088] -- 0:00:20
667000 -- [-759.153] (-759.250) (-762.275) (-758.910) * (-759.724) (-760.481) (-757.900) [-759.017] -- 0:00:19
667500 -- (-759.685) [-758.915] (-760.507) (-758.234) * (-759.923) [-760.011] (-758.126) (-760.970) -- 0:00:19
668000 -- [-758.082] (-761.474) (-762.465) (-760.965) * [-759.795] (-759.766) (-757.551) (-759.112) -- 0:00:19
668500 -- (-758.256) (-764.169) [-763.102] (-762.665) * [-758.503] (-760.095) (-757.578) (-759.908) -- 0:00:19
669000 -- (-758.203) [-759.136] (-763.930) (-760.014) * (-758.339) (-757.936) (-758.353) [-762.837] -- 0:00:19
669500 -- (-758.113) (-758.969) (-758.970) [-760.898] * (-759.296) [-758.390] (-760.902) (-758.050) -- 0:00:19
670000 -- [-758.266] (-759.278) (-759.302) (-760.404) * (-762.025) (-760.446) (-760.312) [-758.859] -- 0:00:19
Average standard deviation of split frequencies: 0.008517
670500 -- [-760.836] (-760.068) (-759.806) (-759.379) * (-762.964) [-759.001] (-761.896) (-760.250) -- 0:00:19
671000 -- [-759.644] (-762.768) (-759.324) (-759.653) * (-761.163) [-759.573] (-762.550) (-758.493) -- 0:00:19
671500 -- [-759.579] (-762.657) (-759.684) (-759.858) * (-763.459) (-760.368) (-762.093) [-760.649] -- 0:00:19
672000 -- (-758.834) (-758.384) [-760.129] (-763.163) * [-759.552] (-762.136) (-762.347) (-759.210) -- 0:00:19
672500 -- (-758.792) [-759.189] (-759.064) (-760.467) * (-761.063) (-762.403) (-762.115) [-759.764] -- 0:00:19
673000 -- (-761.207) [-760.476] (-759.931) (-759.700) * [-758.367] (-759.363) (-758.995) (-762.247) -- 0:00:19
673500 -- [-759.246] (-765.571) (-758.524) (-762.850) * (-759.413) (-760.502) (-758.775) [-757.819] -- 0:00:19
674000 -- [-760.348] (-757.716) (-758.696) (-763.002) * [-757.949] (-765.558) (-762.989) (-757.802) -- 0:00:19
674500 -- (-764.296) (-759.958) [-759.790] (-760.269) * (-761.842) (-759.136) (-759.566) [-758.201] -- 0:00:19
675000 -- (-761.583) (-762.277) [-758.945] (-758.435) * (-763.137) (-757.958) (-761.531) [-761.394] -- 0:00:19
Average standard deviation of split frequencies: 0.008327
675500 -- [-759.624] (-759.709) (-760.350) (-759.908) * (-761.253) (-758.793) (-759.748) [-764.378] -- 0:00:19
676000 -- (-760.425) (-758.320) (-761.220) [-759.250] * (-760.454) (-759.431) [-762.255] (-758.962) -- 0:00:19
676500 -- (-760.273) (-759.504) (-759.549) [-760.181] * (-760.575) (-759.894) (-764.784) [-758.377] -- 0:00:19
677000 -- [-760.769] (-761.911) (-759.076) (-758.454) * (-759.635) (-762.355) [-760.515] (-758.949) -- 0:00:19
677500 -- (-761.135) (-759.084) (-757.829) [-758.468] * (-761.112) (-765.110) (-763.727) [-761.093] -- 0:00:19
678000 -- (-760.567) (-760.974) [-759.267] (-758.841) * (-759.429) (-758.012) (-760.106) [-760.587] -- 0:00:18
678500 -- (-762.281) [-759.861] (-764.885) (-763.692) * (-758.105) (-759.978) (-759.513) [-757.779] -- 0:00:18
679000 -- (-758.495) [-760.253] (-760.024) (-770.713) * [-758.233] (-760.164) (-761.245) (-759.421) -- 0:00:18
679500 -- (-761.295) (-758.210) (-759.578) [-767.683] * (-760.127) (-762.667) (-758.311) [-758.943] -- 0:00:18
680000 -- (-759.777) (-757.946) [-758.835] (-757.761) * (-758.808) (-760.886) (-759.876) [-760.263] -- 0:00:18
Average standard deviation of split frequencies: 0.008311
680500 -- (-762.204) (-760.320) [-759.442] (-758.067) * [-765.168] (-763.471) (-762.821) (-759.719) -- 0:00:18
681000 -- (-758.634) (-759.678) [-759.087] (-759.153) * (-760.539) (-760.915) (-759.849) [-758.516] -- 0:00:19
681500 -- (-758.544) (-758.245) (-758.488) [-758.217] * (-765.862) (-758.283) (-760.046) [-758.447] -- 0:00:19
682000 -- (-760.062) (-762.899) [-759.371] (-758.691) * (-760.064) (-764.261) [-760.325] (-758.724) -- 0:00:19
682500 -- [-759.235] (-759.009) (-760.215) (-759.204) * (-759.539) (-760.730) [-758.720] (-759.872) -- 0:00:19
683000 -- (-760.004) (-759.309) [-757.990] (-761.059) * [-758.282] (-762.300) (-760.529) (-762.653) -- 0:00:19
683500 -- [-760.260] (-767.041) (-757.888) (-759.332) * (-758.137) [-760.324] (-759.756) (-758.667) -- 0:00:18
684000 -- (-761.846) (-762.307) (-761.532) [-759.000] * (-758.494) [-758.587] (-758.518) (-759.172) -- 0:00:18
684500 -- (-762.120) (-765.275) (-758.046) [-764.602] * (-760.023) (-759.783) [-761.226] (-760.764) -- 0:00:18
685000 -- (-765.281) [-759.046] (-760.438) (-759.874) * (-760.875) (-761.348) (-757.981) [-762.098] -- 0:00:18
Average standard deviation of split frequencies: 0.008246
685500 -- (-761.446) (-761.131) [-762.217] (-757.569) * (-759.897) (-764.199) [-759.697] (-761.091) -- 0:00:18
686000 -- (-758.450) (-763.384) (-761.573) [-757.578] * [-762.999] (-763.323) (-761.744) (-759.697) -- 0:00:18
686500 -- [-767.190] (-758.539) (-759.425) (-758.070) * (-761.345) (-762.822) (-760.245) [-758.659] -- 0:00:18
687000 -- (-760.147) (-758.342) (-758.956) [-758.718] * (-763.710) [-758.568] (-759.274) (-760.256) -- 0:00:18
687500 -- [-766.825] (-761.611) (-758.318) (-758.450) * (-759.976) [-761.262] (-761.642) (-757.625) -- 0:00:18
688000 -- (-765.681) (-763.921) (-760.563) [-758.765] * (-757.743) [-761.963] (-758.266) (-758.813) -- 0:00:18
688500 -- (-764.410) (-762.091) (-759.536) [-761.601] * (-761.363) (-759.663) [-758.657] (-758.290) -- 0:00:18
689000 -- (-764.588) [-758.418] (-759.104) (-763.165) * [-761.796] (-761.659) (-760.433) (-763.597) -- 0:00:18
689500 -- (-766.559) [-760.000] (-758.395) (-759.114) * [-759.320] (-761.627) (-763.829) (-764.439) -- 0:00:18
690000 -- (-759.059) (-760.519) [-758.721] (-758.814) * (-758.428) (-761.068) (-761.952) [-758.939] -- 0:00:18
Average standard deviation of split frequencies: 0.007950
690500 -- (-758.723) (-760.243) [-759.290] (-759.507) * (-761.015) [-759.884] (-757.867) (-758.100) -- 0:00:18
691000 -- (-761.030) (-758.758) [-759.782] (-759.124) * (-760.376) (-760.575) (-758.681) [-758.003] -- 0:00:18
691500 -- (-759.431) [-759.570] (-761.275) (-760.691) * [-760.468] (-760.636) (-759.974) (-758.224) -- 0:00:18
692000 -- (-760.400) (-759.343) [-759.389] (-759.584) * [-762.147] (-758.625) (-762.501) (-761.270) -- 0:00:18
692500 -- [-757.906] (-758.689) (-759.375) (-764.188) * (-765.685) (-758.743) (-761.284) [-758.261] -- 0:00:18
693000 -- [-760.733] (-759.333) (-762.552) (-760.784) * (-767.212) (-759.192) [-762.294] (-758.935) -- 0:00:18
693500 -- (-759.667) [-759.313] (-760.857) (-760.803) * (-764.881) (-759.064) (-760.776) [-759.103] -- 0:00:18
694000 -- [-758.080] (-758.335) (-759.130) (-759.565) * [-760.186] (-759.521) (-759.097) (-759.034) -- 0:00:18
694500 -- [-758.825] (-759.378) (-758.636) (-759.734) * [-758.407] (-762.718) (-758.675) (-759.282) -- 0:00:18
695000 -- (-758.111) (-758.976) (-759.357) [-758.828] * (-761.009) (-759.609) [-758.705] (-758.271) -- 0:00:17
Average standard deviation of split frequencies: 0.008890
695500 -- (-759.617) (-759.065) (-760.303) [-758.182] * (-762.989) [-759.217] (-760.558) (-760.429) -- 0:00:17
696000 -- [-758.209] (-763.184) (-760.333) (-758.351) * (-759.069) (-763.196) (-759.155) [-758.893] -- 0:00:17
696500 -- (-758.946) [-757.792] (-763.100) (-759.321) * (-758.184) (-760.682) (-759.691) [-760.972] -- 0:00:17
697000 -- (-758.778) [-759.866] (-759.400) (-762.254) * [-761.359] (-760.271) (-759.996) (-760.292) -- 0:00:17
697500 -- (-761.227) [-758.292] (-760.605) (-758.476) * [-758.350] (-758.250) (-760.106) (-759.363) -- 0:00:18
698000 -- [-762.657] (-759.795) (-765.871) (-758.072) * (-758.374) (-765.968) [-758.624] (-759.550) -- 0:00:18
698500 -- (-758.259) (-760.357) (-760.750) [-758.545] * (-758.306) (-760.410) (-762.671) [-758.549] -- 0:00:18
699000 -- (-758.920) [-759.130] (-764.868) (-759.983) * (-758.793) (-761.510) (-767.028) [-759.827] -- 0:00:18
699500 -- [-758.673] (-763.174) (-763.396) (-762.940) * (-760.436) (-770.295) [-762.715] (-763.505) -- 0:00:18
700000 -- [-759.358] (-761.512) (-758.793) (-759.743) * (-758.454) (-761.017) (-764.689) [-759.091] -- 0:00:18
Average standard deviation of split frequencies: 0.009125
700500 -- (-759.880) (-762.048) (-758.132) [-759.247] * [-758.611] (-761.256) (-762.757) (-761.388) -- 0:00:17
701000 -- (-760.044) (-760.982) [-759.230] (-759.213) * (-759.472) (-761.963) [-758.396] (-760.705) -- 0:00:17
701500 -- (-758.703) (-765.018) (-758.882) [-759.807] * (-759.730) (-760.068) [-758.621] (-761.792) -- 0:00:17
702000 -- (-758.940) [-760.881] (-760.644) (-759.649) * [-759.209] (-762.742) (-763.213) (-761.536) -- 0:00:17
702500 -- (-759.815) [-761.231] (-759.661) (-764.182) * (-760.627) (-762.020) (-760.390) [-758.214] -- 0:00:17
703000 -- (-758.915) (-762.076) [-757.725] (-760.830) * (-757.978) (-758.237) [-759.707] (-762.369) -- 0:00:17
703500 -- (-762.464) [-759.970] (-758.436) (-763.023) * [-763.256] (-758.084) (-759.845) (-761.924) -- 0:00:17
704000 -- (-760.148) (-760.071) [-759.481] (-760.587) * (-760.367) (-760.097) [-759.896] (-762.286) -- 0:00:17
704500 -- (-761.781) [-758.784] (-760.155) (-762.711) * (-761.975) (-761.321) [-761.196] (-763.686) -- 0:00:17
705000 -- (-758.845) (-759.160) [-761.372] (-759.373) * (-763.776) (-757.583) [-759.592] (-762.351) -- 0:00:17
Average standard deviation of split frequencies: 0.009640
705500 -- [-761.255] (-761.852) (-760.395) (-760.282) * [-759.653] (-758.515) (-761.413) (-759.475) -- 0:00:17
706000 -- (-759.260) (-761.157) (-763.737) [-760.472] * (-759.659) [-758.992] (-762.191) (-758.762) -- 0:00:17
706500 -- [-759.849] (-759.118) (-758.883) (-758.340) * [-761.285] (-758.428) (-759.520) (-758.638) -- 0:00:17
707000 -- [-759.040] (-758.980) (-759.046) (-763.127) * [-765.333] (-758.418) (-759.607) (-760.126) -- 0:00:17
707500 -- (-760.217) (-766.592) (-759.975) [-760.357] * (-766.960) (-758.293) [-762.060] (-759.130) -- 0:00:17
708000 -- (-761.100) (-761.952) (-759.762) [-760.321] * (-759.617) (-758.889) (-759.402) [-760.340] -- 0:00:17
708500 -- (-762.615) (-761.041) (-759.474) [-759.989] * (-761.510) (-759.564) [-758.341] (-758.529) -- 0:00:17
709000 -- (-759.929) (-759.542) [-758.803] (-761.148) * (-760.804) [-760.186] (-762.000) (-763.188) -- 0:00:17
709500 -- (-761.095) [-759.593] (-763.652) (-761.039) * [-759.690] (-760.759) (-759.542) (-758.857) -- 0:00:17
710000 -- (-762.558) [-760.213] (-761.587) (-759.067) * (-761.648) [-768.078] (-761.437) (-758.273) -- 0:00:17
Average standard deviation of split frequencies: 0.009452
710500 -- (-758.411) (-759.725) (-759.804) [-759.562] * (-763.287) (-759.385) (-759.501) [-758.581] -- 0:00:17
711000 -- (-759.661) [-758.303] (-761.604) (-760.085) * (-762.751) [-757.678] (-759.780) (-759.568) -- 0:00:17
711500 -- (-759.386) (-760.227) [-759.600] (-759.451) * (-764.435) (-758.144) (-759.433) [-757.974] -- 0:00:17
712000 -- (-760.959) (-758.495) [-760.610] (-760.917) * (-759.431) (-763.280) (-760.488) [-761.354] -- 0:00:16
712500 -- (-763.351) [-762.107] (-760.910) (-760.583) * [-759.515] (-759.444) (-760.095) (-764.089) -- 0:00:16
713000 -- (-760.480) (-762.028) [-761.456] (-759.180) * [-763.505] (-759.547) (-760.598) (-763.407) -- 0:00:16
713500 -- (-758.110) [-761.070] (-759.024) (-758.713) * (-760.546) (-760.235) [-762.378] (-759.601) -- 0:00:16
714000 -- (-761.682) (-768.298) [-759.628] (-759.481) * (-762.294) (-758.175) (-759.123) [-760.202] -- 0:00:16
714500 -- (-759.374) [-760.405] (-762.094) (-759.767) * (-758.527) (-760.567) [-758.302] (-759.245) -- 0:00:17
715000 -- [-763.137] (-759.315) (-760.110) (-761.107) * [-760.146] (-761.093) (-760.104) (-759.415) -- 0:00:17
Average standard deviation of split frequencies: 0.009835
715500 -- (-760.390) [-760.360] (-757.837) (-760.808) * (-759.744) (-760.535) (-759.689) [-760.097] -- 0:00:17
716000 -- [-761.057] (-760.315) (-757.802) (-762.782) * (-758.733) [-762.064] (-759.576) (-761.140) -- 0:00:17
716500 -- (-763.342) (-763.037) [-758.255] (-768.144) * (-758.895) (-762.107) (-760.450) [-759.033] -- 0:00:17
717000 -- (-758.488) (-764.991) [-760.620] (-759.690) * (-760.479) (-759.922) (-760.671) [-758.633] -- 0:00:16
717500 -- (-759.293) [-760.968] (-760.659) (-757.766) * [-760.210] (-759.088) (-760.431) (-759.420) -- 0:00:16
718000 -- (-758.997) [-760.103] (-759.114) (-758.260) * (-766.708) [-759.090] (-759.507) (-758.893) -- 0:00:16
718500 -- [-758.480] (-758.572) (-762.017) (-759.083) * (-759.050) [-757.894] (-758.614) (-761.109) -- 0:00:16
719000 -- (-762.529) [-759.457] (-758.999) (-760.842) * (-761.123) (-762.023) (-757.864) [-758.139] -- 0:00:16
719500 -- (-765.289) (-758.201) [-758.969] (-759.757) * (-760.129) (-759.813) [-759.992] (-758.661) -- 0:00:16
720000 -- (-760.828) (-759.256) [-758.077] (-761.427) * [-757.863] (-763.795) (-758.397) (-761.424) -- 0:00:16
Average standard deviation of split frequencies: 0.009927
720500 -- (-758.754) [-758.350] (-764.883) (-760.462) * (-763.481) [-763.195] (-763.746) (-758.902) -- 0:00:16
721000 -- (-761.063) (-760.398) (-759.790) [-758.818] * (-761.168) (-759.013) (-763.560) [-760.307] -- 0:00:16
721500 -- (-764.008) (-760.341) (-760.189) [-758.291] * (-759.734) [-761.050] (-762.553) (-758.609) -- 0:00:16
722000 -- [-758.421] (-758.869) (-761.718) (-764.156) * (-760.201) (-762.671) [-760.336] (-764.602) -- 0:00:16
722500 -- (-758.467) (-759.940) [-761.886] (-763.288) * (-759.476) (-758.762) (-759.338) [-758.883] -- 0:00:16
723000 -- (-758.340) (-759.525) (-760.704) [-763.375] * (-760.243) [-758.555] (-761.448) (-758.209) -- 0:00:16
723500 -- [-759.535] (-765.103) (-760.944) (-760.091) * (-759.765) (-759.974) (-760.042) [-758.614] -- 0:00:16
724000 -- (-767.099) (-759.905) [-758.758] (-759.067) * [-759.499] (-760.433) (-758.926) (-760.104) -- 0:00:16
724500 -- (-763.010) (-763.327) (-759.459) [-758.427] * [-762.588] (-761.041) (-759.363) (-759.577) -- 0:00:16
725000 -- (-761.166) (-759.330) [-760.567] (-761.297) * [-761.558] (-760.530) (-758.019) (-760.287) -- 0:00:16
Average standard deviation of split frequencies: 0.009456
725500 -- [-761.048] (-762.876) (-760.747) (-760.215) * (-759.481) (-757.984) (-759.905) [-760.536] -- 0:00:16
726000 -- (-759.577) (-760.203) (-759.023) [-759.370] * [-759.121] (-760.971) (-758.157) (-759.183) -- 0:00:16
726500 -- (-760.247) (-759.331) (-759.593) [-758.230] * (-761.732) (-760.773) (-760.713) [-758.019] -- 0:00:16
727000 -- (-761.674) [-760.964] (-760.683) (-762.201) * [-758.868] (-760.312) (-765.498) (-758.440) -- 0:00:16
727500 -- (-763.597) [-758.341] (-759.968) (-760.163) * (-757.887) (-759.564) (-762.547) [-761.402] -- 0:00:16
728000 -- [-759.709] (-764.870) (-759.263) (-759.191) * (-760.698) (-760.477) (-762.114) [-759.401] -- 0:00:16
728500 -- [-760.224] (-760.655) (-759.255) (-759.753) * (-758.931) (-768.420) [-760.184] (-760.938) -- 0:00:16
729000 -- [-762.234] (-762.172) (-758.665) (-760.374) * (-758.191) [-761.920] (-768.086) (-759.868) -- 0:00:15
729500 -- (-765.276) (-758.712) [-759.533] (-760.410) * [-758.451] (-761.897) (-759.106) (-759.760) -- 0:00:15
730000 -- (-772.615) (-765.424) (-761.993) [-760.123] * (-760.150) (-759.349) [-759.646] (-759.390) -- 0:00:15
Average standard deviation of split frequencies: 0.009476
730500 -- [-758.998] (-759.891) (-761.621) (-759.753) * (-758.388) (-758.856) (-760.864) [-759.171] -- 0:00:15
731000 -- (-758.941) (-759.591) [-758.843] (-760.112) * (-760.137) (-758.929) [-759.437] (-758.593) -- 0:00:16
731500 -- (-760.140) (-759.751) [-759.178] (-760.828) * (-758.345) (-758.284) [-759.292] (-759.066) -- 0:00:16
732000 -- (-759.953) (-759.707) (-758.983) [-758.357] * (-761.467) (-758.315) [-757.916] (-759.324) -- 0:00:16
732500 -- (-764.947) (-761.901) (-761.733) [-761.094] * (-761.130) [-760.572] (-759.815) (-759.364) -- 0:00:16
733000 -- (-761.515) (-758.225) (-760.132) [-762.738] * (-759.570) [-760.650] (-759.668) (-759.373) -- 0:00:16
733500 -- (-759.988) (-757.806) [-759.407] (-758.411) * (-759.244) [-759.964] (-758.271) (-759.220) -- 0:00:15
734000 -- (-758.837) (-759.940) [-758.838] (-761.239) * (-758.054) (-759.691) (-758.914) [-759.327] -- 0:00:15
734500 -- (-761.857) (-758.266) (-758.534) [-759.339] * (-758.249) (-761.488) (-760.966) [-758.648] -- 0:00:15
735000 -- (-758.890) (-759.617) [-759.958] (-759.598) * (-760.712) (-761.313) [-757.746] (-758.002) -- 0:00:15
Average standard deviation of split frequencies: 0.009487
735500 -- [-762.317] (-761.847) (-760.456) (-758.072) * (-761.122) (-760.972) [-759.713] (-758.875) -- 0:00:15
736000 -- (-759.526) [-760.574] (-760.953) (-758.414) * (-759.140) [-760.749] (-757.874) (-759.439) -- 0:00:15
736500 -- [-761.404] (-758.277) (-761.181) (-757.880) * (-758.674) [-758.098] (-760.513) (-759.084) -- 0:00:15
737000 -- (-759.556) (-758.277) (-758.411) [-759.826] * (-758.449) (-759.928) (-760.471) [-761.599] -- 0:00:15
737500 -- (-760.251) (-760.007) (-758.742) [-759.266] * [-758.392] (-762.442) (-763.379) (-757.893) -- 0:00:15
738000 -- (-764.294) [-757.712] (-759.147) (-762.455) * (-758.582) (-759.147) (-760.795) [-757.902] -- 0:00:15
738500 -- (-762.461) [-758.058] (-759.709) (-759.234) * (-763.535) [-758.746] (-760.130) (-760.136) -- 0:00:15
739000 -- (-759.669) (-759.822) [-760.119] (-759.146) * [-759.953] (-762.198) (-761.281) (-758.620) -- 0:00:15
739500 -- [-761.456] (-758.813) (-758.802) (-759.690) * (-763.339) (-769.603) [-758.656] (-760.407) -- 0:00:15
740000 -- (-760.766) [-758.558] (-759.049) (-762.116) * [-757.741] (-760.722) (-761.832) (-759.088) -- 0:00:15
Average standard deviation of split frequencies: 0.009547
740500 -- (-763.618) [-758.702] (-761.204) (-762.959) * [-758.321] (-764.667) (-759.932) (-759.178) -- 0:00:15
741000 -- (-762.489) (-757.836) (-763.852) [-758.789] * [-758.323] (-763.855) (-762.086) (-758.178) -- 0:00:15
741500 -- [-762.130] (-760.208) (-759.987) (-758.159) * (-758.983) (-763.354) [-757.682] (-761.943) -- 0:00:15
742000 -- (-758.877) [-759.623] (-758.950) (-759.605) * [-762.251] (-762.996) (-758.969) (-762.644) -- 0:00:15
742500 -- [-759.567] (-758.498) (-758.483) (-759.327) * (-764.257) (-759.670) (-760.430) [-758.924] -- 0:00:15
743000 -- (-759.734) (-758.448) (-759.599) [-758.548] * (-760.916) (-759.282) (-758.870) [-763.249] -- 0:00:15
743500 -- (-761.325) (-760.543) (-759.699) [-758.291] * (-760.751) (-759.214) [-759.040] (-759.507) -- 0:00:15
744000 -- (-760.764) (-761.915) (-760.993) [-758.411] * (-759.409) [-759.772] (-759.612) (-759.090) -- 0:00:15
744500 -- (-759.959) [-762.627] (-759.794) (-761.069) * (-760.288) (-760.565) (-758.803) [-760.419] -- 0:00:15
745000 -- (-758.801) (-758.323) [-758.730] (-758.663) * (-764.260) [-759.574] (-766.841) (-760.049) -- 0:00:15
Average standard deviation of split frequencies: 0.009597
745500 -- (-762.850) (-759.948) [-759.804] (-757.997) * (-761.596) (-759.744) (-758.544) [-761.705] -- 0:00:15
746000 -- (-759.360) (-759.185) (-765.427) [-761.385] * (-761.123) [-761.403] (-765.485) (-760.084) -- 0:00:14
746500 -- (-759.151) [-759.292] (-758.563) (-758.463) * (-760.695) (-761.278) (-768.490) [-757.619] -- 0:00:14
747000 -- (-759.223) (-759.439) [-760.644] (-761.808) * [-759.366] (-762.457) (-759.623) (-758.667) -- 0:00:14
747500 -- [-761.908] (-760.568) (-761.250) (-762.897) * (-759.845) [-759.903] (-760.991) (-759.619) -- 0:00:14
748000 -- (-760.019) (-764.431) (-758.484) [-760.825] * (-758.902) (-759.783) [-761.987] (-759.774) -- 0:00:15
748500 -- [-761.167] (-760.141) (-760.126) (-762.645) * [-758.038] (-758.998) (-761.160) (-758.896) -- 0:00:15
749000 -- (-759.187) (-759.516) [-763.187] (-764.368) * (-759.852) (-759.451) (-760.030) [-760.069] -- 0:00:15
749500 -- (-759.802) (-764.822) [-758.895] (-761.199) * [-759.572] (-760.129) (-764.176) (-759.107) -- 0:00:15
750000 -- (-760.198) (-762.724) (-760.215) [-760.490] * (-761.502) (-760.711) (-760.475) [-759.520] -- 0:00:15
Average standard deviation of split frequencies: 0.009773
750500 -- (-763.294) [-759.890] (-759.267) (-758.538) * [-759.225] (-763.936) (-758.091) (-759.533) -- 0:00:14
751000 -- (-759.127) [-761.134] (-759.298) (-760.848) * (-758.703) [-758.170] (-758.372) (-761.708) -- 0:00:14
751500 -- (-758.557) (-760.098) (-760.610) [-759.935] * (-760.260) [-757.767] (-758.069) (-765.294) -- 0:00:14
752000 -- (-758.548) (-758.492) (-761.993) [-759.944] * [-761.521] (-758.354) (-759.401) (-758.844) -- 0:00:14
752500 -- (-759.355) (-757.803) (-761.974) [-758.759] * (-758.532) [-762.499] (-759.934) (-767.075) -- 0:00:14
753000 -- (-761.264) [-761.319] (-759.756) (-760.472) * (-758.806) (-760.456) (-760.255) [-758.956] -- 0:00:14
753500 -- [-759.074] (-758.775) (-759.451) (-759.711) * [-758.779] (-760.501) (-759.336) (-762.829) -- 0:00:14
754000 -- (-761.665) [-758.871] (-762.392) (-759.282) * [-758.280] (-759.319) (-759.606) (-759.942) -- 0:00:14
754500 -- (-758.402) [-758.269] (-763.435) (-758.216) * (-760.878) [-760.083] (-758.695) (-759.891) -- 0:00:14
755000 -- (-760.876) (-759.078) (-759.965) [-762.753] * (-758.715) (-758.950) [-759.858] (-759.165) -- 0:00:14
Average standard deviation of split frequencies: 0.009665
755500 -- [-758.849] (-760.100) (-764.807) (-764.498) * (-758.650) (-761.247) (-760.381) [-759.051] -- 0:00:14
756000 -- (-758.352) [-759.239] (-759.176) (-762.839) * (-758.521) (-768.775) [-758.505] (-759.927) -- 0:00:14
756500 -- (-760.810) [-761.082] (-758.183) (-759.995) * (-758.333) [-761.131] (-761.184) (-760.885) -- 0:00:14
757000 -- (-758.428) (-761.122) [-760.751] (-760.834) * (-759.155) (-759.014) [-761.098] (-760.011) -- 0:00:14
757500 -- (-759.923) (-763.544) (-759.624) [-762.045] * (-759.614) [-759.094] (-762.120) (-761.118) -- 0:00:14
758000 -- (-761.281) [-765.301] (-762.102) (-758.590) * [-758.383] (-759.195) (-765.355) (-760.149) -- 0:00:14
758500 -- (-760.435) [-761.177] (-758.585) (-759.585) * (-758.471) (-763.761) [-759.090] (-760.171) -- 0:00:14
759000 -- (-763.278) (-764.087) [-759.433] (-763.319) * [-763.805] (-762.903) (-758.403) (-759.054) -- 0:00:14
759500 -- (-762.510) (-761.343) [-758.320] (-758.802) * (-762.940) (-764.927) [-758.409] (-760.728) -- 0:00:14
760000 -- (-759.298) [-761.039] (-759.079) (-760.528) * (-759.071) [-759.851] (-759.573) (-761.846) -- 0:00:14
Average standard deviation of split frequencies: 0.009296
760500 -- (-760.401) (-759.966) [-760.395] (-759.521) * (-760.217) (-762.126) (-759.951) [-761.950] -- 0:00:14
761000 -- (-759.473) (-758.220) (-762.078) [-758.143] * (-761.308) (-758.647) (-759.179) [-760.764] -- 0:00:14
761500 -- (-758.523) (-758.641) (-759.443) [-760.080] * (-761.162) [-758.430] (-761.049) (-766.777) -- 0:00:14
762000 -- (-757.904) [-764.250] (-761.133) (-758.536) * (-759.859) (-765.384) (-762.968) [-760.016] -- 0:00:14
762500 -- (-758.554) (-760.776) (-760.238) [-761.417] * (-761.336) (-759.548) [-762.937] (-759.282) -- 0:00:14
763000 -- (-761.916) [-759.330] (-760.899) (-760.905) * (-759.018) (-759.542) (-760.688) [-759.119] -- 0:00:13
763500 -- (-763.381) (-758.154) (-759.013) [-760.129] * [-759.780] (-759.119) (-759.292) (-761.915) -- 0:00:13
764000 -- (-759.919) (-758.854) [-758.425] (-762.134) * (-758.084) (-759.226) [-763.209] (-760.245) -- 0:00:13
764500 -- [-759.545] (-758.328) (-759.878) (-759.025) * [-758.003] (-758.538) (-762.364) (-759.581) -- 0:00:13
765000 -- [-758.163] (-759.534) (-761.142) (-758.148) * (-759.585) (-762.377) [-762.032] (-758.783) -- 0:00:14
Average standard deviation of split frequencies: 0.009116
765500 -- (-761.963) (-761.138) [-758.836] (-760.153) * (-760.806) (-765.538) (-761.577) [-761.192] -- 0:00:14
766000 -- [-758.485] (-758.744) (-759.106) (-760.496) * (-759.597) [-760.990] (-759.802) (-758.313) -- 0:00:14
766500 -- [-758.980] (-757.947) (-759.045) (-761.654) * (-757.701) (-760.551) [-758.705] (-759.811) -- 0:00:14
767000 -- (-758.913) (-759.184) [-762.385] (-758.461) * [-759.675] (-758.587) (-762.202) (-759.674) -- 0:00:13
767500 -- [-757.950] (-763.033) (-765.405) (-758.258) * [-760.122] (-760.781) (-758.416) (-760.132) -- 0:00:13
768000 -- (-757.707) (-760.921) (-758.975) [-759.585] * (-761.838) (-761.313) [-757.916] (-766.027) -- 0:00:13
768500 -- [-757.878] (-759.573) (-760.155) (-760.568) * (-763.581) (-759.269) [-762.653] (-760.845) -- 0:00:13
769000 -- (-759.340) (-758.560) (-759.267) [-758.935] * (-757.596) [-761.939] (-763.672) (-760.902) -- 0:00:13
769500 -- (-762.589) [-760.086] (-761.152) (-761.487) * [-759.840] (-764.156) (-759.328) (-760.960) -- 0:00:13
770000 -- (-760.058) [-761.420] (-760.102) (-758.344) * [-758.726] (-762.183) (-762.026) (-760.498) -- 0:00:13
Average standard deviation of split frequencies: 0.008716
770500 -- (-758.682) [-758.888] (-758.208) (-759.078) * (-759.577) (-759.570) [-760.022] (-759.476) -- 0:00:13
771000 -- [-759.655] (-758.963) (-758.221) (-759.087) * (-760.420) (-758.666) (-759.608) [-759.535] -- 0:00:13
771500 -- (-761.507) [-760.362] (-760.671) (-759.538) * (-761.046) (-759.520) [-763.450] (-758.220) -- 0:00:13
772000 -- (-761.435) (-758.400) (-760.739) [-760.097] * [-759.432] (-758.952) (-760.147) (-759.306) -- 0:00:13
772500 -- (-758.533) (-758.984) (-758.418) [-759.835] * [-758.770] (-762.512) (-763.243) (-760.735) -- 0:00:13
773000 -- (-760.691) [-757.965] (-758.959) (-759.286) * (-759.960) (-761.304) (-762.450) [-758.675] -- 0:00:13
773500 -- (-759.445) (-758.041) (-758.690) [-760.665] * (-758.788) (-760.028) (-759.719) [-757.725] -- 0:00:13
774000 -- (-760.531) (-763.149) [-759.567] (-758.894) * [-763.975] (-761.982) (-758.244) (-760.139) -- 0:00:13
774500 -- (-760.474) [-760.561] (-759.028) (-763.663) * [-759.916] (-761.091) (-758.566) (-760.455) -- 0:00:13
775000 -- (-760.355) (-760.152) [-758.878] (-761.246) * [-759.778] (-762.287) (-764.500) (-759.590) -- 0:00:13
Average standard deviation of split frequencies: 0.008846
775500 -- [-758.489] (-761.439) (-758.037) (-758.568) * (-759.267) (-761.104) [-760.674] (-758.423) -- 0:00:13
776000 -- [-760.082] (-762.051) (-758.169) (-759.248) * (-759.495) [-760.184] (-767.180) (-762.280) -- 0:00:13
776500 -- (-761.336) [-761.913] (-758.952) (-760.021) * (-758.517) [-760.675] (-764.295) (-758.574) -- 0:00:13
777000 -- (-759.039) [-759.493] (-761.304) (-760.604) * (-758.537) [-760.722] (-760.383) (-758.648) -- 0:00:13
777500 -- (-759.736) (-759.998) [-763.295] (-763.125) * (-758.337) (-763.045) [-760.741] (-759.301) -- 0:00:13
778000 -- (-758.593) [-762.113] (-759.946) (-759.110) * [-758.503] (-758.940) (-761.640) (-759.259) -- 0:00:13
778500 -- (-759.837) (-766.382) [-762.283] (-760.493) * (-758.886) (-758.612) (-762.185) [-758.316] -- 0:00:13
779000 -- (-757.788) (-762.233) (-760.063) [-759.480] * (-760.495) (-760.268) [-759.070] (-760.615) -- 0:00:13
779500 -- (-760.505) (-765.851) [-761.624] (-759.675) * (-760.323) (-761.721) (-760.118) [-759.709] -- 0:00:13
780000 -- (-758.489) (-764.758) (-758.655) [-760.675] * (-761.544) (-764.978) (-759.476) [-758.776] -- 0:00:12
Average standard deviation of split frequencies: 0.009058
780500 -- (-761.030) (-761.217) [-759.365] (-760.559) * [-760.292] (-759.921) (-758.746) (-758.567) -- 0:00:12
781000 -- (-762.445) (-758.520) (-758.758) [-759.653] * (-763.010) (-764.042) [-758.848] (-761.198) -- 0:00:12
781500 -- (-761.121) (-760.227) [-759.972] (-761.217) * (-761.895) [-758.749] (-759.149) (-761.456) -- 0:00:13
782000 -- (-758.462) (-759.732) (-758.633) [-758.795] * (-760.172) [-759.768] (-761.154) (-758.981) -- 0:00:13
782500 -- [-757.828] (-759.190) (-759.457) (-758.400) * (-759.703) (-762.902) [-758.926] (-758.930) -- 0:00:13
783000 -- [-758.639] (-758.195) (-763.948) (-759.574) * (-759.303) (-759.243) (-759.045) [-760.719] -- 0:00:13
783500 -- [-758.566] (-758.761) (-759.078) (-761.644) * [-759.742] (-759.730) (-760.214) (-758.783) -- 0:00:12
784000 -- (-760.354) [-758.816] (-762.064) (-761.826) * (-761.669) (-760.099) [-759.790] (-759.185) -- 0:00:12
784500 -- [-759.467] (-758.622) (-762.251) (-764.753) * (-759.286) (-761.016) [-758.887] (-758.592) -- 0:00:12
785000 -- [-761.504] (-760.832) (-760.109) (-764.793) * (-762.208) [-760.608] (-761.866) (-761.215) -- 0:00:12
Average standard deviation of split frequencies: 0.008546
785500 -- (-760.405) (-762.384) (-761.722) [-761.209] * [-758.029] (-760.751) (-763.354) (-759.629) -- 0:00:12
786000 -- (-761.104) (-763.349) [-759.418] (-761.925) * [-758.256] (-759.036) (-764.127) (-762.938) -- 0:00:12
786500 -- [-757.766] (-760.243) (-762.463) (-759.740) * (-758.710) [-759.982] (-759.131) (-760.680) -- 0:00:12
787000 -- (-758.662) (-760.454) (-762.507) [-758.069] * (-758.773) [-758.492] (-759.514) (-757.979) -- 0:00:12
787500 -- (-763.701) (-761.810) (-758.356) [-758.614] * (-762.167) (-761.968) (-758.978) [-758.772] -- 0:00:12
788000 -- (-760.984) (-761.479) (-759.501) [-759.993] * (-759.958) (-765.631) [-759.678] (-759.762) -- 0:00:12
788500 -- (-762.021) (-758.120) (-763.780) [-759.131] * (-760.225) (-758.394) (-763.463) [-759.556] -- 0:00:12
789000 -- [-761.101] (-759.239) (-765.445) (-763.630) * (-760.130) [-758.071] (-762.950) (-759.748) -- 0:00:12
789500 -- (-759.778) [-760.017] (-761.782) (-759.376) * (-759.143) (-758.559) (-758.878) [-761.462] -- 0:00:12
790000 -- [-761.060] (-759.012) (-759.544) (-758.079) * [-758.897] (-759.770) (-759.549) (-760.840) -- 0:00:12
Average standard deviation of split frequencies: 0.007937
790500 -- (-761.967) (-760.056) [-759.269] (-759.137) * (-759.402) (-758.449) (-762.059) [-760.097] -- 0:00:12
791000 -- (-762.195) [-759.034] (-760.800) (-757.942) * (-759.376) (-761.167) [-758.469] (-760.736) -- 0:00:12
791500 -- (-758.570) [-757.789] (-758.855) (-759.728) * [-761.686] (-761.066) (-758.689) (-758.531) -- 0:00:12
792000 -- (-761.149) [-760.663] (-759.340) (-760.259) * (-760.191) [-760.929] (-761.498) (-761.225) -- 0:00:12
792500 -- (-759.916) (-759.575) (-761.378) [-760.215] * (-760.875) (-760.293) [-759.029] (-761.058) -- 0:00:12
793000 -- (-760.264) [-759.456] (-764.770) (-761.534) * (-758.160) (-759.013) [-758.464] (-759.027) -- 0:00:12
793500 -- (-759.982) [-758.045] (-765.654) (-759.192) * (-757.969) (-758.120) [-762.889] (-764.520) -- 0:00:12
794000 -- [-762.528] (-757.812) (-759.683) (-758.835) * (-757.948) (-758.436) [-759.934] (-766.285) -- 0:00:12
794500 -- (-760.749) (-757.890) (-758.534) [-758.516] * (-760.281) [-759.962] (-763.086) (-761.016) -- 0:00:12
795000 -- (-760.611) (-763.410) (-762.204) [-759.365] * (-758.555) (-760.439) (-761.226) [-759.555] -- 0:00:12
Average standard deviation of split frequencies: 0.008032
795500 -- (-760.771) (-762.524) (-759.725) [-760.971] * (-758.273) (-759.553) [-761.339] (-761.029) -- 0:00:12
796000 -- (-758.354) (-762.079) [-763.958] (-763.135) * (-758.153) (-762.094) (-758.942) [-760.477] -- 0:00:12
796500 -- [-761.420] (-761.137) (-758.088) (-765.496) * (-761.125) [-758.844] (-760.477) (-758.316) -- 0:00:12
797000 -- (-760.288) (-760.520) (-757.982) [-761.703] * [-762.210] (-761.178) (-759.079) (-767.675) -- 0:00:11
797500 -- (-758.524) (-760.985) (-758.333) [-760.262] * (-763.234) (-762.551) [-762.053] (-765.363) -- 0:00:11
798000 -- (-760.124) (-758.654) (-758.929) [-760.074] * [-762.035] (-760.558) (-762.494) (-758.140) -- 0:00:11
798500 -- (-761.911) (-758.675) (-759.259) [-758.471] * (-762.324) (-758.603) (-766.075) [-759.319] -- 0:00:12
799000 -- (-762.691) (-758.792) [-758.972] (-759.623) * (-758.352) (-760.686) [-764.460] (-759.088) -- 0:00:12
799500 -- (-766.685) (-760.729) [-760.994] (-758.895) * [-758.484] (-763.362) (-759.555) (-759.285) -- 0:00:12
800000 -- (-760.207) [-759.215] (-760.136) (-762.419) * (-763.212) (-766.431) [-759.043] (-760.044) -- 0:00:12
Average standard deviation of split frequencies: 0.008169
800500 -- (-758.518) [-759.472] (-760.549) (-762.298) * (-758.073) (-769.309) [-758.788] (-763.884) -- 0:00:11
801000 -- (-758.843) (-758.338) (-761.234) [-759.926] * (-758.050) [-760.137] (-758.741) (-761.976) -- 0:00:11
801500 -- [-759.667] (-757.637) (-759.228) (-758.258) * (-758.207) (-758.680) (-765.883) [-762.144] -- 0:00:11
802000 -- (-765.171) (-761.632) [-763.745] (-759.134) * (-760.175) (-758.554) [-765.689] (-759.387) -- 0:00:11
802500 -- (-758.223) (-760.408) [-758.654] (-760.038) * [-759.559] (-762.891) (-761.811) (-760.534) -- 0:00:11
803000 -- (-760.275) (-760.159) [-759.176] (-760.098) * (-763.768) (-762.694) [-759.714] (-763.759) -- 0:00:11
803500 -- (-762.488) (-758.963) [-760.185] (-759.747) * (-770.762) [-760.462] (-763.773) (-761.348) -- 0:00:11
804000 -- (-760.371) (-760.174) (-761.149) [-759.212] * (-763.987) [-759.350] (-763.951) (-759.205) -- 0:00:11
804500 -- (-758.253) [-759.054] (-757.746) (-758.176) * (-761.570) (-760.267) [-760.670] (-759.542) -- 0:00:11
805000 -- (-759.403) (-760.194) (-759.361) [-760.234] * (-761.238) (-758.080) (-760.317) [-759.474] -- 0:00:11
Average standard deviation of split frequencies: 0.008590
805500 -- (-761.189) [-759.164] (-758.089) (-763.284) * (-759.875) (-762.103) (-759.857) [-760.201] -- 0:00:11
806000 -- (-758.029) (-758.886) [-758.140] (-762.255) * (-759.476) (-760.764) [-760.400] (-759.989) -- 0:00:11
806500 -- (-762.805) (-759.339) (-763.604) [-759.555] * [-759.084] (-760.519) (-760.102) (-758.327) -- 0:00:11
807000 -- (-760.020) [-760.693] (-763.556) (-760.156) * (-758.482) [-761.238] (-758.123) (-759.528) -- 0:00:11
807500 -- [-760.133] (-760.268) (-759.739) (-759.283) * (-758.656) (-759.199) (-759.792) [-759.080] -- 0:00:11
808000 -- [-758.960] (-759.896) (-759.723) (-760.797) * (-762.440) [-762.751] (-758.086) (-759.740) -- 0:00:11
808500 -- (-759.103) (-759.557) [-759.292] (-763.396) * [-758.495] (-760.311) (-758.379) (-762.310) -- 0:00:11
809000 -- (-759.893) [-759.015] (-759.424) (-759.675) * (-758.994) (-760.384) (-758.229) [-760.703] -- 0:00:11
809500 -- (-763.762) (-759.075) (-762.290) [-760.154] * (-758.650) (-758.976) (-758.923) [-759.608] -- 0:00:11
810000 -- [-758.480] (-761.742) (-758.336) (-760.083) * [-758.495] (-759.115) (-760.376) (-758.996) -- 0:00:11
Average standard deviation of split frequencies: 0.008941
810500 -- (-760.443) (-758.617) (-761.078) [-758.935] * (-761.361) (-761.148) [-759.115] (-758.016) -- 0:00:11
811000 -- (-768.496) (-758.086) (-759.872) [-760.021] * [-760.110] (-760.279) (-760.332) (-759.801) -- 0:00:11
811500 -- (-763.004) [-761.297] (-761.852) (-765.984) * (-758.751) (-758.750) [-759.248] (-760.363) -- 0:00:11
812000 -- (-760.653) [-759.239] (-761.828) (-761.564) * (-759.259) (-758.566) [-760.473] (-758.073) -- 0:00:11
812500 -- (-761.420) [-763.380] (-760.343) (-760.630) * (-758.917) (-760.438) [-760.196] (-761.247) -- 0:00:11
813000 -- (-761.822) [-758.351] (-760.195) (-762.148) * (-758.360) (-758.369) [-759.039] (-762.247) -- 0:00:11
813500 -- (-760.908) [-758.106] (-761.472) (-760.777) * (-758.180) (-760.725) (-762.180) [-758.800] -- 0:00:11
814000 -- (-761.493) [-761.586] (-760.756) (-759.451) * (-758.773) [-758.678] (-759.402) (-761.988) -- 0:00:10
814500 -- (-760.964) (-759.632) (-759.116) [-759.590] * (-759.781) (-762.138) [-759.762] (-760.066) -- 0:00:10
815000 -- (-760.091) (-761.120) [-759.479] (-759.391) * (-760.515) [-758.244] (-758.146) (-764.851) -- 0:00:10
Average standard deviation of split frequencies: 0.008810
815500 -- (-759.264) (-763.264) (-762.426) [-759.280] * (-763.685) (-758.932) [-758.198] (-759.500) -- 0:00:11
816000 -- (-758.232) (-760.127) (-758.620) [-758.251] * (-762.907) (-760.187) [-759.895] (-761.862) -- 0:00:11
816500 -- (-758.990) [-759.842] (-758.782) (-758.496) * (-763.868) (-759.836) (-759.013) [-758.815] -- 0:00:11
817000 -- (-761.311) (-758.154) (-759.705) [-758.906] * [-762.438] (-759.716) (-759.549) (-759.580) -- 0:00:10
817500 -- (-760.062) (-758.299) [-759.935] (-760.940) * [-757.882] (-761.194) (-759.168) (-758.880) -- 0:00:10
818000 -- (-762.141) (-758.396) (-760.906) [-761.477] * [-759.139] (-759.199) (-759.302) (-763.290) -- 0:00:10
818500 -- [-761.142] (-764.297) (-759.229) (-759.337) * (-762.499) (-765.536) (-761.533) [-760.879] -- 0:00:10
819000 -- (-759.590) (-761.382) [-759.820] (-761.756) * (-759.206) [-759.783] (-759.546) (-762.261) -- 0:00:10
819500 -- (-762.350) (-762.692) [-758.492] (-762.219) * (-759.500) (-762.345) (-760.783) [-760.442] -- 0:00:10
820000 -- (-759.502) (-759.381) (-762.298) [-760.088] * (-759.452) [-758.778] (-760.122) (-761.279) -- 0:00:10
Average standard deviation of split frequencies: 0.008796
820500 -- (-759.999) (-757.781) [-761.072] (-758.982) * (-759.067) [-759.576] (-758.639) (-761.786) -- 0:00:10
821000 -- (-765.380) (-760.088) (-760.218) [-758.012] * (-762.981) (-759.237) (-761.333) [-761.622] -- 0:00:10
821500 -- (-758.850) [-761.349] (-761.506) (-758.289) * (-758.581) (-761.180) [-761.236] (-758.613) -- 0:00:10
822000 -- (-757.742) (-762.310) (-761.697) [-760.080] * (-761.977) (-758.191) (-760.307) [-758.302] -- 0:00:10
822500 -- (-761.125) (-759.789) (-761.139) [-758.254] * (-759.542) [-758.191] (-758.294) (-760.247) -- 0:00:10
823000 -- (-759.047) (-759.462) [-758.959] (-760.152) * (-758.171) [-759.970] (-758.508) (-762.669) -- 0:00:10
823500 -- (-761.011) (-760.740) (-760.316) [-762.840] * (-759.878) (-761.383) (-759.152) [-759.359] -- 0:00:10
824000 -- [-760.701] (-759.054) (-758.908) (-759.048) * [-758.610] (-761.829) (-761.259) (-758.340) -- 0:00:10
824500 -- (-759.689) [-759.849] (-757.906) (-758.970) * (-764.899) (-759.039) [-761.661] (-763.614) -- 0:00:10
825000 -- (-762.263) [-760.439] (-758.538) (-760.117) * (-763.025) (-759.465) (-761.549) [-761.781] -- 0:00:10
Average standard deviation of split frequencies: 0.008023
825500 -- (-758.864) (-763.231) (-761.455) [-759.705] * [-761.606] (-759.335) (-758.667) (-759.362) -- 0:00:10
826000 -- (-762.461) (-760.534) [-759.427] (-759.417) * [-759.668] (-762.226) (-761.456) (-758.115) -- 0:00:10
826500 -- (-760.574) (-759.611) [-761.340] (-758.566) * (-759.436) [-760.046] (-759.348) (-760.922) -- 0:00:10
827000 -- (-758.185) [-759.556] (-759.675) (-758.927) * [-759.084] (-758.008) (-759.920) (-760.415) -- 0:00:10
827500 -- (-760.923) (-758.547) (-760.269) [-758.810] * (-767.145) [-760.266] (-758.492) (-762.218) -- 0:00:10
828000 -- (-762.376) [-758.696] (-763.452) (-759.903) * (-764.066) [-764.795] (-758.322) (-761.460) -- 0:00:10
828500 -- (-760.507) (-760.580) [-758.273] (-764.813) * (-760.335) [-758.493] (-758.804) (-760.629) -- 0:00:10
829000 -- (-761.395) [-757.966] (-759.824) (-761.056) * [-759.308] (-760.026) (-758.801) (-760.720) -- 0:00:10
829500 -- (-759.874) (-759.014) (-760.155) [-759.782] * (-758.420) (-758.952) (-759.653) [-761.212] -- 0:00:10
830000 -- [-760.943] (-760.646) (-757.700) (-761.020) * (-760.758) (-758.205) [-760.819] (-760.111) -- 0:00:10
Average standard deviation of split frequencies: 0.008379
830500 -- (-759.828) (-758.072) [-759.717] (-759.020) * (-759.512) (-760.428) [-762.889] (-760.505) -- 0:00:10
831000 -- (-761.720) [-762.107] (-759.737) (-758.541) * (-761.377) (-761.128) [-759.320] (-759.891) -- 0:00:09
831500 -- (-759.435) (-760.245) [-761.906] (-759.727) * (-758.598) (-758.307) [-757.921] (-760.062) -- 0:00:09
832000 -- (-760.183) (-759.458) [-759.914] (-759.376) * [-762.190] (-758.522) (-758.676) (-761.061) -- 0:00:09
832500 -- (-759.250) (-760.204) [-759.707] (-758.812) * (-763.136) (-758.332) (-761.681) [-761.707] -- 0:00:10
833000 -- (-760.435) (-761.184) [-759.260] (-758.183) * (-761.054) (-760.400) [-757.998] (-759.565) -- 0:00:10
833500 -- (-764.936) [-760.813] (-759.439) (-757.673) * (-762.175) (-759.747) (-759.057) [-759.458] -- 0:00:09
834000 -- (-760.540) (-760.866) (-758.503) [-758.830] * (-760.365) (-763.248) [-761.535] (-759.306) -- 0:00:09
834500 -- (-762.015) (-761.291) [-758.165] (-757.691) * (-758.525) (-764.203) (-758.889) [-759.760] -- 0:00:09
835000 -- (-762.039) (-760.819) [-758.289] (-760.854) * [-759.034] (-766.468) (-758.578) (-761.476) -- 0:00:09
Average standard deviation of split frequencies: 0.008491
835500 -- [-760.506] (-763.175) (-758.238) (-760.670) * (-759.742) (-759.342) [-758.946] (-761.151) -- 0:00:09
836000 -- (-758.944) (-760.851) (-759.745) [-758.716] * [-758.102] (-760.819) (-759.058) (-759.264) -- 0:00:09
836500 -- (-758.909) [-758.482] (-758.521) (-763.955) * (-758.275) (-758.588) [-759.731] (-762.787) -- 0:00:09
837000 -- (-759.364) (-759.109) [-761.327] (-763.700) * (-761.213) (-759.209) (-759.195) [-760.378] -- 0:00:09
837500 -- (-760.682) (-761.274) (-761.782) [-759.574] * (-759.541) (-760.670) [-760.572] (-758.010) -- 0:00:09
838000 -- (-758.603) (-759.236) [-758.827] (-762.105) * (-760.351) (-758.374) [-760.803] (-758.033) -- 0:00:09
838500 -- (-759.322) (-760.754) [-758.130] (-758.264) * (-761.964) (-759.883) [-757.914] (-759.225) -- 0:00:09
839000 -- (-761.128) (-761.875) [-758.178] (-759.081) * (-764.670) (-758.738) [-759.900] (-758.363) -- 0:00:09
839500 -- (-760.326) (-759.442) (-765.727) [-758.121] * [-761.416] (-758.237) (-759.987) (-758.519) -- 0:00:09
840000 -- (-759.526) [-761.376] (-761.535) (-760.776) * (-758.569) (-759.243) [-759.942] (-758.018) -- 0:00:09
Average standard deviation of split frequencies: 0.008867
840500 -- (-759.687) (-760.816) [-759.842] (-759.608) * (-760.925) (-758.729) (-761.677) [-758.586] -- 0:00:09
841000 -- (-760.571) (-759.957) [-758.963] (-760.808) * (-760.888) [-759.167] (-764.289) (-761.869) -- 0:00:09
841500 -- (-760.751) (-758.855) [-759.173] (-759.026) * (-761.119) [-758.115] (-761.104) (-763.166) -- 0:00:09
842000 -- (-758.387) (-758.540) [-760.176] (-761.697) * (-760.417) (-758.346) [-757.932] (-759.567) -- 0:00:09
842500 -- (-758.541) (-758.656) [-763.363] (-760.346) * (-758.950) (-759.349) (-759.637) [-762.537] -- 0:00:09
843000 -- (-760.422) (-759.326) (-761.295) [-763.191] * [-758.968] (-760.043) (-764.577) (-758.856) -- 0:00:09
843500 -- (-757.722) [-760.108] (-762.394) (-764.594) * [-760.419] (-758.715) (-761.818) (-759.472) -- 0:00:09
844000 -- [-757.873] (-763.902) (-762.601) (-759.618) * (-761.410) (-760.101) (-761.756) [-759.761] -- 0:00:09
844500 -- (-759.215) (-759.712) (-762.422) [-759.973] * (-763.527) [-759.602] (-761.233) (-760.577) -- 0:00:09
845000 -- [-758.651] (-765.479) (-761.849) (-760.538) * (-759.111) (-760.228) [-758.797] (-759.177) -- 0:00:09
Average standard deviation of split frequencies: 0.008555
845500 -- [-759.396] (-761.551) (-761.368) (-762.097) * [-758.704] (-761.736) (-758.372) (-762.747) -- 0:00:09
846000 -- (-759.653) (-759.881) [-759.379] (-759.889) * (-759.463) [-759.394] (-758.203) (-760.680) -- 0:00:09
846500 -- [-759.176] (-759.543) (-758.384) (-760.193) * [-760.525] (-759.532) (-759.783) (-760.995) -- 0:00:09
847000 -- (-762.166) (-758.929) [-758.503] (-760.685) * (-763.222) [-759.803] (-759.765) (-759.994) -- 0:00:09
847500 -- (-758.830) [-759.587] (-758.562) (-760.294) * [-758.721] (-761.055) (-759.544) (-759.389) -- 0:00:08
848000 -- [-759.832] (-760.177) (-764.125) (-758.442) * (-758.948) (-759.115) (-759.536) [-759.333] -- 0:00:08
848500 -- (-757.855) [-763.318] (-761.638) (-759.138) * (-758.637) [-766.254] (-759.427) (-758.460) -- 0:00:08
849000 -- (-757.972) (-759.708) (-762.999) [-761.073] * (-760.444) (-764.071) (-762.777) [-758.495] -- 0:00:08
849500 -- (-759.212) (-762.938) (-761.309) [-759.999] * (-761.420) (-768.063) (-763.429) [-759.018] -- 0:00:09
850000 -- (-763.897) (-758.514) (-761.882) [-762.715] * (-759.593) (-758.800) [-759.561] (-760.865) -- 0:00:09
Average standard deviation of split frequencies: 0.008932
850500 -- (-758.650) (-758.561) [-761.126] (-762.780) * (-764.984) (-761.998) (-761.650) [-760.390] -- 0:00:08
851000 -- (-760.434) [-758.635] (-761.879) (-759.172) * (-763.662) [-759.385] (-760.183) (-761.347) -- 0:00:08
851500 -- (-762.648) (-760.553) [-759.236] (-761.574) * (-763.338) [-758.929] (-758.672) (-759.918) -- 0:00:08
852000 -- [-759.636] (-758.682) (-759.517) (-760.361) * (-758.769) [-760.270] (-759.625) (-759.322) -- 0:00:08
852500 -- (-763.898) (-758.330) (-762.968) [-759.257] * [-758.625] (-762.733) (-760.155) (-759.259) -- 0:00:08
853000 -- [-759.073] (-760.658) (-759.141) (-758.933) * [-758.373] (-762.297) (-761.401) (-759.747) -- 0:00:08
853500 -- [-759.319] (-760.018) (-759.420) (-757.979) * [-760.109] (-760.473) (-760.276) (-758.132) -- 0:00:08
854000 -- (-761.027) [-760.823] (-759.574) (-760.561) * (-760.201) (-766.628) [-761.102] (-758.089) -- 0:00:08
854500 -- (-758.181) (-759.730) [-758.374] (-761.759) * (-758.563) (-762.048) (-758.681) [-760.878] -- 0:00:08
855000 -- [-761.519] (-760.403) (-760.727) (-759.691) * (-760.854) [-761.468] (-761.581) (-758.891) -- 0:00:08
Average standard deviation of split frequencies: 0.009135
855500 -- (-762.838) (-762.537) [-759.270] (-761.425) * (-760.223) (-761.810) [-760.548] (-761.822) -- 0:00:08
856000 -- (-759.149) (-761.499) [-765.673] (-759.355) * (-760.859) (-764.167) [-761.048] (-758.959) -- 0:00:08
856500 -- (-757.937) (-762.331) [-759.803] (-757.649) * (-758.124) (-763.568) [-760.479] (-759.539) -- 0:00:08
857000 -- (-759.269) [-765.613] (-758.566) (-758.782) * (-758.224) (-758.748) (-761.889) [-760.042] -- 0:00:08
857500 -- (-760.078) (-760.376) [-759.048] (-761.632) * (-759.792) (-760.974) [-761.524] (-759.878) -- 0:00:08
858000 -- [-760.216] (-764.126) (-759.334) (-760.926) * (-759.286) (-758.935) (-765.162) [-758.298] -- 0:00:08
858500 -- (-762.787) (-759.246) (-759.180) [-758.973] * [-758.321] (-758.775) (-759.999) (-758.443) -- 0:00:08
859000 -- [-758.092] (-759.779) (-759.473) (-761.685) * (-761.002) (-759.977) (-764.843) [-763.783] -- 0:00:08
859500 -- (-759.056) [-759.673] (-758.934) (-763.311) * (-762.715) (-759.129) (-761.860) [-758.101] -- 0:00:08
860000 -- (-759.471) (-758.804) (-758.213) [-761.495] * (-759.520) (-761.727) (-758.711) [-758.118] -- 0:00:08
Average standard deviation of split frequencies: 0.009215
860500 -- (-760.743) (-759.713) (-759.252) [-763.899] * (-757.900) (-759.491) [-758.269] (-759.185) -- 0:00:08
861000 -- (-760.316) [-761.967] (-762.089) (-759.949) * [-761.351] (-760.088) (-761.820) (-759.681) -- 0:00:08
861500 -- [-760.672] (-759.975) (-757.660) (-758.444) * (-761.251) (-761.288) (-757.933) [-759.363] -- 0:00:08
862000 -- (-758.820) (-758.411) [-757.712] (-760.592) * (-763.457) [-758.926] (-759.539) (-759.472) -- 0:00:08
862500 -- (-760.384) (-759.690) (-760.607) [-763.231] * (-763.702) [-759.511] (-759.520) (-767.672) -- 0:00:08
863000 -- (-759.143) (-759.235) (-760.966) [-763.141] * [-760.808] (-758.058) (-760.372) (-759.371) -- 0:00:08
863500 -- [-758.359] (-763.633) (-762.467) (-767.899) * (-760.537) [-758.639] (-759.575) (-761.371) -- 0:00:08
864000 -- [-760.279] (-763.829) (-759.495) (-770.738) * (-759.046) [-760.676] (-760.189) (-760.411) -- 0:00:08
864500 -- (-763.569) [-759.535] (-758.565) (-761.480) * [-759.610] (-758.377) (-758.977) (-760.346) -- 0:00:07
865000 -- [-759.027] (-760.384) (-762.087) (-760.270) * [-758.087] (-757.727) (-760.022) (-758.081) -- 0:00:07
Average standard deviation of split frequencies: 0.008998
865500 -- (-762.289) (-761.816) [-759.090] (-761.110) * (-758.143) (-757.745) (-761.575) [-758.366] -- 0:00:07
866000 -- (-759.207) [-759.802] (-760.150) (-762.602) * (-758.972) [-760.127] (-761.335) (-758.502) -- 0:00:07
866500 -- (-758.403) (-758.712) [-759.523] (-758.066) * (-761.593) (-761.550) (-763.355) [-761.164] -- 0:00:08
867000 -- (-760.367) (-758.958) (-762.148) [-761.222] * (-759.901) (-762.256) [-761.233] (-762.562) -- 0:00:07
867500 -- [-759.719] (-764.153) (-758.752) (-760.812) * (-759.188) (-761.572) [-759.538] (-760.766) -- 0:00:07
868000 -- (-758.952) (-760.857) [-759.396] (-758.752) * (-758.565) [-762.397] (-759.114) (-759.098) -- 0:00:07
868500 -- (-763.151) (-765.906) [-760.041] (-758.940) * (-761.170) (-761.185) [-759.783] (-764.142) -- 0:00:07
869000 -- (-764.051) [-761.435] (-766.287) (-760.316) * (-760.487) (-759.478) (-760.268) [-763.091] -- 0:00:07
869500 -- (-758.542) (-759.230) [-759.627] (-758.042) * (-760.210) (-762.696) [-759.981] (-759.054) -- 0:00:07
870000 -- (-758.488) (-761.283) [-759.251] (-760.335) * (-760.807) (-760.032) [-761.557] (-759.083) -- 0:00:07
Average standard deviation of split frequencies: 0.009204
870500 -- [-759.282] (-760.259) (-759.121) (-761.137) * (-765.629) (-759.715) [-759.910] (-758.878) -- 0:00:07
871000 -- [-758.331] (-762.868) (-763.628) (-758.942) * (-758.404) [-760.072] (-759.871) (-761.621) -- 0:00:07
871500 -- [-764.735] (-758.575) (-760.406) (-759.223) * (-760.896) (-760.177) [-757.965] (-759.609) -- 0:00:07
872000 -- (-760.269) (-758.203) [-757.828] (-761.133) * (-758.531) (-763.100) [-759.003] (-763.663) -- 0:00:07
872500 -- (-760.948) (-758.642) [-758.860] (-758.573) * (-759.160) (-762.452) [-761.804] (-763.625) -- 0:00:07
873000 -- (-760.821) (-759.785) [-760.336] (-763.873) * [-758.189] (-759.050) (-761.746) (-761.226) -- 0:00:07
873500 -- (-759.722) [-759.379] (-758.741) (-763.594) * (-759.104) [-759.391] (-761.492) (-759.102) -- 0:00:07
874000 -- [-759.152] (-759.935) (-759.292) (-757.752) * (-764.078) (-760.762) (-760.595) [-759.371] -- 0:00:07
874500 -- (-759.613) (-762.420) [-757.990] (-759.595) * (-759.446) (-760.454) [-759.130] (-760.113) -- 0:00:07
875000 -- [-759.263] (-760.578) (-758.222) (-760.022) * (-760.726) (-760.626) [-759.592] (-759.371) -- 0:00:07
Average standard deviation of split frequencies: 0.009338
875500 -- (-760.103) (-760.464) (-758.354) [-760.197] * (-758.824) (-759.254) (-759.851) [-758.705] -- 0:00:07
876000 -- [-760.356] (-761.487) (-758.013) (-758.625) * (-766.809) (-760.246) [-761.231] (-759.084) -- 0:00:07
876500 -- [-761.068] (-759.339) (-761.289) (-758.914) * (-761.551) [-759.633] (-763.749) (-761.385) -- 0:00:07
877000 -- [-758.408] (-759.340) (-759.797) (-758.319) * [-759.867] (-759.160) (-762.073) (-760.503) -- 0:00:07
877500 -- (-760.028) [-758.812] (-760.494) (-759.339) * (-759.384) [-759.661] (-760.886) (-759.283) -- 0:00:07
878000 -- [-759.266] (-757.883) (-758.801) (-757.710) * (-760.282) [-759.688] (-759.502) (-759.877) -- 0:00:07
878500 -- (-760.959) [-758.147] (-759.010) (-757.627) * [-757.703] (-759.338) (-761.367) (-758.066) -- 0:00:07
879000 -- (-758.793) (-763.249) (-758.456) [-758.129] * (-757.919) [-760.182] (-758.146) (-759.242) -- 0:00:07
879500 -- (-758.874) (-758.130) [-759.028] (-758.551) * (-759.691) (-760.059) (-758.580) [-759.348] -- 0:00:07
880000 -- (-758.372) (-759.321) (-760.193) [-758.003] * (-758.412) (-760.698) (-759.091) [-758.834] -- 0:00:07
Average standard deviation of split frequencies: 0.009769
880500 -- (-771.385) (-759.893) [-759.745] (-760.224) * [-757.491] (-759.847) (-760.692) (-761.908) -- 0:00:07
881000 -- (-762.628) [-763.610] (-760.608) (-760.524) * [-761.668] (-760.193) (-760.657) (-759.502) -- 0:00:07
881500 -- [-759.701] (-758.452) (-762.096) (-759.613) * (-762.572) [-758.046] (-761.236) (-761.321) -- 0:00:06
882000 -- (-759.407) (-763.444) (-762.800) [-762.465] * [-759.949] (-764.848) (-762.743) (-760.314) -- 0:00:06
882500 -- [-758.112] (-759.295) (-760.112) (-760.114) * (-758.317) (-759.029) [-761.661] (-758.427) -- 0:00:06
883000 -- (-758.121) [-760.758] (-762.711) (-763.248) * (-759.372) [-763.098] (-761.231) (-759.109) -- 0:00:07
883500 -- (-758.271) (-763.102) (-762.228) [-761.479] * (-758.232) (-760.313) (-760.011) [-760.557] -- 0:00:06
884000 -- (-758.376) [-763.263] (-758.682) (-757.717) * (-760.088) [-759.063] (-762.257) (-762.030) -- 0:00:06
884500 -- (-758.360) (-761.334) [-760.992] (-759.152) * (-761.573) (-759.276) [-758.590] (-761.101) -- 0:00:06
885000 -- [-759.804] (-761.224) (-760.984) (-758.937) * (-763.432) (-759.300) [-761.147] (-757.938) -- 0:00:06
Average standard deviation of split frequencies: 0.009411
885500 -- (-759.618) (-760.727) (-758.600) [-759.857] * (-760.621) (-759.263) [-758.604] (-759.743) -- 0:00:06
886000 -- (-761.125) (-761.462) (-760.334) [-758.084] * [-759.912] (-761.127) (-761.780) (-758.198) -- 0:00:06
886500 -- [-758.974] (-759.829) (-767.095) (-759.057) * (-760.617) (-760.240) (-761.612) [-762.035] -- 0:00:06
887000 -- (-759.287) (-760.229) (-764.410) [-757.766] * (-761.081) (-760.054) [-759.343] (-761.480) -- 0:00:06
887500 -- [-759.759] (-761.173) (-760.502) (-759.938) * (-758.584) (-759.443) [-760.410] (-762.707) -- 0:00:06
888000 -- (-758.362) (-761.943) [-762.342] (-758.307) * (-762.165) [-760.617] (-763.833) (-762.777) -- 0:00:06
888500 -- (-761.518) (-768.992) (-759.052) [-759.156] * (-759.848) (-759.670) [-759.851] (-760.393) -- 0:00:06
889000 -- (-759.392) (-760.889) (-757.914) [-759.108] * [-759.109] (-763.129) (-759.773) (-759.526) -- 0:00:06
889500 -- (-764.905) (-761.153) [-758.587] (-758.811) * (-760.347) (-765.691) [-759.334] (-761.275) -- 0:00:06
890000 -- (-760.961) [-760.839] (-758.672) (-760.964) * (-760.887) [-765.379] (-758.411) (-761.810) -- 0:00:06
Average standard deviation of split frequencies: 0.009196
890500 -- (-762.323) (-758.702) (-759.655) [-760.348] * [-759.876] (-761.937) (-757.762) (-758.755) -- 0:00:06
891000 -- (-759.858) (-761.002) [-758.097] (-761.833) * (-760.272) (-758.695) [-760.685] (-758.874) -- 0:00:06
891500 -- (-759.336) [-762.090] (-758.211) (-760.032) * (-761.575) [-757.655] (-761.026) (-759.345) -- 0:00:06
892000 -- (-757.596) [-761.563] (-758.681) (-760.173) * (-758.972) (-758.244) (-758.462) [-761.285] -- 0:00:06
892500 -- (-759.837) (-758.455) (-760.320) [-760.578] * (-765.381) [-762.639] (-760.580) (-761.742) -- 0:00:06
893000 -- (-759.869) [-758.564] (-758.524) (-758.041) * [-759.034] (-760.310) (-763.373) (-760.115) -- 0:00:06
893500 -- (-760.287) (-759.652) [-757.784] (-758.318) * (-760.246) (-757.917) [-761.615] (-760.322) -- 0:00:06
894000 -- (-762.287) (-758.311) (-757.885) [-759.379] * (-758.900) (-758.242) (-758.981) [-758.290] -- 0:00:06
894500 -- (-762.302) (-760.581) (-760.003) [-760.332] * (-758.716) [-759.490] (-760.190) (-765.662) -- 0:00:06
895000 -- (-759.507) (-759.016) [-759.955] (-761.571) * [-757.932] (-757.570) (-761.058) (-759.979) -- 0:00:06
Average standard deviation of split frequencies: 0.009996
895500 -- (-764.245) [-762.843] (-763.591) (-760.628) * (-763.787) (-760.240) [-758.399] (-763.702) -- 0:00:06
896000 -- [-763.402] (-759.039) (-760.499) (-760.703) * (-763.787) (-758.845) [-758.775] (-759.239) -- 0:00:06
896500 -- (-765.926) [-759.190] (-762.001) (-758.004) * (-759.581) (-760.184) (-759.456) [-759.227] -- 0:00:06
897000 -- [-761.655] (-758.746) (-760.347) (-760.204) * [-761.851] (-760.074) (-762.386) (-759.984) -- 0:00:06
897500 -- (-762.481) (-759.418) [-759.516] (-759.437) * (-767.189) (-764.445) (-760.900) [-760.183] -- 0:00:06
898000 -- [-761.665] (-759.263) (-759.566) (-759.726) * [-768.807] (-762.898) (-759.655) (-761.918) -- 0:00:06
898500 -- (-759.025) [-759.046] (-761.899) (-758.503) * [-766.569] (-760.735) (-760.642) (-759.848) -- 0:00:05
899000 -- (-760.273) [-758.325] (-762.780) (-764.876) * [-763.673] (-759.597) (-761.438) (-761.729) -- 0:00:05
899500 -- (-759.511) (-760.370) (-759.662) [-761.352] * (-762.087) [-763.828] (-759.318) (-761.139) -- 0:00:05
900000 -- (-761.154) (-761.835) [-762.772] (-759.767) * (-758.833) (-758.000) (-759.126) [-761.678] -- 0:00:06
Average standard deviation of split frequencies: 0.010084
900500 -- (-759.213) (-759.922) [-764.664] (-763.979) * (-757.830) [-757.846] (-758.276) (-760.057) -- 0:00:05
901000 -- [-760.622] (-758.072) (-761.843) (-760.273) * (-760.174) (-757.899) (-759.411) [-762.969] -- 0:00:05
901500 -- (-761.159) (-760.854) [-760.927] (-762.680) * (-761.695) [-758.599] (-759.592) (-758.789) -- 0:00:05
902000 -- (-762.195) (-763.097) [-759.993] (-760.784) * (-760.016) (-758.336) [-758.660] (-760.848) -- 0:00:05
902500 -- (-758.816) [-761.358] (-762.598) (-760.806) * [-758.423] (-758.516) (-761.056) (-761.634) -- 0:00:05
903000 -- [-758.551] (-759.635) (-766.559) (-760.079) * (-760.372) (-758.367) [-758.943] (-760.265) -- 0:00:05
903500 -- (-758.801) (-760.228) (-765.532) [-760.358] * (-761.707) (-759.568) (-758.957) [-758.112] -- 0:00:05
904000 -- [-762.261] (-760.227) (-760.570) (-760.613) * (-759.629) (-758.178) (-763.420) [-758.920] -- 0:00:05
904500 -- (-760.824) [-761.055] (-759.344) (-759.097) * [-757.996] (-759.593) (-759.470) (-762.617) -- 0:00:05
905000 -- (-759.824) (-762.768) [-760.014] (-758.053) * (-762.499) (-760.493) (-760.969) [-758.683] -- 0:00:05
Average standard deviation of split frequencies: 0.010233
905500 -- [-760.670] (-760.058) (-759.082) (-761.727) * (-767.293) (-760.071) (-758.906) [-758.904] -- 0:00:05
906000 -- (-762.415) (-757.919) (-763.130) [-758.109] * (-763.417) [-762.571] (-759.318) (-764.272) -- 0:00:05
906500 -- [-758.252] (-758.946) (-758.786) (-758.904) * (-766.421) [-761.292] (-761.764) (-762.920) -- 0:00:05
907000 -- (-759.635) [-761.662] (-764.679) (-758.475) * (-764.762) [-760.973] (-758.456) (-759.262) -- 0:00:05
907500 -- (-761.232) [-762.050] (-759.878) (-763.417) * (-766.417) (-761.591) (-758.778) [-758.116] -- 0:00:05
908000 -- (-767.462) (-760.373) [-760.631] (-762.371) * [-760.141] (-759.346) (-759.811) (-759.728) -- 0:00:05
908500 -- (-758.450) (-764.048) [-758.356] (-762.180) * [-758.015] (-760.188) (-759.648) (-760.433) -- 0:00:05
909000 -- (-759.927) (-759.242) [-759.891] (-759.266) * (-759.249) [-763.088] (-765.872) (-760.846) -- 0:00:05
909500 -- (-759.621) (-760.310) [-761.759] (-764.150) * (-761.322) [-761.744] (-760.526) (-759.131) -- 0:00:05
910000 -- (-759.162) (-758.764) (-761.080) [-760.077] * (-762.304) [-758.972] (-759.213) (-762.085) -- 0:00:05
Average standard deviation of split frequencies: 0.010042
910500 -- (-761.877) [-760.085] (-764.954) (-766.453) * (-759.897) [-759.707] (-758.603) (-760.800) -- 0:00:05
911000 -- [-759.751] (-759.225) (-759.867) (-767.735) * (-763.394) (-758.630) (-760.607) [-764.416] -- 0:00:05
911500 -- (-759.228) [-758.956] (-761.585) (-757.960) * [-763.775] (-758.304) (-763.178) (-759.990) -- 0:00:05
912000 -- (-760.810) (-760.608) (-763.597) [-760.086] * [-758.759] (-758.935) (-760.803) (-760.149) -- 0:00:05
912500 -- [-759.922] (-758.939) (-762.337) (-761.034) * (-762.438) [-761.377] (-761.743) (-759.707) -- 0:00:05
913000 -- (-758.936) (-763.770) [-758.369] (-763.491) * (-759.263) (-762.726) (-762.274) [-762.187] -- 0:00:05
913500 -- (-761.039) [-759.004] (-759.973) (-760.603) * (-759.620) [-760.062] (-761.102) (-758.552) -- 0:00:05
914000 -- [-758.394] (-758.556) (-762.717) (-760.086) * (-759.253) [-761.543] (-759.714) (-760.637) -- 0:00:05
914500 -- (-759.179) (-764.027) [-759.156] (-760.489) * (-765.893) (-759.485) [-759.395] (-762.217) -- 0:00:05
915000 -- (-758.280) (-759.900) [-758.812] (-760.184) * (-759.666) [-758.019] (-759.552) (-759.889) -- 0:00:05
Average standard deviation of split frequencies: 0.009881
915500 -- (-763.990) [-760.271] (-760.712) (-759.975) * (-758.062) (-758.246) [-759.129] (-760.301) -- 0:00:04
916000 -- [-758.868] (-760.330) (-759.136) (-761.799) * (-757.702) (-759.814) [-759.602] (-762.672) -- 0:00:04
916500 -- (-758.504) (-761.819) [-760.895] (-762.273) * (-758.002) [-760.437] (-759.360) (-762.831) -- 0:00:05
917000 -- [-759.502] (-757.902) (-762.866) (-761.547) * (-758.860) (-761.672) [-759.419] (-760.150) -- 0:00:04
917500 -- (-760.807) (-760.881) (-760.154) [-765.436] * (-758.160) (-759.670) [-759.942] (-761.292) -- 0:00:04
918000 -- (-761.380) [-759.345] (-760.707) (-758.441) * (-758.512) (-759.669) [-760.274] (-758.685) -- 0:00:04
918500 -- (-759.765) (-757.984) (-759.933) [-758.935] * (-763.890) (-759.201) (-761.709) [-758.875] -- 0:00:04
919000 -- (-760.274) (-759.395) [-760.214] (-761.074) * [-762.692] (-760.318) (-761.759) (-760.801) -- 0:00:04
919500 -- (-758.394) [-759.163] (-758.392) (-760.272) * (-761.152) (-760.306) (-758.930) [-759.813] -- 0:00:04
920000 -- [-758.435] (-759.972) (-759.457) (-759.176) * [-760.979] (-761.692) (-757.735) (-760.939) -- 0:00:04
Average standard deviation of split frequencies: 0.010104
920500 -- (-763.355) [-758.401] (-759.113) (-760.232) * [-759.897] (-762.713) (-764.449) (-758.167) -- 0:00:04
921000 -- (-761.354) [-760.797] (-760.681) (-760.007) * (-759.808) (-764.886) (-762.897) [-760.531] -- 0:00:04
921500 -- (-758.551) [-759.045] (-757.977) (-758.951) * (-760.112) (-759.934) (-762.155) [-759.863] -- 0:00:04
922000 -- [-759.317] (-761.680) (-758.095) (-758.659) * (-762.477) (-761.817) [-763.141] (-761.112) -- 0:00:04
922500 -- [-760.516] (-758.267) (-758.158) (-762.245) * (-761.880) [-759.878] (-762.698) (-759.740) -- 0:00:04
923000 -- (-761.691) (-759.340) [-759.549] (-761.736) * [-759.336] (-758.276) (-762.879) (-761.164) -- 0:00:04
923500 -- (-757.961) [-758.031] (-762.569) (-761.318) * (-758.986) (-761.679) [-760.794] (-759.779) -- 0:00:04
924000 -- [-757.959] (-759.794) (-763.746) (-759.683) * [-758.790] (-765.855) (-760.957) (-759.123) -- 0:00:04
924500 -- (-758.228) [-759.371] (-764.392) (-760.332) * (-760.707) (-760.669) (-760.858) [-759.162] -- 0:00:04
925000 -- [-759.408] (-760.827) (-760.424) (-759.698) * (-758.503) (-761.372) (-759.288) [-759.605] -- 0:00:04
Average standard deviation of split frequencies: 0.009706
925500 -- (-760.254) (-758.559) (-759.213) [-759.130] * [-758.194] (-760.343) (-759.845) (-759.015) -- 0:00:04
926000 -- (-758.230) [-757.992] (-764.146) (-758.228) * (-762.196) (-758.653) [-762.321] (-758.523) -- 0:00:04
926500 -- (-761.205) [-758.233] (-763.037) (-758.930) * [-759.548] (-758.320) (-760.083) (-758.259) -- 0:00:04
927000 -- (-758.773) (-759.225) (-761.085) [-757.953] * [-761.652] (-758.923) (-758.599) (-758.987) -- 0:00:04
927500 -- (-763.341) [-757.818] (-760.147) (-759.751) * (-762.187) [-760.101] (-759.329) (-761.623) -- 0:00:04
928000 -- (-762.203) [-761.365] (-759.506) (-763.858) * (-758.762) (-761.243) (-757.867) [-759.255] -- 0:00:04
928500 -- [-758.806] (-759.376) (-761.623) (-762.731) * (-758.163) (-760.505) (-759.921) [-761.038] -- 0:00:04
929000 -- (-759.180) [-760.026] (-762.149) (-760.032) * (-759.426) [-759.168] (-758.392) (-762.060) -- 0:00:04
929500 -- [-761.354] (-759.899) (-758.150) (-760.616) * (-759.766) [-761.127] (-758.778) (-761.172) -- 0:00:04
930000 -- [-759.943] (-759.213) (-763.570) (-764.288) * (-760.613) (-758.372) [-759.908] (-760.722) -- 0:00:04
Average standard deviation of split frequencies: 0.009759
930500 -- (-758.746) [-758.827] (-761.266) (-759.915) * [-761.277] (-761.306) (-758.543) (-762.062) -- 0:00:04
931000 -- (-758.756) [-760.837] (-761.594) (-761.172) * [-759.192] (-762.334) (-759.278) (-759.720) -- 0:00:04
931500 -- (-761.237) (-765.668) (-760.768) [-759.725] * (-761.535) (-759.100) (-760.551) [-760.685] -- 0:00:04
932000 -- (-757.844) (-760.955) (-759.792) [-759.322] * [-758.193] (-759.137) (-760.413) (-759.760) -- 0:00:04
932500 -- (-763.397) [-764.178] (-762.246) (-759.798) * (-758.151) (-760.081) [-759.517] (-762.573) -- 0:00:03
933000 -- (-758.378) (-765.129) (-758.889) [-759.902] * [-757.969] (-758.175) (-758.945) (-760.300) -- 0:00:03
933500 -- (-759.472) (-761.390) [-757.882] (-758.748) * (-758.037) (-759.276) (-761.195) [-758.190] -- 0:00:03
934000 -- (-759.101) (-760.754) [-758.502] (-758.820) * (-761.576) (-763.353) (-760.641) [-762.371] -- 0:00:03
934500 -- (-764.074) (-761.850) [-761.342] (-759.400) * (-758.612) (-761.364) (-760.687) [-759.744] -- 0:00:03
935000 -- [-760.883] (-758.761) (-760.155) (-761.075) * (-765.997) (-758.578) (-760.446) [-761.862] -- 0:00:03
Average standard deviation of split frequencies: 0.009871
935500 -- (-764.466) (-758.886) [-758.332] (-761.532) * (-759.332) [-759.530] (-759.303) (-758.429) -- 0:00:03
936000 -- [-761.843] (-759.635) (-759.771) (-758.717) * (-758.349) (-759.528) (-760.858) [-758.506] -- 0:00:03
936500 -- (-759.138) (-767.082) (-759.359) [-758.688] * [-759.519] (-761.074) (-759.822) (-759.768) -- 0:00:03
937000 -- (-762.737) (-758.638) (-758.110) [-758.735] * (-759.902) [-758.194] (-757.666) (-758.663) -- 0:00:03
937500 -- [-758.466] (-758.677) (-757.992) (-760.289) * [-760.496] (-759.037) (-759.649) (-760.368) -- 0:00:03
938000 -- (-760.572) (-759.488) [-758.465] (-761.875) * (-762.241) (-757.935) [-762.320] (-758.696) -- 0:00:03
938500 -- (-759.362) (-759.618) [-758.473] (-763.418) * (-758.204) (-758.168) (-760.029) [-760.848] -- 0:00:03
939000 -- [-758.530] (-758.470) (-758.297) (-764.774) * [-758.459] (-758.221) (-757.792) (-758.393) -- 0:00:03
939500 -- (-759.714) (-759.507) (-760.199) [-760.967] * (-762.348) [-758.733] (-759.323) (-758.206) -- 0:00:03
940000 -- (-761.908) [-758.773] (-759.812) (-758.204) * [-758.867] (-759.296) (-757.790) (-759.206) -- 0:00:03
Average standard deviation of split frequencies: 0.009923
940500 -- (-759.751) (-758.420) [-758.750] (-758.457) * (-760.310) (-759.206) [-760.914] (-762.965) -- 0:00:03
941000 -- [-759.815] (-759.940) (-760.459) (-758.591) * (-761.027) [-763.034] (-759.030) (-758.453) -- 0:00:03
941500 -- (-761.346) (-761.046) [-758.386] (-757.982) * [-760.643] (-759.214) (-762.164) (-761.675) -- 0:00:03
942000 -- (-760.840) (-760.500) (-758.657) [-758.243] * (-758.546) (-762.032) (-765.677) [-758.124] -- 0:00:03
942500 -- (-761.604) (-760.597) (-758.555) [-758.840] * (-760.256) (-761.770) [-760.197] (-758.254) -- 0:00:03
943000 -- (-769.099) (-759.418) [-759.697] (-757.744) * [-762.396] (-763.508) (-760.028) (-758.514) -- 0:00:03
943500 -- (-762.306) [-759.931] (-758.097) (-757.954) * [-758.932] (-764.033) (-764.018) (-758.762) -- 0:00:03
944000 -- (-761.215) (-760.685) (-761.033) [-758.278] * (-759.999) [-760.547] (-760.225) (-759.075) -- 0:00:03
944500 -- [-759.413] (-762.689) (-760.329) (-759.504) * (-760.104) (-760.760) (-761.604) [-760.311] -- 0:00:03
945000 -- (-758.553) (-763.427) [-761.018] (-761.427) * (-761.638) [-759.858] (-761.921) (-760.295) -- 0:00:03
Average standard deviation of split frequencies: 0.009734
945500 -- (-768.113) [-766.991] (-758.825) (-761.037) * (-761.794) [-757.936] (-760.063) (-760.068) -- 0:00:03
946000 -- (-765.446) [-761.107] (-759.910) (-764.074) * [-761.249] (-758.365) (-764.860) (-759.826) -- 0:00:03
946500 -- (-759.262) [-759.579] (-757.834) (-762.433) * (-761.505) (-763.985) (-764.268) [-757.781] -- 0:00:03
947000 -- [-760.981] (-759.939) (-758.441) (-759.841) * (-758.162) (-763.586) (-758.866) [-762.292] -- 0:00:03
947500 -- (-759.182) (-762.527) [-758.009] (-760.511) * [-757.482] (-763.037) (-758.370) (-762.733) -- 0:00:03
948000 -- [-759.458] (-762.225) (-760.231) (-758.880) * (-763.727) [-761.180] (-758.700) (-762.039) -- 0:00:03
948500 -- [-759.441] (-759.144) (-763.812) (-759.349) * (-758.691) (-761.248) (-758.818) [-761.072] -- 0:00:03
949000 -- [-758.238] (-758.975) (-762.996) (-758.836) * (-761.282) [-758.541] (-760.228) (-759.132) -- 0:00:03
949500 -- [-758.135] (-759.586) (-764.019) (-758.325) * (-762.783) (-761.648) (-759.455) [-759.420] -- 0:00:02
950000 -- [-757.977] (-759.885) (-762.591) (-760.311) * (-765.786) [-759.114] (-760.051) (-759.117) -- 0:00:02
Average standard deviation of split frequencies: 0.009686
950500 -- [-757.913] (-765.532) (-758.811) (-760.124) * [-758.544] (-762.127) (-765.146) (-758.393) -- 0:00:02
951000 -- (-758.050) (-760.139) (-760.767) [-759.779] * (-758.367) (-761.504) [-761.909] (-759.798) -- 0:00:02
951500 -- (-760.626) (-761.915) [-760.851] (-762.747) * (-758.386) (-759.044) (-760.736) [-759.621] -- 0:00:02
952000 -- [-760.983] (-761.208) (-762.791) (-761.069) * (-758.127) [-758.230] (-764.819) (-759.480) -- 0:00:02
952500 -- (-759.365) (-761.105) [-759.649] (-761.149) * (-763.366) (-758.045) [-759.029] (-759.576) -- 0:00:02
953000 -- (-763.985) (-763.532) [-759.759] (-758.758) * (-762.043) [-762.029] (-759.124) (-760.481) -- 0:00:02
953500 -- [-762.022] (-761.130) (-763.736) (-760.324) * (-762.570) (-760.702) [-760.474] (-760.349) -- 0:00:02
954000 -- (-760.612) (-758.629) [-758.483] (-759.946) * (-764.369) (-760.768) (-757.940) [-758.965] -- 0:00:02
954500 -- [-760.487] (-760.817) (-764.882) (-759.545) * (-765.768) (-760.573) (-760.843) [-764.507] -- 0:00:02
955000 -- (-761.590) (-760.303) [-759.131] (-759.826) * (-761.259) [-760.723] (-760.532) (-761.713) -- 0:00:02
Average standard deviation of split frequencies: 0.009763
955500 -- (-759.755) [-760.593] (-760.752) (-759.306) * (-757.990) [-759.868] (-763.066) (-761.800) -- 0:00:02
956000 -- (-761.963) [-760.362] (-759.661) (-759.502) * (-759.740) (-759.196) (-762.741) [-760.826] -- 0:00:02
956500 -- [-760.031] (-758.098) (-761.813) (-760.406) * [-758.077] (-760.937) (-760.966) (-760.765) -- 0:00:02
957000 -- (-759.531) (-759.784) [-757.983] (-758.324) * (-758.541) (-760.155) [-765.803] (-762.413) -- 0:00:02
957500 -- [-759.725] (-760.383) (-759.842) (-763.584) * (-758.650) (-762.346) [-761.121] (-759.131) -- 0:00:02
958000 -- (-759.020) [-757.755] (-763.166) (-761.686) * (-759.478) (-760.649) (-761.098) [-759.806] -- 0:00:02
958500 -- (-761.570) (-757.886) [-762.123] (-760.052) * [-759.975] (-762.105) (-761.579) (-759.237) -- 0:00:02
959000 -- (-760.181) (-759.681) (-760.521) [-759.708] * (-759.080) (-758.194) (-758.887) [-759.119] -- 0:00:02
959500 -- [-757.976] (-760.357) (-759.288) (-760.224) * (-759.040) (-760.045) (-758.914) [-761.187] -- 0:00:02
960000 -- (-759.699) [-761.405] (-758.399) (-760.791) * (-760.924) [-757.809] (-759.685) (-758.965) -- 0:00:02
Average standard deviation of split frequencies: 0.009552
960500 -- [-762.436] (-759.429) (-757.897) (-761.368) * (-761.148) (-763.448) [-758.067] (-758.987) -- 0:00:02
961000 -- (-758.582) [-758.445] (-761.723) (-760.023) * (-758.982) (-759.044) [-760.139] (-759.493) -- 0:00:02
961500 -- (-760.525) [-760.455] (-762.147) (-758.627) * (-759.048) (-761.336) [-760.984] (-764.430) -- 0:00:02
962000 -- [-761.465] (-760.490) (-759.661) (-758.966) * (-757.856) (-761.541) [-761.587] (-759.649) -- 0:00:02
962500 -- [-759.918] (-758.792) (-763.094) (-760.529) * (-760.563) [-759.729] (-758.846) (-758.708) -- 0:00:02
963000 -- (-760.687) [-757.766] (-758.380) (-759.375) * (-762.433) (-758.845) [-761.851] (-766.131) -- 0:00:02
963500 -- (-761.565) (-758.410) (-759.116) [-762.484] * (-761.830) (-758.134) [-761.236] (-765.572) -- 0:00:02
964000 -- (-759.453) (-759.052) (-762.955) [-757.979] * (-759.909) [-758.409] (-758.711) (-759.541) -- 0:00:02
964500 -- (-758.492) (-758.600) [-758.517] (-759.478) * (-766.214) [-759.448] (-761.503) (-763.248) -- 0:00:02
965000 -- (-760.129) (-759.826) (-759.396) [-759.015] * [-759.369] (-761.274) (-761.611) (-763.588) -- 0:00:02
Average standard deviation of split frequencies: 0.009467
965500 -- (-760.839) [-758.754] (-759.959) (-762.600) * (-759.686) (-758.165) (-759.544) [-762.173] -- 0:00:02
966000 -- (-762.472) (-760.769) [-759.224] (-757.946) * (-760.687) [-759.481] (-759.528) (-758.450) -- 0:00:02
966500 -- (-762.319) [-760.818] (-761.964) (-758.721) * (-762.886) [-760.073] (-759.546) (-761.501) -- 0:00:01
967000 -- [-759.876] (-764.375) (-758.783) (-758.764) * [-761.435] (-759.168) (-759.111) (-759.455) -- 0:00:01
967500 -- (-758.859) (-759.402) (-761.712) [-758.306] * (-760.602) (-760.154) (-759.634) [-758.711] -- 0:00:01
968000 -- (-759.546) [-758.305] (-761.252) (-760.178) * [-758.429] (-760.633) (-763.840) (-759.755) -- 0:00:01
968500 -- (-758.644) (-760.238) (-762.121) [-759.306] * (-758.863) (-759.445) [-760.511] (-759.490) -- 0:00:01
969000 -- (-759.987) (-758.540) (-759.182) [-759.018] * (-759.514) [-761.391] (-761.766) (-758.653) -- 0:00:01
969500 -- [-761.745] (-759.427) (-760.274) (-758.640) * (-760.970) (-762.153) (-763.024) [-757.799] -- 0:00:01
970000 -- (-757.661) (-762.427) (-758.900) [-758.587] * (-759.700) (-758.315) [-761.005] (-760.557) -- 0:00:01
Average standard deviation of split frequencies: 0.009810
970500 -- (-758.267) (-759.342) (-760.103) [-758.680] * (-760.191) (-758.629) (-760.483) [-760.012] -- 0:00:01
971000 -- [-758.113] (-760.378) (-759.158) (-759.528) * (-761.321) (-759.120) (-757.876) [-760.343] -- 0:00:01
971500 -- [-761.045] (-759.477) (-760.624) (-759.708) * (-759.377) [-758.851] (-761.082) (-758.209) -- 0:00:01
972000 -- (-759.119) (-761.335) (-759.876) [-760.924] * (-758.905) (-759.298) (-758.221) [-761.558] -- 0:00:01
972500 -- [-760.108] (-761.077) (-758.956) (-760.616) * [-759.099] (-759.468) (-758.478) (-758.793) -- 0:00:01
973000 -- [-762.650] (-758.972) (-759.366) (-761.024) * (-762.837) (-759.375) (-758.595) [-758.362] -- 0:00:01
973500 -- (-761.560) [-761.210] (-761.548) (-760.315) * (-759.402) (-758.289) (-761.619) [-758.770] -- 0:00:01
974000 -- (-760.973) (-761.220) (-759.767) [-759.903] * (-759.058) (-761.134) [-757.999] (-763.406) -- 0:00:01
974500 -- (-769.168) (-760.145) [-759.888] (-760.922) * (-759.575) (-760.327) (-763.114) [-758.898] -- 0:00:01
975000 -- (-762.357) (-763.635) (-759.734) [-760.019] * (-762.461) [-761.109] (-762.165) (-759.547) -- 0:00:01
Average standard deviation of split frequencies: 0.009789
975500 -- (-762.390) (-760.581) [-759.154] (-757.991) * [-758.519] (-760.240) (-759.501) (-758.483) -- 0:00:01
976000 -- (-763.534) [-759.211] (-763.118) (-759.380) * [-761.535] (-760.826) (-758.273) (-758.855) -- 0:00:01
976500 -- (-763.683) (-761.235) [-759.899] (-764.063) * (-760.213) (-758.954) [-760.211] (-758.844) -- 0:00:01
977000 -- (-761.059) [-760.669] (-762.848) (-759.216) * (-763.202) (-759.293) (-760.292) [-760.936] -- 0:00:01
977500 -- (-758.736) (-761.946) [-760.638] (-758.508) * (-762.379) (-758.791) [-759.367] (-761.923) -- 0:00:01
978000 -- (-759.175) (-762.063) [-759.699] (-759.913) * (-758.985) (-761.238) [-758.014] (-759.949) -- 0:00:01
978500 -- (-760.027) [-759.300] (-758.118) (-770.186) * (-759.447) (-759.525) [-758.300] (-760.528) -- 0:00:01
979000 -- [-758.962] (-758.069) (-761.775) (-759.942) * (-758.745) [-759.366] (-758.735) (-762.374) -- 0:00:01
979500 -- (-757.887) [-759.030] (-761.297) (-759.909) * [-762.577] (-763.763) (-760.979) (-766.531) -- 0:00:01
980000 -- (-757.762) (-759.919) (-759.161) [-760.704] * [-761.631] (-761.435) (-758.426) (-762.825) -- 0:00:01
Average standard deviation of split frequencies: 0.009646
980500 -- [-765.841] (-762.320) (-758.159) (-759.033) * [-758.261] (-757.831) (-765.059) (-760.808) -- 0:00:01
981000 -- (-760.815) [-760.456] (-758.301) (-760.622) * (-758.604) [-758.130] (-759.015) (-760.219) -- 0:00:01
981500 -- [-760.037] (-760.594) (-760.246) (-762.763) * (-762.026) (-759.062) (-758.168) [-759.574] -- 0:00:01
982000 -- [-761.150] (-760.713) (-759.592) (-763.277) * (-761.261) [-760.422] (-758.013) (-759.022) -- 0:00:01
982500 -- [-758.611] (-759.928) (-762.243) (-761.338) * [-764.246] (-758.826) (-761.797) (-760.864) -- 0:00:01
983000 -- (-758.635) (-762.811) (-762.508) [-761.791] * [-762.046] (-762.638) (-761.553) (-759.462) -- 0:00:01
983500 -- [-759.194] (-759.646) (-761.165) (-759.097) * (-761.165) (-760.181) [-758.864] (-760.457) -- 0:00:00
984000 -- (-759.983) (-760.115) (-760.080) [-760.018] * (-758.948) (-760.565) [-760.757] (-761.086) -- 0:00:00
984500 -- (-759.597) [-758.944] (-765.618) (-761.192) * (-760.389) (-761.123) [-762.101] (-761.292) -- 0:00:00
985000 -- [-758.106] (-767.724) (-761.223) (-758.477) * (-761.974) (-762.256) (-760.450) [-759.133] -- 0:00:00
Average standard deviation of split frequencies: 0.009721
985500 -- (-759.819) (-759.411) [-759.204] (-760.204) * (-758.337) (-758.576) [-761.117] (-761.126) -- 0:00:00
986000 -- (-761.395) (-758.646) (-758.582) [-759.568] * (-757.971) [-758.355] (-762.757) (-760.569) -- 0:00:00
986500 -- (-759.738) (-759.087) (-758.528) [-758.215] * [-759.393] (-758.728) (-762.354) (-760.242) -- 0:00:00
987000 -- (-759.474) [-759.618] (-760.333) (-759.930) * [-761.993] (-761.671) (-759.235) (-762.366) -- 0:00:00
987500 -- (-758.780) (-761.261) (-760.687) [-759.605] * (-762.219) (-758.260) (-760.729) [-760.383] -- 0:00:00
988000 -- (-761.000) (-760.630) (-759.696) [-759.819] * (-761.501) [-758.343] (-761.217) (-767.366) -- 0:00:00
988500 -- [-760.627] (-759.138) (-760.159) (-758.189) * (-762.010) [-758.266] (-757.751) (-766.683) -- 0:00:00
989000 -- (-760.369) [-757.732] (-761.438) (-760.947) * (-760.529) (-763.344) [-757.630] (-759.439) -- 0:00:00
989500 -- (-760.656) [-757.769] (-760.982) (-758.586) * (-759.653) (-760.182) (-759.085) [-758.728] -- 0:00:00
990000 -- [-760.386] (-758.459) (-759.333) (-759.570) * (-760.327) (-766.217) (-763.984) [-760.528] -- 0:00:00
Average standard deviation of split frequencies: 0.009961
990500 -- (-761.186) (-760.414) [-762.363] (-758.589) * (-759.441) [-759.050] (-762.713) (-761.980) -- 0:00:00
991000 -- (-758.046) [-759.530] (-762.231) (-760.628) * (-759.853) (-758.653) [-758.313] (-758.465) -- 0:00:00
991500 -- [-761.547] (-763.632) (-758.785) (-758.274) * (-759.846) [-760.729] (-758.329) (-759.367) -- 0:00:00
992000 -- (-759.387) (-760.946) (-760.475) [-758.762] * (-757.779) [-759.007] (-757.757) (-760.924) -- 0:00:00
992500 -- (-760.988) (-761.532) [-758.476] (-761.314) * (-761.755) [-761.692] (-758.788) (-759.063) -- 0:00:00
993000 -- (-760.731) (-760.440) (-762.066) [-760.849] * [-759.222] (-761.106) (-758.950) (-759.378) -- 0:00:00
993500 -- (-759.289) [-761.230] (-758.750) (-763.921) * (-765.661) (-758.543) (-758.230) [-759.299] -- 0:00:00
994000 -- (-758.142) (-758.300) [-762.433] (-763.010) * (-767.424) (-764.357) [-759.006] (-758.995) -- 0:00:00
994500 -- [-760.787] (-762.278) (-757.781) (-761.749) * (-763.418) [-760.551] (-760.697) (-760.768) -- 0:00:00
995000 -- (-759.358) (-758.215) [-759.842] (-759.251) * (-758.937) (-760.080) (-760.142) [-759.192] -- 0:00:00
Average standard deviation of split frequencies: 0.009434
995500 -- [-759.424] (-757.779) (-764.743) (-760.206) * (-758.938) (-757.773) (-758.360) [-759.376] -- 0:00:00
996000 -- (-759.118) (-759.548) (-762.013) [-761.607] * [-757.591] (-759.452) (-758.336) (-761.113) -- 0:00:00
996500 -- (-759.644) (-759.748) [-759.392] (-762.494) * [-758.224] (-762.306) (-758.760) (-759.217) -- 0:00:00
997000 -- (-760.768) [-759.121] (-758.052) (-761.736) * [-761.326] (-759.727) (-758.420) (-760.720) -- 0:00:00
997500 -- [-761.241] (-759.126) (-758.036) (-760.917) * (-759.278) [-759.357] (-759.306) (-759.325) -- 0:00:00
998000 -- (-758.888) (-758.624) [-758.166] (-758.101) * [-758.257] (-759.476) (-762.900) (-759.485) -- 0:00:00
998500 -- (-759.996) (-758.588) (-761.349) [-758.344] * (-759.516) [-758.982] (-760.133) (-760.355) -- 0:00:00
999000 -- [-759.830] (-760.594) (-766.314) (-759.266) * (-758.280) [-758.843] (-759.548) (-759.015) -- 0:00:00
999500 -- [-760.594] (-758.842) (-759.302) (-761.671) * [-758.962] (-759.225) (-762.571) (-758.076) -- 0:00:00
1000000 -- (-758.591) [-758.540] (-759.413) (-761.248) * [-760.724] (-758.988) (-758.041) (-758.213) -- 0:00:00
Average standard deviation of split frequencies: 0.008825
Analysis completed in 59 seconds
Analysis used 58.80 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -757.46
Likelihood of best state for "cold" chain of run 2 was -757.46
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.2 % ( 27 %) Dirichlet(Pi{all})
31.7 % ( 22 %) Slider(Pi{all})
78.5 % ( 58 %) Multiplier(Alpha{1,2})
77.8 % ( 47 %) Multiplier(Alpha{3})
22.8 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.5 % ( 29 %) Dirichlet(Pi{all})
32.2 % ( 31 %) Slider(Pi{all})
79.2 % ( 62 %) Multiplier(Alpha{1,2})
78.3 % ( 64 %) Multiplier(Alpha{3})
22.7 % ( 12 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.63 0.50
2 | 166295 0.82 0.67
3 | 166709 166761 0.83
4 | 167030 166632 166573
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165731 0.82 0.67
3 | 166924 167580 0.84
4 | 166528 166787 166450
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -759.25
| 2 2 2|
| 1 1 2 2 |
| 1 1 1 2 22 1 2 12 2 1 1 |
| 2 2 1 1 * 2 1 1 1 1 |
|2 1 2 2 1 1 2 2 * 2 |
| 1 1 12 1 1 1 1 2 2 1 1 121 2 1 11|
|1 2 12 2 1 11 * *1 1 2 2 |
| 222 2 1 22 1 2 12 2 |
| 22 1 1 2 2 1 * 2 2 2 1 2 2 |
| 1 1 2 1 2 2 |
| 1 1 2 1 1 1 1 |
| 2 |
| 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -760.98
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -759.19 -762.50
2 -759.18 -762.90
--------------------------------------
TOTAL -759.18 -762.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888916 0.088597 0.383660 1.482354 0.849143 1501.00 1501.00 1.000
r(A<->C){all} 0.160812 0.019352 0.000006 0.439526 0.120430 187.07 251.88 1.008
r(A<->G){all} 0.167835 0.019242 0.000123 0.434547 0.132935 201.92 257.20 1.002
r(A<->T){all} 0.169274 0.021026 0.000063 0.462778 0.128825 163.91 234.00 1.000
r(C<->G){all} 0.169281 0.020259 0.000004 0.454211 0.135458 218.26 233.51 1.000
r(C<->T){all} 0.165300 0.019922 0.000045 0.448931 0.125992 140.14 207.74 1.000
r(G<->T){all} 0.167498 0.020732 0.000038 0.469782 0.128217 263.95 275.80 1.001
pi(A){all} 0.195938 0.000271 0.163018 0.226805 0.195527 1028.40 1235.98 1.000
pi(C){all} 0.258675 0.000345 0.223653 0.296563 0.258300 1240.81 1370.91 1.000
pi(G){all} 0.311445 0.000372 0.275239 0.349333 0.310926 1125.33 1246.56 1.000
pi(T){all} 0.233942 0.000323 0.199273 0.268976 0.233481 1251.78 1266.73 1.000
alpha{1,2} 0.424121 0.238510 0.000171 1.363898 0.255857 985.69 1041.09 1.002
alpha{3} 0.477440 0.263592 0.000179 1.556781 0.304903 1133.73 1221.11 1.001
pinvar{all} 0.997164 0.000012 0.991108 0.999999 0.998228 1209.27 1355.13 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ....**
9 -- .*.*..
10 -- ...**.
11 -- .***.*
12 -- .**...
13 -- .****.
14 -- ..**..
15 -- ...*.*
16 -- .*..*.
17 -- ..****
18 -- ..*.*.
19 -- .*...*
20 -- ..*..*
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.013191 0.144570 0.163225 2
8 451 0.150233 0.012719 0.141239 0.159227 2
9 449 0.149567 0.005182 0.145903 0.153231 2
10 446 0.148568 0.006595 0.143904 0.153231 2
11 446 0.148568 0.014133 0.138574 0.158561 2
12 441 0.146902 0.005182 0.143238 0.150566 2
13 437 0.145570 0.008951 0.139241 0.151899 2
14 434 0.144570 0.005653 0.140573 0.148568 2
15 434 0.144570 0.000942 0.143904 0.145237 2
16 425 0.141572 0.000471 0.141239 0.141905 2
17 422 0.140573 0.016959 0.128581 0.152565 2
18 408 0.135909 0.007537 0.130580 0.141239 2
19 402 0.133911 0.013191 0.124584 0.143238 2
20 388 0.129247 0.010364 0.121919 0.136576 2
21 384 0.127915 0.011306 0.119920 0.135909 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098818 0.009588 0.000009 0.296034 0.070343 1.000 2
length{all}[2] 0.101554 0.009959 0.000012 0.289900 0.073689 1.001 2
length{all}[3] 0.097816 0.009486 0.000038 0.295622 0.068505 1.000 2
length{all}[4] 0.097424 0.009052 0.000007 0.284728 0.067520 1.000 2
length{all}[5] 0.098386 0.009863 0.000110 0.293319 0.067570 1.000 2
length{all}[6] 0.098275 0.009122 0.000129 0.294525 0.070224 1.000 2
length{all}[7] 0.095763 0.008622 0.000174 0.283636 0.067200 0.998 2
length{all}[8] 0.097536 0.009106 0.001033 0.288670 0.066259 1.003 2
length{all}[9] 0.102301 0.010259 0.000039 0.301485 0.070512 0.999 2
length{all}[10] 0.097993 0.011132 0.000494 0.340170 0.061058 1.001 2
length{all}[11] 0.101684 0.010160 0.000366 0.303175 0.072425 1.000 2
length{all}[12] 0.109057 0.011848 0.000178 0.315800 0.072383 0.998 2
length{all}[13] 0.095447 0.010885 0.000018 0.302592 0.059629 1.003 2
length{all}[14] 0.093290 0.008872 0.000750 0.254409 0.069632 1.001 2
length{all}[15] 0.095889 0.009643 0.000066 0.278132 0.066610 1.001 2
length{all}[16] 0.103777 0.011026 0.000118 0.315386 0.068823 0.999 2
length{all}[17] 0.093482 0.008200 0.000222 0.254671 0.068506 0.998 2
length{all}[18] 0.105856 0.011952 0.000039 0.327140 0.074347 1.004 2
length{all}[19] 0.103012 0.011881 0.000177 0.308902 0.070002 0.998 2
length{all}[20] 0.098478 0.010280 0.000981 0.326888 0.065300 1.008 2
length{all}[21] 0.092656 0.008316 0.000532 0.290959 0.063530 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008825
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 552
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 184 / 184 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 184 / 184 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072135 0.093810 0.052638 0.078590 0.028190 0.088610 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -801.876617
Iterating by ming2
Initial: fx= 801.876617
x= 0.07213 0.09381 0.05264 0.07859 0.02819 0.08861 0.30000 1.30000
1 h-m-p 0.0000 0.0002 442.1683 ++ 771.498945 m 0.0002 13 | 1/8
2 h-m-p 0.0013 0.0097 48.7882 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 405.1240 ++ 749.288002 m 0.0001 44 | 2/8
4 h-m-p 0.0013 0.0175 37.4564 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 363.5744 ++ 734.976903 m 0.0001 75 | 3/8
6 h-m-p 0.0012 0.0399 28.9771 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 315.7802 ++ 731.402580 m 0.0000 106 | 4/8
8 h-m-p 0.0004 0.0625 21.8494 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 257.9398 ++ 727.692252 m 0.0001 137 | 5/8
10 h-m-p 0.0007 0.0928 14.7320 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 182.6407 ++ 726.726476 m 0.0000 168 | 6/8
12 h-m-p 0.0693 8.0000 0.0000 ++++ 726.726476 m 8.0000 181 | 6/8
13 h-m-p 1.4429 8.0000 0.0000 ++ 726.726476 m 8.0000 194 | 6/8
14 h-m-p 0.0066 3.2924 0.0911 -----Y 726.726476 0 0.0000 212 | 6/8
15 h-m-p 0.0160 8.0000 0.0002 +++++ 726.726476 m 8.0000 228 | 6/8
16 h-m-p 0.0041 0.7757 0.3888 ---------C 726.726476 0 0.0000 250 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 Y 726.726476 0 0.0040 263 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 ----Y 726.726476 0 0.0000 280
Out..
lnL = -726.726476
281 lfun, 281 eigenQcodon, 1686 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030258 0.023422 0.026771 0.056487 0.028451 0.094368 0.301690 0.586945 0.575129
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.540546
np = 9
lnL0 = -773.352836
Iterating by ming2
Initial: fx= 773.352836
x= 0.03026 0.02342 0.02677 0.05649 0.02845 0.09437 0.30169 0.58694 0.57513
1 h-m-p 0.0000 0.0001 435.6573 ++ 748.311746 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 167.6201 ++ 745.256401 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 869.7752 ++ 744.122915 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 4362.7884 ++ 743.180299 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 1322.9212 ++ 733.930787 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 226659.5390 ++ 726.726435 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 726.726435 m 8.0000 86 | 6/9
8 h-m-p 0.0148 7.4142 0.1095 ------------C 726.726435 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0004 +++++ 726.726435 m 8.0000 131 | 6/9
10 h-m-p 0.0080 1.7484 0.3768 -------------.. | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726434 m 8.0000 175 | 6/9
12 h-m-p 0.0062 3.1144 0.2990 ---------C 726.726434 0 0.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0008 +++++ 726.726434 m 8.0000 217 | 6/9
14 h-m-p 0.0204 2.1840 0.3296 -------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726434 m 8.0000 261 | 6/9
16 h-m-p 0.0062 3.1228 0.3018 --------C 726.726434 0 0.0000 284 | 6/9
17 h-m-p 0.0160 8.0000 0.0069 +++++ 726.726427 m 8.0000 302 | 6/9
18 h-m-p 0.1691 3.0316 0.3258 -----------C 726.726427 0 0.0000 328 | 6/9
19 h-m-p 0.0160 8.0000 0.0012 +++++ 726.726426 m 8.0000 346 | 6/9
20 h-m-p 0.0331 3.1524 0.2850 ----------Y 726.726426 0 0.0000 371 | 6/9
21 h-m-p 0.0160 8.0000 0.0002 +++++ 726.726426 m 8.0000 389 | 6/9
22 h-m-p 0.0062 3.0963 0.2959 ---------Y 726.726426 0 0.0000 413 | 6/9
23 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726425 m 8.0000 431 | 6/9
24 h-m-p 0.0048 2.4217 0.3307 ----------Y 726.726425 0 0.0000 456 | 6/9
25 h-m-p 0.0160 8.0000 0.0124 +++++ 726.726411 m 8.0000 474 | 6/9
26 h-m-p 0.2659 2.3376 0.3729 ---------------.. | 6/9
27 h-m-p 0.0160 8.0000 0.0002 +++++ 726.726411 m 8.0000 520 | 6/9
28 h-m-p 0.0086 4.3168 0.2460 -----------Y 726.726411 0 0.0000 546 | 6/9
29 h-m-p 0.0160 8.0000 0.0006 +++++ 726.726410 m 8.0000 564 | 6/9
30 h-m-p 0.0169 3.5458 0.2678 ----------C 726.726410 0 0.0000 589 | 6/9
31 h-m-p 0.0160 8.0000 0.0013 +++++ 726.726408 m 8.0000 607 | 6/9
32 h-m-p 0.0341 2.6688 0.3050 ----------N 726.726408 0 0.0000 632 | 6/9
33 h-m-p 0.0160 8.0000 0.0012 +++++ 726.726407 m 8.0000 650 | 6/9
34 h-m-p 0.0298 2.4141 0.3305 ----------Y 726.726407 0 0.0000 675 | 6/9
35 h-m-p 0.0160 8.0000 0.0001 ----------N 726.726407 0 0.0000 700 | 6/9
36 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
37 h-m-p 0.0160 8.0000 0.0002 +++++ 726.726406 m 8.0000 744 | 6/9
38 h-m-p 0.0089 4.4399 0.2393 -----------Y 726.726406 0 0.0000 770 | 6/9
39 h-m-p 0.0160 8.0000 0.0004 +++++ 726.726406 m 8.0000 788 | 6/9
40 h-m-p 0.0098 2.5573 0.3167 -------------.. | 6/9
41 h-m-p 0.0160 8.0000 0.0002 +++++ 726.726405 m 8.0000 832 | 6/9
42 h-m-p 0.0090 4.4836 0.2371 -----------Y 726.726405 0 0.0000 858 | 6/9
43 h-m-p 0.0012 0.5885 0.5663 +++++ 726.726187 m 0.5885 876 | 7/9
44 h-m-p 0.7419 3.7095 0.2925 -------------C 726.726187 0 0.0000 904 | 7/9
45 h-m-p 0.0160 8.0000 0.0004 +++++ 726.726184 m 8.0000 921 | 7/9
46 h-m-p 0.0182 8.0000 0.1549 -----------Y 726.726184 0 0.0000 946 | 7/9
47 h-m-p 0.0160 8.0000 0.0005 ---------C 726.726184 0 0.0000 969 | 7/9
48 h-m-p 0.0160 8.0000 0.0000 +++++ 726.726184 m 8.0000 986 | 7/9
49 h-m-p 0.0001 0.0749 1.7200 +++++ 726.726171 m 0.0749 1003 | 8/9
50 h-m-p 0.0202 0.1010 1.9193 ++ 726.726083 m 0.1010 1015 | 9/9
51 h-m-p 0.0160 8.0000 0.0000 Y 726.726083 0 0.0160 1027 | 9/9
52 h-m-p 0.0160 8.0000 0.0000 Y 726.726083 0 0.0160 1039
Out..
lnL = -726.726083
1040 lfun, 3120 eigenQcodon, 12480 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043883 0.096230 0.040827 0.021068 0.062570 0.073377 0.000100 0.930391 0.576872 0.140973 1.524755
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.674425
np = 11
lnL0 = -782.828504
Iterating by ming2
Initial: fx= 782.828504
x= 0.04388 0.09623 0.04083 0.02107 0.06257 0.07338 0.00011 0.93039 0.57687 0.14097 1.52475
1 h-m-p 0.0000 0.0000 373.6376 ++ 782.523116 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 188.6457 ++++ 761.589060 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0001 200.7859 ++ 754.404677 m 0.0001 46 | 3/11
4 h-m-p 0.0007 0.0118 31.0336 +++ 746.005663 m 0.0118 61 | 4/11
5 h-m-p 0.0001 0.0003 812.1587 ++ 738.466991 m 0.0003 75 | 5/11
6 h-m-p 0.0000 0.0001 2392.1959 ++ 732.925408 m 0.0001 89 | 6/11
7 h-m-p 0.0002 0.0010 113.1801 ++ 730.543001 m 0.0010 103 | 7/11
8 h-m-p 0.0001 0.0005 926.4069 ++ 726.726392 m 0.0005 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0003 ++ 726.726392 m 8.0000 131 | 8/11
10 h-m-p 0.0071 3.5536 0.8475 ------------Y 726.726392 0 0.0000 160 | 8/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726392 m 8.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 3.3396 -------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726392 m 8.0000 225 | 8/11
14 h-m-p 0.0160 8.0000 0.1357 ----------C 726.726392 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0013 +++++ 726.726391 m 8.0000 272 | 8/11
16 h-m-p 0.0160 8.0000 1.8730 -----------C 726.726391 0 0.0000 300 | 8/11
17 h-m-p 0.0160 8.0000 0.0228 +++++ 726.726376 m 8.0000 317 | 8/11
18 h-m-p 0.0874 8.0000 2.0923 --------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726376 m 8.0000 363 | 8/11
20 h-m-p 0.0006 0.2828 6.3240 +++++ 726.726186 m 0.2828 383 | 9/11
21 h-m-p 0.0026 0.1746 619.8879 ------------.. | 9/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726186 m 8.0000 424 | 9/11
23 h-m-p 0.0160 8.0000 0.3062 -----------Y 726.726186 0 0.0000 451 | 9/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726186 m 8.0000 470 | 9/11
25 h-m-p 0.0160 8.0000 2.3831 +++++ 726.726083 m 8.0000 489 | 9/11
26 h-m-p 1.6000 8.0000 0.0000 N 726.726083 0 1.6000 503 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 C 726.726083 0 0.0160 519
Out..
lnL = -726.726083
520 lfun, 2080 eigenQcodon, 9360 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -726.778765 S = -726.727150 -0.019950
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:06
did 20 / 54 patterns 0:06
did 30 / 54 patterns 0:07
did 40 / 54 patterns 0:07
did 50 / 54 patterns 0:07
did 54 / 54 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046910 0.020470 0.040358 0.039946 0.041916 0.100109 0.000100 0.894266 1.253775
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.787254
np = 9
lnL0 = -776.440685
Iterating by ming2
Initial: fx= 776.440685
x= 0.04691 0.02047 0.04036 0.03995 0.04192 0.10011 0.00011 0.89427 1.25378
1 h-m-p 0.0000 0.0000 404.2199 ++ 776.066861 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0111 54.8321 +++++ 749.812708 m 0.0111 29 | 2/9
3 h-m-p 0.0001 0.0005 74.1135 ++ 742.926525 m 0.0005 41 | 3/9
4 h-m-p 0.0004 0.0019 50.8898 ++ 732.599423 m 0.0019 53 | 4/9
5 h-m-p 0.0000 0.0001 443.7868 ++ 728.890893 m 0.0001 65 | 5/9
6 h-m-p 0.0000 0.0000 48539.4034 ++ 728.463978 m 0.0000 77 | 6/9
7 h-m-p 0.0000 0.0001 236.4254 ++ 726.726270 m 0.0001 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ---------C 726.726270 0 0.0000 110
Out..
lnL = -726.726270
111 lfun, 1221 eigenQcodon, 6660 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010161 0.043805 0.084355 0.063025 0.080545 0.094845 0.000100 0.900000 0.514918 1.061325 1.299855
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.587797
np = 11
lnL0 = -787.910690
Iterating by ming2
Initial: fx= 787.910690
x= 0.01016 0.04380 0.08436 0.06302 0.08055 0.09484 0.00011 0.90000 0.51492 1.06132 1.29985
1 h-m-p 0.0000 0.0000 363.3026 ++ 787.745474 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0008 122.7717 ++++ 777.286997 m 0.0008 32 | 2/11
3 h-m-p 0.0001 0.0007 221.0143 ++ 751.376360 m 0.0007 46 | 3/11
4 h-m-p 0.0000 0.0002 758.4057 ++ 737.945833 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0000 39366.6503 ++ 729.397809 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 99515.2478 ++ 728.239060 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 308.8696 ++ 727.603237 m 0.0000 102 | 7/11
8 h-m-p 0.0030 0.1081 1.6395 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 170.5946 ++ 726.726242 m 0.0000 140 | 8/11
10 h-m-p 0.4851 8.0000 0.0000 +++ 726.726242 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0300 +++++ 726.726235 m 8.0000 175 | 8/11
12 h-m-p 0.4506 4.4895 0.5322 -------------Y 726.726235 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726235 m 8.0000 225 | 8/11
14 h-m-p 0.0087 4.3666 0.5602 ----------Y 726.726235 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 726.726235 m 8.0000 272 | 8/11
16 h-m-p 0.0094 4.7219 0.5782 ------------Y 726.726235 0 0.0000 301 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 --Y 726.726235 0 0.0003 320 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 726.726235 m 8.0000 340 | 8/11
19 h-m-p 0.0130 6.5107 0.3012 --------Y 726.726235 0 0.0000 365 | 8/11
20 h-m-p 0.0160 8.0000 0.0006 +++++ 726.726235 m 8.0000 385 | 8/11
21 h-m-p 0.0163 7.1671 0.2774 ---------Y 726.726235 0 0.0000 411 | 8/11
22 h-m-p 0.0160 8.0000 0.0003 +++++ 726.726235 m 8.0000 431 | 8/11
23 h-m-p 0.0141 7.0278 0.2758 ---------Y 726.726235 0 0.0000 457 | 8/11
24 h-m-p 0.0160 8.0000 0.0001 -----C 726.726235 0 0.0000 479 | 8/11
25 h-m-p 0.0160 8.0000 0.0002 -----------C 726.726235 0 0.0000 507
Out..
lnL = -726.726235
508 lfun, 6096 eigenQcodon, 33528 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -726.770471 S = -726.725464 -0.019923
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:17
did 20 / 54 patterns 0:17
did 30 / 54 patterns 0:17
did 40 / 54 patterns 0:17
did 50 / 54 patterns 0:17
did 54 / 54 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
NC_011896_1_WP_010908902_1_2611_MLBR_RS12425 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
NC_002677_1_NP_302583_1_1455_ML2442 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK
**************************************************
NC_011896_1_WP_010908902_1_2611_MLBR_RS12425 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
NC_002677_1_NP_302583_1_1455_ML2442 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765 TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV
**************************************************
NC_011896_1_WP_010908902_1_2611_MLBR_RS12425 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
NC_002677_1_NP_302583_1_1455_ML2442 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765 GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW
**************************************************
NC_011896_1_WP_010908902_1_2611_MLBR_RS12425 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
NC_002677_1_NP_302583_1_1455_ML2442 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765 DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
**********************************
>NC_011896_1_WP_010908902_1_2611_MLBR_RS12425 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC CG >NC_002677_1_NP_302583_1_1455_ML2442 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC CG >NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC CG >NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC CG >NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC CG >NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765 ATGAGCACAGCCTGGGATACGGTGTGGCACGCGTGTTCGGTGATTGAGCA CGCGCTGCAAGCCAGCCACCTCACCTACTCGGAATTTTCTGGGGTGCCCG ATGGATTGTTGCGATTGGTAGTGGAACTGCCTGGTGAGCGTAGGCTCAAG ACCAACGCCATCCTGAGTATCGGCGAGCATTCAGTGCATGTTGAGGCGTT CGTATGCCGCAAACCTGACGAGAACCACGAGGGTGTCTACCGGTTTTTGC TCAAGCGCAACCGTCGGCTCTTTTGCGTTTCCTACACGCTGGACAACGTG GGCGATATCTATCTGGTGGGCCGGATGTCCTTGGCGTCGGTCGACACCGA CGAGATCGATCGAGTGCTCGGACAGGTACTCGAGGCGGTGGAATCGGACT TTAATACGTTGTTGGAATTGGGTTTTCGTTCGTCGATCCAAAAGGAGTGG GACTGGCGAATCTCTCGCGGCGAGTCGCTGAACAATCTGCAGGCCTTCGC GCACCTAATCGACGACGAAGGTGACGGCGACGCTTCCATCTACGCTCGTC CG
>NC_011896_1_WP_010908902_1_2611_MLBR_RS12425 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP >NC_002677_1_NP_302583_1_1455_ML2442 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP >NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP >NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP >NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP >NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765 MSTAWDTVWHACSVIEHALQASHLTYSEFSGVPDGLLRLVVELPGERRLK TNAILSIGEHSVHVEAFVCRKPDENHEGVYRFLLKRNRRLFCVSYTLDNV GDIYLVGRMSLASVDTDEIDRVLGQVLEAVESDFNTLLELGFRSSIQKEW DWRISRGESLNNLQAFAHLIDDEGDGDASIYARP
#NEXUS
[ID: 5309682979]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908902_1_2611_MLBR_RS12425
NC_002677_1_NP_302583_1_1455_ML2442
NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200
NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625
NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435
NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908902_1_2611_MLBR_RS12425,
2 NC_002677_1_NP_302583_1_1455_ML2442,
3 NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200,
4 NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625,
5 NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435,
6 NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07034326,2:0.07368935,3:0.06850522,4:0.06751955,5:0.06756957,6:0.07022429);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07034326,2:0.07368935,3:0.06850522,4:0.06751955,5:0.06756957,6:0.07022429);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -759.19 -762.50
2 -759.18 -762.90
--------------------------------------
TOTAL -759.18 -762.72
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2442/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888916 0.088597 0.383660 1.482354 0.849143 1501.00 1501.00 1.000
r(A<->C){all} 0.160812 0.019352 0.000006 0.439526 0.120430 187.07 251.88 1.008
r(A<->G){all} 0.167835 0.019242 0.000123 0.434547 0.132935 201.92 257.20 1.002
r(A<->T){all} 0.169274 0.021026 0.000063 0.462778 0.128825 163.91 234.00 1.000
r(C<->G){all} 0.169281 0.020259 0.000004 0.454211 0.135458 218.26 233.51 1.000
r(C<->T){all} 0.165300 0.019922 0.000045 0.448931 0.125992 140.14 207.74 1.000
r(G<->T){all} 0.167498 0.020732 0.000038 0.469782 0.128217 263.95 275.80 1.001
pi(A){all} 0.195938 0.000271 0.163018 0.226805 0.195527 1028.40 1235.98 1.000
pi(C){all} 0.258675 0.000345 0.223653 0.296563 0.258300 1240.81 1370.91 1.000
pi(G){all} 0.311445 0.000372 0.275239 0.349333 0.310926 1125.33 1246.56 1.000
pi(T){all} 0.233942 0.000323 0.199273 0.268976 0.233481 1251.78 1266.73 1.000
alpha{1,2} 0.424121 0.238510 0.000171 1.363898 0.255857 985.69 1041.09 1.002
alpha{3} 0.477440 0.263592 0.000179 1.556781 0.304903 1133.73 1221.11 1.001
pinvar{all} 0.997164 0.000012 0.991108 0.999999 0.998228 1209.27 1355.13 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2442/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 184
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 5 5 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 6 6 6 6 6 6 | CCC 1 1 1 1 1 1 | CAC 5 5 5 5 5 5 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 7 7 7 7 7 7 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 8 8 8 8 8 8 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 4 4 4 4 4 4
GTC 2 2 2 2 2 2 | GCC 4 4 4 4 4 4 | GAC 10 10 10 10 10 10 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 3 | GCA 0 0 0 0 0 0 | Glu GAA 5 5 5 5 5 5 | GGA 2 2 2 2 2 2
GTG 9 9 9 9 9 9 | GCG 6 6 6 6 6 6 | GAG 10 10 10 10 10 10 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908902_1_2611_MLBR_RS12425
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
#2: NC_002677_1_NP_302583_1_1455_ML2442
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
#3: NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
#4: NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
#5: NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
#6: NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 30 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 6
TTC 12 | TCC 18 | TAC 24 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 42 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 24
CTC 36 | CCC 6 | CAC 30 | CGC 18
CTA 6 | CCA 0 | Gln Q CAA 12 | CGA 18
CTG 42 | CCG 6 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 12 | Ser S AGT 6
ATC 48 | ACC 18 | AAC 30 | AGC 12
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 24
GTC 12 | GCC 24 | GAC 60 | GGC 30
GTA 18 | GCA 0 | Glu E GAA 30 | GGA 12
GTG 54 | GCG 36 | GAG 60 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21739 C:0.22826 A:0.17935 G:0.37500
position 2: T:0.30435 C:0.19565 A:0.30435 G:0.19565
position 3: T:0.17935 C:0.35326 A:0.10326 G:0.36413
Average T:0.23370 C:0.25906 A:0.19565 G:0.31159
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -726.726476 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.301690 1.299855
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908902_1_2611_MLBR_RS12425: 0.000004, NC_002677_1_NP_302583_1_1455_ML2442: 0.000004, NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200: 0.000004, NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625: 0.000004, NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435: 0.000004, NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30169
omega (dN/dS) = 1.29985
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.9 104.1 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 447.9 104.1 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 447.9 104.1 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 447.9 104.1 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 447.9 104.1 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 447.9 104.1 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -726.726083 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908902_1_2611_MLBR_RS12425: 0.000004, NC_002677_1_NP_302583_1_1455_ML2442: 0.000004, NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200: 0.000004, NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625: 0.000004, NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435: 0.000004, NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -726.726083 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908902_1_2611_MLBR_RS12425: 0.000004, NC_002677_1_NP_302583_1_1455_ML2442: 0.000004, NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200: 0.000004, NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625: 0.000004, NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435: 0.000004, NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 456.7 95.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908902_1_2611_MLBR_RS12425)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -726.726270 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.234548 1.358557
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908902_1_2611_MLBR_RS12425: 0.000004, NC_002677_1_NP_302583_1_1455_ML2442: 0.000004, NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200: 0.000004, NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625: 0.000004, NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435: 0.000004, NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.23455 q = 1.35856
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00020 0.00179 0.00753 0.02208 0.05242 0.10868 0.20621 0.37154 0.66996
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 456.7 95.3 0.1440 0.0000 0.0000 0.0 0.0
7..2 0.000 456.7 95.3 0.1440 0.0000 0.0000 0.0 0.0
7..3 0.000 456.7 95.3 0.1440 0.0000 0.0000 0.0 0.0
7..4 0.000 456.7 95.3 0.1440 0.0000 0.0000 0.0 0.0
7..5 0.000 456.7 95.3 0.1440 0.0000 0.0000 0.0 0.0
7..6 0.000 456.7 95.3 0.1440 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -726.726235 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.916535 0.005000 1.195130 1.248112
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908902_1_2611_MLBR_RS12425: 0.000004, NC_002677_1_NP_302583_1_1455_ML2442: 0.000004, NZ_LVXE01000039_1_WP_010908902_1_1678_A3216_RS10200: 0.000004, NZ_LYPH01000045_1_WP_010908902_1_1808_A8144_RS08625: 0.000004, NZ_CP029543_1_WP_010908902_1_2638_DIJ64_RS13435: 0.000004, NZ_AP014567_1_WP_010908902_1_2704_JK2ML_RS13765: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.91654 p = 0.00500 q = 1.19513
(p1 = 0.08346) w = 1.24811
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09165 0.09165 0.09165 0.09165 0.09165 0.09165 0.09165 0.09165 0.09165 0.09165 0.08346
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.24811
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 456.7 95.3 0.1042 0.0000 0.0000 0.0 0.0
7..2 0.000 456.7 95.3 0.1042 0.0000 0.0000 0.0 0.0
7..3 0.000 456.7 95.3 0.1042 0.0000 0.0000 0.0 0.0
7..4 0.000 456.7 95.3 0.1042 0.0000 0.0000 0.0 0.0
7..5 0.000 456.7 95.3 0.1042 0.0000 0.0000 0.0 0.0
7..6 0.000 456.7 95.3 0.1042 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908902_1_2611_MLBR_RS12425)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908902_1_2611_MLBR_RS12425)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:17
Model 1: NearlyNeutral -726.726083 Model 2: PositiveSelection -726.726083 Model 0: one-ratio -726.726476 Model 7: beta -726.72627 Model 8: beta&w>1 -726.726235 Model 0 vs 1 7.860000000619038E-4 Model 2 vs 1 0.0 Model 8 vs 7 7.000000005064066E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
