--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 14:23:52 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/336/Orct2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -5031.76         -5043.91
2      -5031.73         -5042.87
--------------------------------------
TOTAL    -5031.75         -5043.52
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.854179    0.005363    0.707492    0.997001    0.850027   1177.60   1214.06    1.000
r(A<->C){all}   0.115166    0.000453    0.073114    0.154506    0.114227    906.92    913.02    1.000
r(A<->G){all}   0.231387    0.000803    0.174857    0.284527    0.230315    960.14   1057.93    1.000
r(A<->T){all}   0.106394    0.000574    0.059286    0.151936    0.105046    892.59    982.32    1.002
r(C<->G){all}   0.116292    0.000263    0.087013    0.150819    0.115373    877.41    892.96    1.000
r(C<->T){all}   0.394818    0.001314    0.324683    0.464363    0.394096    937.11    952.40    1.000
r(G<->T){all}   0.035943    0.000188    0.007850    0.062059    0.034931    837.13   1029.81    1.003
pi(A){all}      0.199580    0.000078    0.181364    0.216218    0.199556   1243.30   1279.59    1.000
pi(C){all}      0.295115    0.000098    0.276247    0.315540    0.295247   1023.70   1167.61    1.000
pi(G){all}      0.287861    0.000101    0.267667    0.306458    0.287778   1086.97   1120.92    1.000
pi(T){all}      0.217444    0.000086    0.198553    0.234694    0.217423   1182.76   1208.53    1.000
alpha{1,2}      0.126811    0.000381    0.091116    0.166320    0.126817   1018.81   1115.83    1.000
alpha{3}        3.528741    0.946638    1.855169    5.498023    3.405951   1310.31   1405.65    1.000
pinvar{all}     0.281297    0.002685    0.170904    0.373414    0.285090   1047.90   1134.72    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4685.131724
Model 2: PositiveSelection	-4685.131724
Model 0: one-ratio	-4747.45533
Model 3: discrete	-4680.97397
Model 7: beta	-4682.007894
Model 8: beta&w>1	-4681.123106


Model 0 vs 1	124.64721199999985

Model 2 vs 1	0.0

Model 8 vs 7	1.7695760000005976
>C1
MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETK
TCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQ
LSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFL
VAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIAL
TLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEAL
SELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFLD
WLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRR
SILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFS
AEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTL
VAGLLSLLLPETHNKPMLETIADGERFGKKTKADVYLETGQELRAPEAQP
LKGSGETNGSTIANGHK
>C2
MGYDEAIVHLGDFGRYQKIIYSLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENGSTYELSPHLWNLSYPLDERCSYYDVEYSEAYLNGSIPRSSNNTK
SCTSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQ
LSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARVMVGATTSGVFL
VAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFIHDWRWLQIAL
TLPGLIFMFYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEAL
SELLDEGEDSEERAKQKLEDLEQVEGPPPSVWDLFCYPNLRRKTLLIFLD
WLVTSGVYYGLSWNTNDLGGNVLLNFIISGAVEIPGYIFLLLTLNRWGRR
SILCGSLVMAGLSLLATVIVPEEMHTLIIACAMLGKLAITASYGTVYIFS
AEQFPTVVRNVALGAASMVARISGMMAPFLKMLATIWKPLPLLICGSLSL
AAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRVPEAQP
LKGSGEANGSAIANGHK
>C3
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENGSSYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDTK
SCSRYVYDQSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQ
LSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFL
VAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFFHDWRWLQIAL
TLPGLIFMFYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEISDEAL
GELLDEGENSEEKAKQKLEDPEQDAGPPPSVWDLFCYPNLRRKTLLIFLD
WLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGRR
SILCGCLVMAGLSLLATVVVPDSMHTLMIACAMLGKLAITASYGTVYIFS
AEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLSL
AAGLLSLLLPETHNQPMLETIADGERFGKKTKGDVYLETGQELRAPEAQP
LKGTGEANGSSIANGHK
>C4
MGYDEAISHVGDFGRYQKIIYFLICLTSIPVAFHKFAGVFLLAKPDFRCE
LPYENGSATYELPTHLWNLSFPRGERCAYYDVEYSEEYLNGSIARSSNET
KACSRYVYDQSKYLNSAVTEWNLVCGRDFLAATSDSIFMLGVLLGSIVFG
QLSDRYGRKPILFASLVIQVLFGVMAGVAPEYITYTFSRLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAGFAYFVHDWRWLQIA
LTLPGIIFLCYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSDLLDEGESTEEKAKQKLEDREDEGPPPSVWDLFCYPNLRRKTLLIFLD
WLVTSGVYYGLSWNTNNLGDNVLLNFLISGAVEIPAYVFLLLTLNRWGRR
SILCGCLVLAGVSLLATGIIPEKMNTLIVTCAMLGKLAITASYGTVYIFS
AEQFPTVVRNVALGAASMVARISGMMAPYLSFLATIWRPLPLLICGSLSL
LAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRQTPETQ
PLRGATEANGLKTNGHK
>C5
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCV
LPFENGSSYDLEPHLWNLSYSGKDGCSYYDVEYSEAYLEGNITRKSNDTK
SCSSYVYDQSKYLNSAVTEWNLVCGREFLAATSDSLFMFGVLLGSIVFGQ
LSDKYGRKPILFASLVIQVIFGVLAGVAPEYFTYTFARLMVGATTSGVFL
VAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIAL
TLPGLIFMCYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEVTNEAL
SELLDEGETSEEKAKQKLEDEDKDEGPPPSVWDLFCYPNLRRKTLLIFLD
WLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGRR
SILCGCLVMAGLSLLATVVIPSRMHSLIVACAMLGKLAITASYGTVYIFS
AEQFPTVVRNVALGAASMVARISGMMAPFLTFLATIWQPLPLLICGSLAL
AAGLLSLLLPKTHNKPMLETIADGERFGKKTKGDVYLETGQEMRQTPETQ
PLNGSADSNGLKSNGQK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=569 

C1              MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
C2              MGYDEAIVHLGDFGRYQKIIYSLICLTSIPVAFHKLAGVFLLAKPDFRCA
C3              MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
C4              MGYDEAISHVGDFGRYQKIIYFLICLTSIPVAFHKFAGVFLLAKPDFRCE
C5              MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCV
                ******* *:*********** *************:************* 

C1              LPFENG-SSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNET
C2              LPFENG-STYELSPHLWNLSYPLDERCSYYDVEYSEAYLNGSIPRSSNNT
C3              LPFENG-SSYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDT
C4              LPYENGSATYELPTHLWNLSFPRGERCAYYDVEYSEEYLNGSIARSSNET
C5              LPFENG-SSYDLEPHLWNLSYSGKDGCSYYDVEYSEAYLEGNITRKSNDT
                **:*** ::*:* .******:.  : *:****:*:  **:*.*.*.**:*

C1              KTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
C2              KSCTSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
C3              KSCSRYVYDQSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
C4              KACSRYVYDQSKYLNSAVTEWNLVCGRDFLAATSDSIFMLGVLLGSIVFG
C5              KSCSSYVYDQSKYLNSAVTEWNLVCGREFLAATSDSLFMFGVLLGSIVFG
                *:*: ****:*****************:*:******:**:**********

C1              QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
C2              QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARVMVGATTSGVF
C3              QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
C4              QLSDRYGRKPILFASLVIQVLFGVMAGVAPEYITYTFSRLMVGATTSGVF
C5              QLSDKYGRKPILFASLVIQVIFGVLAGVAPEYFTYTFARLMVGATTSGVF
                ****:***************:***:*******:****:*:**********

C1              LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
C2              LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFIHDWRWLQIA
C3              LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFFHDWRWLQIA
C4              LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAGFAYFVHDWRWLQIA
C5              LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
                *********************************** ****.*********

C1              LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEA
C2              LTLPGLIFMFYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
C3              LTLPGLIFMFYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEISDEA
C4              LTLPGIIFLCYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
C5              LTLPGLIFMCYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEVTNEA
                *****:**: ************* ****:****************:::**

C1              LSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFL
C2              LSELLDEGEDSEERAKQKLEDLEQVEGPPPSVWDLFCYPNLRRKTLLIFL
C3              LGELLDEGENSEEKAKQKLEDPEQDAGPPPSVWDLFCYPNLRRKTLLIFL
C4              LSDLLDEGESTEEKAKQKLEDRE-DEGPPPSVWDLFCYPNLRRKTLLIFL
C5              LSELLDEGETSEEKAKQKLEDEDKDEGPPPSVWDLFCYPNLRRKTLLIFL
                *.:****** :**:******* :   ************************

C1              DWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGR
C2              DWLVTSGVYYGLSWNTNDLGGNVLLNFIISGAVEIPGYIFLLLTLNRWGR
C3              DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
C4              DWLVTSGVYYGLSWNTNNLGDNVLLNFLISGAVEIPAYVFLLLTLNRWGR
C5              DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
                ****************.:**.******:********.*:***********

C1              RSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIF
C2              RSILCGSLVMAGLSLLATVIVPEEMHTLIIACAMLGKLAITASYGTVYIF
C3              RSILCGCLVMAGLSLLATVVVPDSMHTLMIACAMLGKLAITASYGTVYIF
C4              RSILCGCLVLAGVSLLATGIIPEKMNTLIVTCAMLGKLAITASYGTVYIF
C5              RSILCGCLVMAGLSLLATVVIPSRMHSLIVACAMLGKLAITASYGTVYIF
                ******.**:**:***** ::*. *::*:::*******************

C1              SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLT
C2              SAEQFPTVVRNVALGAASMVARISGMMAPFLKMLATIWKPLPLLICGSLS
C3              SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLS
C4              SAEQFPTVVRNVALGAASMVARISGMMAPYLSFLATIWRPLPLLICGSLS
C5              SAEQFPTVVRNVALGAASMVARISGMMAPFLTFLATIWQPLPLLICGSLA
                *****************************:*.:*****:**********:

C1              LVAGLLSLLLPETHNKPMLETIADGERFGKKTKADVYLETGQELR-APEA
C2              LAAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELR-VPEA
C3              LAAGLLSLLLPETHNQPMLETIADGERFGKKTKGDVYLETGQELR-APEA
C4              LLAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRQTPET
C5              LAAGLLSLLLPKTHNKPMLETIADGERFGKKTKGDVYLETGQEMRQTPET
                * *********:***:*****************.*********:* .**:

C1              QPLKGSGETNGSTIANGHK
C2              QPLKGSGEANGSAIANGHK
C3              QPLKGTGEANGSSIANGHK
C4              QPLRGATEANG-LKTNGHK
C5              QPLNGSADSNG-LKSNGQK
                ***.*: ::**   :**:*




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 ugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  567 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  567 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11526]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11526]--->[11490]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/336/Orct2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.343 Mb, Max= 30.833 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENG-SSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNET
KTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEA
LSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGR
RSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLT
LVAGLLSLLLPETHNKPMLETIADGERFGKKTKADVYLETGQELR-APEA
QPLKGSGETNGSTIANGHK
>C2
MGYDEAIVHLGDFGRYQKIIYSLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENG-STYELSPHLWNLSYPLDERCSYYDVEYSEAYLNGSIPRSSNNT
KSCTSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARVMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFIHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSELLDEGEDSEERAKQKLEDLEQVEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNDLGGNVLLNFIISGAVEIPGYIFLLLTLNRWGR
RSILCGSLVMAGLSLLATVIVPEEMHTLIIACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLKMLATIWKPLPLLICGSLS
LAAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELR-VPEA
QPLKGSGEANGSAIANGHK
>C3
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENG-SSYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDT
KSCSRYVYDQSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFFHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEISDEA
LGELLDEGENSEEKAKQKLEDPEQDAGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVMAGLSLLATVVVPDSMHTLMIACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLS
LAAGLLSLLLPETHNQPMLETIADGERFGKKTKGDVYLETGQELR-APEA
QPLKGTGEANGSSIANGHK
>C4
MGYDEAISHVGDFGRYQKIIYFLICLTSIPVAFHKFAGVFLLAKPDFRCE
LPYENGSATYELPTHLWNLSFPRGERCAYYDVEYSEEYLNGSIARSSNET
KACSRYVYDQSKYLNSAVTEWNLVCGRDFLAATSDSIFMLGVLLGSIVFG
QLSDRYGRKPILFASLVIQVLFGVMAGVAPEYITYTFSRLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAGFAYFVHDWRWLQIA
LTLPGIIFLCYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSDLLDEGESTEEKAKQKLEDRE-DEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGDNVLLNFLISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVLAGVSLLATGIIPEKMNTLIVTCAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPYLSFLATIWRPLPLLICGSLS
LLAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRQTPET
QPLRGATEANG-LKTNGHK
>C5
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCV
LPFENG-SSYDLEPHLWNLSYSGKDGCSYYDVEYSEAYLEGNITRKSNDT
KSCSSYVYDQSKYLNSAVTEWNLVCGREFLAATSDSLFMFGVLLGSIVFG
QLSDKYGRKPILFASLVIQVIFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
LTLPGLIFMCYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEVTNEA
LSELLDEGETSEEKAKQKLEDEDKDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVMAGLSLLATVVIPSRMHSLIVACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLTFLATIWQPLPLLICGSLA
LAAGLLSLLLPKTHNKPMLETIADGERFGKKTKGDVYLETGQEMRQTPET
QPLNGSADSNG-LKSNGQK

FORMAT of file /tmp/tmp2117902449590104127aln Not Supported[FATAL:T-COFFEE]
>C1
MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENG-SSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNET
KTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEA
LSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGR
RSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLT
LVAGLLSLLLPETHNKPMLETIADGERFGKKTKADVYLETGQELR-APEA
QPLKGSGETNGSTIANGHK
>C2
MGYDEAIVHLGDFGRYQKIIYSLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENG-STYELSPHLWNLSYPLDERCSYYDVEYSEAYLNGSIPRSSNNT
KSCTSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARVMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFIHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSELLDEGEDSEERAKQKLEDLEQVEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNDLGGNVLLNFIISGAVEIPGYIFLLLTLNRWGR
RSILCGSLVMAGLSLLATVIVPEEMHTLIIACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLKMLATIWKPLPLLICGSLS
LAAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELR-VPEA
QPLKGSGEANGSAIANGHK
>C3
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENG-SSYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDT
KSCSRYVYDQSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFFHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEISDEA
LGELLDEGENSEEKAKQKLEDPEQDAGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVMAGLSLLATVVVPDSMHTLMIACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLS
LAAGLLSLLLPETHNQPMLETIADGERFGKKTKGDVYLETGQELR-APEA
QPLKGTGEANGSSIANGHK
>C4
MGYDEAISHVGDFGRYQKIIYFLICLTSIPVAFHKFAGVFLLAKPDFRCE
LPYENGSATYELPTHLWNLSFPRGERCAYYDVEYSEEYLNGSIARSSNET
KACSRYVYDQSKYLNSAVTEWNLVCGRDFLAATSDSIFMLGVLLGSIVFG
QLSDRYGRKPILFASLVIQVLFGVMAGVAPEYITYTFSRLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAGFAYFVHDWRWLQIA
LTLPGIIFLCYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSDLLDEGESTEEKAKQKLEDRE-DEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGDNVLLNFLISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVLAGVSLLATGIIPEKMNTLIVTCAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPYLSFLATIWRPLPLLICGSLS
LLAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRQTPET
QPLRGATEANG-LKTNGHK
>C5
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCV
LPFENG-SSYDLEPHLWNLSYSGKDGCSYYDVEYSEAYLEGNITRKSNDT
KSCSSYVYDQSKYLNSAVTEWNLVCGREFLAATSDSLFMFGVLLGSIVFG
QLSDKYGRKPILFASLVIQVIFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
LTLPGLIFMCYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEVTNEA
LSELLDEGETSEEKAKQKLEDEDKDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVMAGLSLLATVVIPSRMHSLIVACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLTFLATIWQPLPLLICGSLA
LAAGLLSLLLPKTHNKPMLETIADGERFGKKTKGDVYLETGQEMRQTPET
QPLNGSADSNG-LKSNGQK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:569 S:99 BS:569
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 93.12 C1	 C2	 93.12
TOP	    1    0	 93.12 C2	 C1	 93.12
BOT	    0    2	 94.36 C1	 C3	 94.36
TOP	    2    0	 94.36 C3	 C1	 94.36
BOT	    0    3	 89.56 C1	 C4	 89.56
TOP	    3    0	 89.56 C4	 C1	 89.56
BOT	    0    4	 90.28 C1	 C5	 90.28
TOP	    4    0	 90.28 C5	 C1	 90.28
BOT	    1    2	 93.65 C2	 C3	 93.65
TOP	    2    1	 93.65 C3	 C2	 93.65
BOT	    1    3	 88.50 C2	 C4	 88.50
TOP	    3    1	 88.50 C4	 C2	 88.50
BOT	    1    4	 89.22 C2	 C5	 89.22
TOP	    4    1	 89.22 C5	 C2	 89.22
BOT	    2    3	 88.85 C3	 C4	 88.85
TOP	    3    2	 88.85 C4	 C3	 88.85
BOT	    2    4	 90.28 C3	 C5	 90.28
TOP	    4    2	 90.28 C5	 C3	 90.28
BOT	    3    4	 87.63 C4	 C5	 87.63
TOP	    4    3	 87.63 C5	 C4	 87.63
AVG	 0	 C1	  *	 91.83
AVG	 1	 C2	  *	 91.12
AVG	 2	 C3	  *	 91.78
AVG	 3	 C4	  *	 88.63
AVG	 4	 C5	  *	 89.36
TOT	 TOT	  *	 90.55
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGCTACGATGAGGCCATCATCCATCTGGGTGATTTTGGACGCTATCA
C2              ATGGGCTATGACGAGGCCATCGTCCATCTGGGCGACTTTGGACGCTACCA
C3              ATGGGCTATGACGAGGCCATCGTCCACTTGGGGGACTTTGGACGCTACCA
C4              ATGGGCTACGATGAGGCCATCAGCCATGTGGGCGACTTCGGACGCTACCA
C5              ATGGGCTACGATGAGGCGATTGTCCATCTGGGAGACTTTGGTCGCTACCA
                ******** ** ***** ** . ***  **** ** ** **:***** **

C1              GAAGATCATCTACTTTCTCATCTGCCTAACATCCATACCAGTTGCCTTCC
C2              GAAGATCATCTACTCCCTCATCTGCCTCACCTCCATTCCAGTGGCCTTCC
C3              GAAGATCATCTACTTCCTCATCTGCCTCACATCCATTCCAGTGGCCTTTC
C4              GAAGATCATCTACTTCCTCATCTGCCTGACCTCCATTCCAGTGGCCTTTC
C5              GAAGATCATCTACTTCCTCATCTGTTTGACTTCCATTCCGGTGGCTTTTC
                **************  ********  * ** *****:**.** ** ** *

C1              ACAAGCTGGCCGGGGTGTTCCTGCTGGCCAAACCGGACTTCCGGTGCGCC
C2              ACAAGTTGGCCGGGGTGTTCCTGCTGGCCAAACCCGACTTCCGATGTGCG
C3              ACAAGCTGGCCGGGGTGTTCCTGCTGGCCAAGCCGGACTTCCGGTGCGCC
C4              ACAAGTTCGCGGGGGTCTTCCTGCTGGCCAAGCCCGACTTTCGCTGCGAG
C5              ACAAGTTGGCAGGGGTTTTCCTTCTGGCCAAACCGGATTTTCGCTGTGTC
                ***** * ** ***** ***** ********.** ** ** ** ** *  

C1              CTGCCCTTCGAGAATGGA---AGTAGCTACGACTTGCCCACCCACCTGTG
C2              CTGCCCTTCGAGAATGGC---AGCACCTACGAGCTATCGCCCCACCTGTG
C3              CTGCCCTTCGAGAATGGC---AGTAGCTACGAGTTGTCCCCCCACCTGTG
C4              TTGCCCTACGAGAACGGCAGTGCCACCTATGAGCTGCCCACCCACCTGTG
C5              CTGCCCTTCGAGAATGGA---AGTAGCTATGATTTGGAGCCTCATTTGTG
                 ******:****** **.   .  * *** **  *. . .* **  ****

C1              GAACCTATCGTATCCGGAGAATGAAAGGTGCTCCTACTACGATGTGGATT
C2              GAACCTTTCGTATCCGCTGGACGAGCGGTGCTCCTACTACGATGTGGAGT
C3              GAACCTATCGTACCCGCAGAACGAACGGTGCTCCTACTACGACGTGGACT
C4              GAACCTCTCGTTTCCCCGGGGGGAAAGGTGTGCCTACTACGACGTGGAGT
C5              GAATCTATCTTATTCCGGGAAGGATGGTTGTTCCTACTACGATGTGGAGT
                *** ** ** *:  *   *.. **  * **  ********** ***** *

C1              ACACGGAGGAGTACCTGAATGGCAGCATTCCACGGAGCAGCAACGAAACC
C2              ACTCCGAGGCGTATCTGAATGGCAGCATTCCGCGGAGCAGCAACAACACC
C3              ACACAGCGGAGTACCTGAATGGCAGCATTCCGCGGAGCAGCAACGACACC
C4              ACAGCGAGGAGTACCTGAATGGCAGCATTGCCAGGAGTAGCAATGAAACC
C5              ACAGTGAGGCCTATTTGGAGGGCAATATTACCCGGAAAAGCAACGACACC
                **:  *.**. **  **.* ****. *** * .***. ***** .*.***

C1              AAGACCTGTTCCAGCTACGTTTACGATCGGAGCAAGTACCTCAATAGTGC
C2              AAGAGCTGCACCAGCTACGTCTACGATCGGAGCAAGTACCTCAATAGTGC
C3              AAGAGCTGTTCGCGCTATGTGTACGATCAGAGCAAGTACCTCAACAGTGC
C4              AAGGCCTGTTCCCGCTACGTCTACGACCAGAGCAAGTACCTCAACAGTGC
C5              AAGAGCTGCTCCTCCTACGTTTACGATCAGAGCAAGTATCTCAACAGTGC
                ***. *** :*   *** ** ***** *.********* ***** *****

C1              GGTGACCGAGTGGAACCTGGTTTGTGGCAGGGATTTCATGGCAGCTACCA
C2              GGTGACCGAGTGGAACCTGGTTTGTGGCAGGGATTTCATGGCTGCCACCA
C3              CGTGACCGAGTGGAATCTGGTTTGTGGCAGGGATTTCATGGCCGCCACCA
C4              GGTGACCGAATGGAACCTGGTTTGTGGCCGCGATTTCCTGGCAGCCACCA
C5              GGTGACCGAATGGAATCTGGTTTGTGGCAGGGAGTTTCTGGCTGCCACCA
                 ********.***** ************.* ** ** .**** ** ****

C1              GTGATTCGCTCTTCATGCTGGGCGTGCTTCTGGGCAGCATTGTGTTTGGT
C2              GTGATTCGCTCTTCATGCTGGGCGTGCTCCTGGGCAGCATTGTGTTTGGC
C3              GCGATTCGCTCTTCATGCTGGGCGTGCTCCTGGGCAGCATTGTGTTTGGC
C4              GCGACTCCATCTTCATGCTGGGCGTGCTCCTGGGCAGCATCGTTTTTGGC
C5              GCGATTCCCTCTTCATGTTCGGAGTGCTCCTGGGCAGCATCGTCTTTGGC
                * ** ** .******** * **.***** *********** ** ***** 

C1              CAACTGAGCGATAAGTACGGAAGAAAACCCATCCTCTTCGCCTCACTGGT
C2              CAGCTGAGCGACAAGTACGGAAGGAAGCCCATACTCTTCGCCTCGCTGGT
C3              CAACTGAGCGATAAGTACGGTAGAAAGCCCATCCTCTTCGCCTCGCTGGT
C4              CAACTGAGTGATAGGTACGGACGCAAGCCCATCCTCTTCGCCTCGCTGGT
C5              CAACTGAGCGACAAGTATGGAAGGAAGCCCATCCTCTTCGCCTCGCTGGT
                **.***** ** *.*** **:.* **.*****.***********.*****

C1              CATCCAGGTGCTGTTCGGTGTTCTGGCTGGAGTGGCTCCGGAATATTTCA
C2              CATCCAGGTGCTGTTCGGTGTTCTGGCCGGAGTTGCTCCGGAATATTTCA
C3              CATCCAGGTGCTGTTCGGCGTTCTGGCTGGAGTGGCACCGGAATATTTCA
C4              CATCCAGGTGCTGTTCGGAGTTATGGCCGGAGTGGCTCCGGAGTACATTA
C5              AATCCAGGTGATATTCGGAGTGCTGGCTGGAGTGGCTCCGGAGTACTTTA
                .*********.*.***** ** .**** ***** **:*****.** :* *

C1              CCTACACGTTCGCCAGGCTGATGGTGGGAGCCACCACTTCCGGAGTTTTC
C2              CCTACACGTTCGCGAGAGTGATGGTGGGTGCCACCACTTCGGGTGTTTTC
C3              CCTACACGTTCGCCAGACTGATGGTGGGCGCCACCACTTCCGGTGTCTTC
C4              CCTACACATTTTCCCGCCTGATGGTGGGGGCCACCACCTCGGGGGTGTTC
C5              CCTACACCTTTGCGAGATTGATGGTGGGTGCCACCACCTCGGGCGTCTTC
                ******* **  * .*  ********** ******** ** ** ** ***

C1              CTCGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCGGACAAGCGCCT
C2              CTGGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCGGACAAGCGCCT
C3              CTGGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCGGACAAGCGCCT
C4              CTGGTGGCCTATGTGGTGGCCATGGAGATGGTGGGACCCGACAAGCGCCT
C5              CTGGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCCGATAAGCGACT
                ** ***********************.********:** ** *****.**

C1              TTACGCCGGCATCTTCGTCATGATGTTCTTCTCCGTGGGATTCATGCTGA
C2              GTACGCCGGCATCTTCGTCATGATGTTCTTCTCCGTGGGCTTCATGCTGA
C3              GTACGCCGGCATCTTTGTTATGATGTTCTTCTCCGTGGGATTCATGCTGA
C4              CTACGCCGGCATCTTCGTGATGATGTTCTTCTCCGTGGGCTTCATGCTCA
C5              CTACGCTGGCATCTTTGTGATGATGTTCTTCTCCGTGGGATTTATGTTGA
                 ***** ******** ** ********************.** *** * *

C1              CGGCGGTCTTCGCCTACTTTGTCCACGACTGGCGCTGGCTGCAGATTGCT
C2              CGGCGGTCTTTGCCTACTTCATCCACGACTGGCGCTGGTTGCAGATTGCA
C3              CGGCAGTCTTCGCCTACTTCTTCCACGACTGGCGCTGGCTGCAGATTGCT
C4              CAGCGGGCTTTGCCTACTTCGTCCACGACTGGAGATGGCTGCAGATTGCC
C5              CCGCGGTCTTTGCCTACTTCGTTCACGATTGGAGATGGCTGCAGATTGCT
                * **.* *** ********  * ***** ***.*.*** ********** 

C1              CTAACGCTTCCCGGACTAATTTTCATGTTCTACTACTGGATCATTCCGGA
C2              CTAACTCTACCCGGACTCATCTTCATGTTCTACTACTGGATCATTCCGGA
C3              CTAACCCTACCCGGACTCATCTTCATGTTCTACTACTGGATCATTCCGGA
C4              CTGACCTTGCCGGGGATCATCTTCTTGTGCTACTACTGGATCATTCCGGA
C5              CTCACCTTGCCGGGATTGATTTTCATGTGCTACTACTGGATCATTCCCGA
                ** **  * ** **. * ** ***:*** ****************** **

C1              ATCCGCCCGCTGGCTGCTCTTGAAGGGACGTAAGGATTGCGCCATTGCCA
C2              ATCCGCCCGCTGGCTGCTCTCGAAGGGACGCAAGGATTGCGCCATCGCCA
C3              GTCCGCCCGCTGGCTGCTGTCGAAGGGACGCAAGGAGTGCGCCATCGCCA
C4              GTCTGCCCGCTGGCTGCTCTCCAAGGGTCGCAAGGATTGCGCCATTGCCA
C5              ATCCGCCCGCTGGCTGCTCTCGAAGGGAAGGAAGGAGTGCGCCATTGCCA
                .** ************** *  *****:.* ***** ******** ****

C1              ACATGCAGAAGGCGGCGCGATTCAACAAGGTGGAGATCAGCGATGAGGCT
C2              ACATGCAGAAGGCGGCGCGATTCAACAAGGTGGAGATCAGCGATGAGGCA
C3              ACATGCAGAAGGCGGCGCGATTCAACAAGGTGGAGATCAGCGATGAGGCA
C4              ATATGCAAAAGGCGGCGAGATTCAACAAGGTGGAAATAAGTGACGAGGCC
C5              ACATGCAGAAGGCAGCGCGATTCAACAAAGTGGAGGTCACCAATGAGGCT
                * *****.*****.***.**********.*****..*.*  .* ***** 

C1              TTGAGTGAGCTGCTCGATGAGGGAGAAAACTCGGAGGAGAAGGCCAAGCA
C2              TTGAGTGAGCTGCTCGATGAGGGTGAAGACAGCGAGGAGAGGGCCAAGCA
C3              TTGGGTGAGCTGCTCGATGAGGGTGAAAACTCCGAGGAGAAGGCCAAGCA
C4              TTGAGTGACCTGCTGGATGAGGGAGAATCTACCGAGGAGAAGGCCAAGCA
C5              TTGAGTGAGCTGCTCGACGAGGGAGAAACCTCCGAGGAGAAGGCCAAGCA
                ***.**** ***** ** *****:*** . :  *******.*********

C1              GAAGCTGGAGGATCAGGAGCTGGATGAGGGACCACCGCCCTCCGTGTGGG
C2              GAAGCTGGAGGATTTGGAGCAGGTTGAGGGACCGCCGCCCTCCGTGTGGG
C3              GAAGCTGGAGGATCCGGAGCAGGACGCGGGACCGCCGCCCTCCGTGTGGG
C4              GAAGCTGGAGGATCGGGAG---GATGAGGGACCACCGCCCTCCGTCTGGG
C5              GAAGTTGGAGGATGAGGATAAGGATGAGGGACCTCCGCCCTCCGTTTGGG
                **** ********  ***    *: *.****** *********** ****

C1              ATCTCTTCTGCTACCCCAATCTCCGGCGCAAGACGCTGCTTATCTTCCTG
C2              ATCTCTTTTGCTATCCCAATCTGCGGCGCAAGACGCTGCTCATCTTCCTG
C3              ATCTCTTCTGCTACCCCAATCTCCGCCGCAAGACGCTGCTCATCTTCCTG
C4              ATCTCTTCTGCTACCCCAACCTCCGCCGCAAGACGCTGCTCATCTTCCTG
C5              ATCTCTTCTGCTACCCGAATCTCCGCCGGAAAACCCTTTTAATATTCCTG
                ******* ***** ** ** ** ** ** **.** **  * **.******

C1              GACTGGCTGGTGACCAGCGGCGTGTATTATGGTCTCTCATGGAACACCAG
C2              GACTGGCTGGTGACCAGTGGCGTGTACTATGGACTCTCGTGGAACACCAA
C3              GACTGGCTGGTGACCAGTGGCGTGTACTATGGACTCTCCTGGAACACCAA
C4              GACTGGCTGGTCACGAGTGGCGTGTACTACGGACTCTCCTGGAACACCAA
C5              GATTGGCTGGTAACTAGTGGTGTTTACTACGGACTCTCCTGGAACACCAA
                ** ******** ** ** ** ** ** ** **:***** **********.

C1              CAACCTGGGTGGCAATGTGCTGCTGAACTTCGTCATCTCGGGAGCCGTGG
C2              CGACCTGGGCGGCAATGTGCTGCTGAACTTCATCATCTCGGGTGCCGTGG
C3              CAACCTGGGTGGCAATGTGCTGCTGAACTTTGTTATCTCGGGAGCCGTGG
C4              CAACCTGGGTGACAATGTACTCCTCAATTTCCTCATCTCGGGAGCCGTGG
C5              CAACCTGGGTGGCAATGTGTTACTCAACTTTGTAATCTCTGGAGCCGTGG
                *.******* *.******. * ** ** **  * ***** **:*******

C1              AGATCCCGGCCTATATATTCCTGCTGCTGACCTTGAACCGCTGGGGCCGG
C2              AAATACCAGGCTATATATTCCTGCTGCTCACCCTCAACCGCTGGGGCCGG
C3              AGATCCCAGCCTATGTATTCCTGCTGCTAACCCTGAACCGCTGGGGCCGG
C4              AGATACCAGCCTATGTATTCCTCCTCCTCACCCTCAACCGCTGGGGCAGA
C5              AGATACCAGCCTATGTGTTCCTACTCCTCACTTTGAATCGCTGGGGCAGA
                *.**.**.* ****.*.***** ** ** **  * ** *********.*.

C1              CGATCGATCCTGTGTGGCTGCCTGGTGATGGCCGGTCTCAGTCTCCTGGC
C2              CGATCGATCCTGTGCGGCAGTTTGGTGATGGCCGGTCTCAGTCTCCTGGC
C3              CGATCCATCCTGTGCGGCTGCCTGGTGATGGCGGGTCTCAGTCTCCTGGC
C4              AGATCCATTCTGTGCGGCTGCTTGGTGCTGGCGGGAGTCAGTCTGCTGGC
C5              AGATCCATCCTTTGTGGTTGCTTGGTGATGGCAGGCTTGAGTCTCCTGGC
                .**** ** ** ** ** :*  *****.**** **  * ***** *****

C1              CACGGTCATCATTCCGCAGCGAATGCACACCCTCATAGTCGCGTGCGCCA
C2              CACGGTCATCGTTCCGGAGGAGATGCACACGCTCATCATCGCGTGCGCCA
C3              CACGGTCGTCGTTCCGGACAGCATGCACACCTTAATGATCGCGTGCGCCA
C4              CACGGGCATTATTCCGGAGAAGATGAACACCCTGATTGTGACCTGCGCCA
C5              CACTGTGGTCATTCCAAGCAGGATGCACAGCCTGATTGTGGCCTGTGCCA
                *** *  .* .****. .  . ***.***   * ** .* .* ** ****

C1              TGCTTGGCAAGCTGGCCATCACGGCGTCGTATGGAACCGTTTACATATTC
C2              TGCTGGGCAAGCTGGCGATCACGGCGTCGTATGGCACCGTTTACATATTC
C3              TGCTGGGCAAGCTGGCCATCACAGCGTCCTATGGCACCGTCTACATATTC
C4              TGTTGGGCAAACTGGCCATCACTGCCTCGTATGGCACCGTCTACATATTC
C5              TGTTGGGCAAACTGGCCATCACTGCCTCCTATGGAACCGTTTACATATTC
                ** * *****.***** ***** ** ** *****.***** *********

C1              TCCGCCGAGCAGTTCCCAACCGTGGTTAGAAATGTGGCCCTGGGCGCCGC
C2              TCCGCCGAGCAGTTCCCAACCGTGGTGAGGAATGTGGCTCTGGGCGCCGC
C3              TCCGCCGAGCAGTTCCCAACCGTGGTGCGAAATGTGGCTCTGGGCGCCGC
C4              TCCGCCGAGCAGTTCCCCACTGTGGTCAGGAATGTGGCCTTGGGAGCCGC
C5              TCCGCTGAGCAGTTTCCCACTGTGGTTAGGAATGTGGCTTTGGGCGCCGC
                ***** ******** **.** ***** .*.********  ****.*****

C1              CTCTATGGTGGCCCGGATCAGTGGCATGATGGCACCGTTCCTCAACTTCT
C2              CTCCATGGTGGCACGCATTAGTGGCATGATGGCACCATTCCTCAAAATGT
C3              CTCCATGGTGGCCCGCATCAGTGGCATGATGGCACCATTCCTCAACTTCC
C4              CTCCATGGTGGCCCGCATCAGTGGTATGATGGCGCCGTACCTCAGTTTTT
C5              TTCCATGGTGGCCAGAATCAGCGGAATGATGGCGCCGTTTCTCACCTTTT
                 ** ********..* ** ** ** ********.**.*: ****  :*  

C1              TGGCCACCATCTGGAAGCCACTGCCGTTGCTCATCTGCGGATCCCTGACC
C2              TGGCCACCATTTGGAAGCCACTGCCGCTGCTCATCTGCGGATCGCTCTCC
C3              TGGCCACCATTTGGAAGCCACTGCCGCTGCTCATCTGCGGATCGCTCTCC
C4              TGGCCACCATCTGGCGGCCACTGCCACTCCTCATCTGTGGATCCCTCTCC
C5              TGGCCACCATTTGGCAACCGCTGCCACTCCTCATCTGCGGATCCCTGGCC
                ********** ***...**.*****. * ******** ***** **  **

C1              TTGGTAGCCGGATTGCTCTCCCTCCTGCTGCCGGAGACGCACAATAAGCC
C2              TTGGCGGCCGGATTGCTCTCGCTCCTGCTGCCGGAGACGCACAACAAGCC
C3              CTGGCAGCCGGGTTGCTCTCTCTCCTGCTGCCGGAGACGCACAACCAGCC
C4              TTGTTGGCGGGACTACTATCTCTTCTGCTGCCGGAGACGCACAACAAGCC
C5              CTGGCAGCGGGATTGCTATCGCTTCTCCTCCCAAAAACGCACAACAAACC
                 **  .** **. *.**.** ** ** ** **..*.******** .*.**

C1              CATGCTGGAGACCATCGCGGATGGCGAGCGCTTTGGCAAGAAGACCAAGG
C2              CATGCTGGAGACCATTGCCGATGGCGAGCGCTTTGGCAAGAAGACCAAGG
C3              CATGCTGGAGACCATTGCGGATGGCGAGCGTTTTGGCAAGAAGACCAAGG
C4              CATGCTGGAGACCATTGCGGATGGCGAGCGGTTCGGTAAGAAGACCAAGG
C5              GATGCTGGAAACCATTGCGGATGGCGAGCGTTTTGGCAAGAAGACCAAGG
                 ********.***** ** *********** ** ** *************

C1              CAGATGTCTACCTGGAAACGGGCCAAGAACTGAGA---GCACCAGAGGCG
C2              GCGATGTCTACCTGGAAACGGGCCAAGAACTGCGA---GTACCCGAGGCG
C3              GAGATGTCTACCTGGAAACGGGCCAAGAACTGAGG---GCACCAGAGGCG
C4              GAGACGTCTACCTGGAGACGGGCCAGGAGCTGCGGCAGACCCCAGAGACG
C5              GCGATGTCTATCTGGAAACGGGCCAAGAAATGCGACAGACACCGGAGACG
                 .** ***** *****.********.**..**.*.   . .** ***.**

C1              CAGCCACTCAAGGGATCAGGCGAGACAAATGGATCAACCATAGCCAATGG
C2              CAGCCACTCAAGGGATCAGGCGAAGCGAATGGATCAGCCATAGCCAATGG
C3              CAGCCACTCAAGGGAACAGGCGAGGCAAATGGCTCAAGCATAGCCAATGG
C4              CAGCCCCTGAGGGGAGCAACTGAAGCGAATGGG---CTGAAGACCAATGG
C5              CAGCCGCTGAATGGATCGGCTGACTCGAATGGA---CTCAAGAGCAATGG
                ***** ** *. *** *..  **  *.*****       *:.. ******

C1              CCACAAG
C2              CCACAAG
C3              CCACAAG
C4              CCACAAG
C5              CCAGAAG
                *** ***



>C1
ATGGGCTACGATGAGGCCATCATCCATCTGGGTGATTTTGGACGCTATCA
GAAGATCATCTACTTTCTCATCTGCCTAACATCCATACCAGTTGCCTTCC
ACAAGCTGGCCGGGGTGTTCCTGCTGGCCAAACCGGACTTCCGGTGCGCC
CTGCCCTTCGAGAATGGA---AGTAGCTACGACTTGCCCACCCACCTGTG
GAACCTATCGTATCCGGAGAATGAAAGGTGCTCCTACTACGATGTGGATT
ACACGGAGGAGTACCTGAATGGCAGCATTCCACGGAGCAGCAACGAAACC
AAGACCTGTTCCAGCTACGTTTACGATCGGAGCAAGTACCTCAATAGTGC
GGTGACCGAGTGGAACCTGGTTTGTGGCAGGGATTTCATGGCAGCTACCA
GTGATTCGCTCTTCATGCTGGGCGTGCTTCTGGGCAGCATTGTGTTTGGT
CAACTGAGCGATAAGTACGGAAGAAAACCCATCCTCTTCGCCTCACTGGT
CATCCAGGTGCTGTTCGGTGTTCTGGCTGGAGTGGCTCCGGAATATTTCA
CCTACACGTTCGCCAGGCTGATGGTGGGAGCCACCACTTCCGGAGTTTTC
CTCGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCGGACAAGCGCCT
TTACGCCGGCATCTTCGTCATGATGTTCTTCTCCGTGGGATTCATGCTGA
CGGCGGTCTTCGCCTACTTTGTCCACGACTGGCGCTGGCTGCAGATTGCT
CTAACGCTTCCCGGACTAATTTTCATGTTCTACTACTGGATCATTCCGGA
ATCCGCCCGCTGGCTGCTCTTGAAGGGACGTAAGGATTGCGCCATTGCCA
ACATGCAGAAGGCGGCGCGATTCAACAAGGTGGAGATCAGCGATGAGGCT
TTGAGTGAGCTGCTCGATGAGGGAGAAAACTCGGAGGAGAAGGCCAAGCA
GAAGCTGGAGGATCAGGAGCTGGATGAGGGACCACCGCCCTCCGTGTGGG
ATCTCTTCTGCTACCCCAATCTCCGGCGCAAGACGCTGCTTATCTTCCTG
GACTGGCTGGTGACCAGCGGCGTGTATTATGGTCTCTCATGGAACACCAG
CAACCTGGGTGGCAATGTGCTGCTGAACTTCGTCATCTCGGGAGCCGTGG
AGATCCCGGCCTATATATTCCTGCTGCTGACCTTGAACCGCTGGGGCCGG
CGATCGATCCTGTGTGGCTGCCTGGTGATGGCCGGTCTCAGTCTCCTGGC
CACGGTCATCATTCCGCAGCGAATGCACACCCTCATAGTCGCGTGCGCCA
TGCTTGGCAAGCTGGCCATCACGGCGTCGTATGGAACCGTTTACATATTC
TCCGCCGAGCAGTTCCCAACCGTGGTTAGAAATGTGGCCCTGGGCGCCGC
CTCTATGGTGGCCCGGATCAGTGGCATGATGGCACCGTTCCTCAACTTCT
TGGCCACCATCTGGAAGCCACTGCCGTTGCTCATCTGCGGATCCCTGACC
TTGGTAGCCGGATTGCTCTCCCTCCTGCTGCCGGAGACGCACAATAAGCC
CATGCTGGAGACCATCGCGGATGGCGAGCGCTTTGGCAAGAAGACCAAGG
CAGATGTCTACCTGGAAACGGGCCAAGAACTGAGA---GCACCAGAGGCG
CAGCCACTCAAGGGATCAGGCGAGACAAATGGATCAACCATAGCCAATGG
CCACAAG
>C2
ATGGGCTATGACGAGGCCATCGTCCATCTGGGCGACTTTGGACGCTACCA
GAAGATCATCTACTCCCTCATCTGCCTCACCTCCATTCCAGTGGCCTTCC
ACAAGTTGGCCGGGGTGTTCCTGCTGGCCAAACCCGACTTCCGATGTGCG
CTGCCCTTCGAGAATGGC---AGCACCTACGAGCTATCGCCCCACCTGTG
GAACCTTTCGTATCCGCTGGACGAGCGGTGCTCCTACTACGATGTGGAGT
ACTCCGAGGCGTATCTGAATGGCAGCATTCCGCGGAGCAGCAACAACACC
AAGAGCTGCACCAGCTACGTCTACGATCGGAGCAAGTACCTCAATAGTGC
GGTGACCGAGTGGAACCTGGTTTGTGGCAGGGATTTCATGGCTGCCACCA
GTGATTCGCTCTTCATGCTGGGCGTGCTCCTGGGCAGCATTGTGTTTGGC
CAGCTGAGCGACAAGTACGGAAGGAAGCCCATACTCTTCGCCTCGCTGGT
CATCCAGGTGCTGTTCGGTGTTCTGGCCGGAGTTGCTCCGGAATATTTCA
CCTACACGTTCGCGAGAGTGATGGTGGGTGCCACCACTTCGGGTGTTTTC
CTGGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCGGACAAGCGCCT
GTACGCCGGCATCTTCGTCATGATGTTCTTCTCCGTGGGCTTCATGCTGA
CGGCGGTCTTTGCCTACTTCATCCACGACTGGCGCTGGTTGCAGATTGCA
CTAACTCTACCCGGACTCATCTTCATGTTCTACTACTGGATCATTCCGGA
ATCCGCCCGCTGGCTGCTCTCGAAGGGACGCAAGGATTGCGCCATCGCCA
ACATGCAGAAGGCGGCGCGATTCAACAAGGTGGAGATCAGCGATGAGGCA
TTGAGTGAGCTGCTCGATGAGGGTGAAGACAGCGAGGAGAGGGCCAAGCA
GAAGCTGGAGGATTTGGAGCAGGTTGAGGGACCGCCGCCCTCCGTGTGGG
ATCTCTTTTGCTATCCCAATCTGCGGCGCAAGACGCTGCTCATCTTCCTG
GACTGGCTGGTGACCAGTGGCGTGTACTATGGACTCTCGTGGAACACCAA
CGACCTGGGCGGCAATGTGCTGCTGAACTTCATCATCTCGGGTGCCGTGG
AAATACCAGGCTATATATTCCTGCTGCTCACCCTCAACCGCTGGGGCCGG
CGATCGATCCTGTGCGGCAGTTTGGTGATGGCCGGTCTCAGTCTCCTGGC
CACGGTCATCGTTCCGGAGGAGATGCACACGCTCATCATCGCGTGCGCCA
TGCTGGGCAAGCTGGCGATCACGGCGTCGTATGGCACCGTTTACATATTC
TCCGCCGAGCAGTTCCCAACCGTGGTGAGGAATGTGGCTCTGGGCGCCGC
CTCCATGGTGGCACGCATTAGTGGCATGATGGCACCATTCCTCAAAATGT
TGGCCACCATTTGGAAGCCACTGCCGCTGCTCATCTGCGGATCGCTCTCC
TTGGCGGCCGGATTGCTCTCGCTCCTGCTGCCGGAGACGCACAACAAGCC
CATGCTGGAGACCATTGCCGATGGCGAGCGCTTTGGCAAGAAGACCAAGG
GCGATGTCTACCTGGAAACGGGCCAAGAACTGCGA---GTACCCGAGGCG
CAGCCACTCAAGGGATCAGGCGAAGCGAATGGATCAGCCATAGCCAATGG
CCACAAG
>C3
ATGGGCTATGACGAGGCCATCGTCCACTTGGGGGACTTTGGACGCTACCA
GAAGATCATCTACTTCCTCATCTGCCTCACATCCATTCCAGTGGCCTTTC
ACAAGCTGGCCGGGGTGTTCCTGCTGGCCAAGCCGGACTTCCGGTGCGCC
CTGCCCTTCGAGAATGGC---AGTAGCTACGAGTTGTCCCCCCACCTGTG
GAACCTATCGTACCCGCAGAACGAACGGTGCTCCTACTACGACGTGGACT
ACACAGCGGAGTACCTGAATGGCAGCATTCCGCGGAGCAGCAACGACACC
AAGAGCTGTTCGCGCTATGTGTACGATCAGAGCAAGTACCTCAACAGTGC
CGTGACCGAGTGGAATCTGGTTTGTGGCAGGGATTTCATGGCCGCCACCA
GCGATTCGCTCTTCATGCTGGGCGTGCTCCTGGGCAGCATTGTGTTTGGC
CAACTGAGCGATAAGTACGGTAGAAAGCCCATCCTCTTCGCCTCGCTGGT
CATCCAGGTGCTGTTCGGCGTTCTGGCTGGAGTGGCACCGGAATATTTCA
CCTACACGTTCGCCAGACTGATGGTGGGCGCCACCACTTCCGGTGTCTTC
CTGGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCGGACAAGCGCCT
GTACGCCGGCATCTTTGTTATGATGTTCTTCTCCGTGGGATTCATGCTGA
CGGCAGTCTTCGCCTACTTCTTCCACGACTGGCGCTGGCTGCAGATTGCT
CTAACCCTACCCGGACTCATCTTCATGTTCTACTACTGGATCATTCCGGA
GTCCGCCCGCTGGCTGCTGTCGAAGGGACGCAAGGAGTGCGCCATCGCCA
ACATGCAGAAGGCGGCGCGATTCAACAAGGTGGAGATCAGCGATGAGGCA
TTGGGTGAGCTGCTCGATGAGGGTGAAAACTCCGAGGAGAAGGCCAAGCA
GAAGCTGGAGGATCCGGAGCAGGACGCGGGACCGCCGCCCTCCGTGTGGG
ATCTCTTCTGCTACCCCAATCTCCGCCGCAAGACGCTGCTCATCTTCCTG
GACTGGCTGGTGACCAGTGGCGTGTACTATGGACTCTCCTGGAACACCAA
CAACCTGGGTGGCAATGTGCTGCTGAACTTTGTTATCTCGGGAGCCGTGG
AGATCCCAGCCTATGTATTCCTGCTGCTAACCCTGAACCGCTGGGGCCGG
CGATCCATCCTGTGCGGCTGCCTGGTGATGGCGGGTCTCAGTCTCCTGGC
CACGGTCGTCGTTCCGGACAGCATGCACACCTTAATGATCGCGTGCGCCA
TGCTGGGCAAGCTGGCCATCACAGCGTCCTATGGCACCGTCTACATATTC
TCCGCCGAGCAGTTCCCAACCGTGGTGCGAAATGTGGCTCTGGGCGCCGC
CTCCATGGTGGCCCGCATCAGTGGCATGATGGCACCATTCCTCAACTTCC
TGGCCACCATTTGGAAGCCACTGCCGCTGCTCATCTGCGGATCGCTCTCC
CTGGCAGCCGGGTTGCTCTCTCTCCTGCTGCCGGAGACGCACAACCAGCC
CATGCTGGAGACCATTGCGGATGGCGAGCGTTTTGGCAAGAAGACCAAGG
GAGATGTCTACCTGGAAACGGGCCAAGAACTGAGG---GCACCAGAGGCG
CAGCCACTCAAGGGAACAGGCGAGGCAAATGGCTCAAGCATAGCCAATGG
CCACAAG
>C4
ATGGGCTACGATGAGGCCATCAGCCATGTGGGCGACTTCGGACGCTACCA
GAAGATCATCTACTTCCTCATCTGCCTGACCTCCATTCCAGTGGCCTTTC
ACAAGTTCGCGGGGGTCTTCCTGCTGGCCAAGCCCGACTTTCGCTGCGAG
TTGCCCTACGAGAACGGCAGTGCCACCTATGAGCTGCCCACCCACCTGTG
GAACCTCTCGTTTCCCCGGGGGGAAAGGTGTGCCTACTACGACGTGGAGT
ACAGCGAGGAGTACCTGAATGGCAGCATTGCCAGGAGTAGCAATGAAACC
AAGGCCTGTTCCCGCTACGTCTACGACCAGAGCAAGTACCTCAACAGTGC
GGTGACCGAATGGAACCTGGTTTGTGGCCGCGATTTCCTGGCAGCCACCA
GCGACTCCATCTTCATGCTGGGCGTGCTCCTGGGCAGCATCGTTTTTGGC
CAACTGAGTGATAGGTACGGACGCAAGCCCATCCTCTTCGCCTCGCTGGT
CATCCAGGTGCTGTTCGGAGTTATGGCCGGAGTGGCTCCGGAGTACATTA
CCTACACATTTTCCCGCCTGATGGTGGGGGCCACCACCTCGGGGGTGTTC
CTGGTGGCCTATGTGGTGGCCATGGAGATGGTGGGACCCGACAAGCGCCT
CTACGCCGGCATCTTCGTGATGATGTTCTTCTCCGTGGGCTTCATGCTCA
CAGCGGGCTTTGCCTACTTCGTCCACGACTGGAGATGGCTGCAGATTGCC
CTGACCTTGCCGGGGATCATCTTCTTGTGCTACTACTGGATCATTCCGGA
GTCTGCCCGCTGGCTGCTCTCCAAGGGTCGCAAGGATTGCGCCATTGCCA
ATATGCAAAAGGCGGCGAGATTCAACAAGGTGGAAATAAGTGACGAGGCC
TTGAGTGACCTGCTGGATGAGGGAGAATCTACCGAGGAGAAGGCCAAGCA
GAAGCTGGAGGATCGGGAG---GATGAGGGACCACCGCCCTCCGTCTGGG
ATCTCTTCTGCTACCCCAACCTCCGCCGCAAGACGCTGCTCATCTTCCTG
GACTGGCTGGTCACGAGTGGCGTGTACTACGGACTCTCCTGGAACACCAA
CAACCTGGGTGACAATGTACTCCTCAATTTCCTCATCTCGGGAGCCGTGG
AGATACCAGCCTATGTATTCCTCCTCCTCACCCTCAACCGCTGGGGCAGA
AGATCCATTCTGTGCGGCTGCTTGGTGCTGGCGGGAGTCAGTCTGCTGGC
CACGGGCATTATTCCGGAGAAGATGAACACCCTGATTGTGACCTGCGCCA
TGTTGGGCAAACTGGCCATCACTGCCTCGTATGGCACCGTCTACATATTC
TCCGCCGAGCAGTTCCCCACTGTGGTCAGGAATGTGGCCTTGGGAGCCGC
CTCCATGGTGGCCCGCATCAGTGGTATGATGGCGCCGTACCTCAGTTTTT
TGGCCACCATCTGGCGGCCACTGCCACTCCTCATCTGTGGATCCCTCTCC
TTGTTGGCGGGACTACTATCTCTTCTGCTGCCGGAGACGCACAACAAGCC
CATGCTGGAGACCATTGCGGATGGCGAGCGGTTCGGTAAGAAGACCAAGG
GAGACGTCTACCTGGAGACGGGCCAGGAGCTGCGGCAGACCCCAGAGACG
CAGCCCCTGAGGGGAGCAACTGAAGCGAATGGG---CTGAAGACCAATGG
CCACAAG
>C5
ATGGGCTACGATGAGGCGATTGTCCATCTGGGAGACTTTGGTCGCTACCA
GAAGATCATCTACTTCCTCATCTGTTTGACTTCCATTCCGGTGGCTTTTC
ACAAGTTGGCAGGGGTTTTCCTTCTGGCCAAACCGGATTTTCGCTGTGTC
CTGCCCTTCGAGAATGGA---AGTAGCTATGATTTGGAGCCTCATTTGTG
GAATCTATCTTATTCCGGGAAGGATGGTTGTTCCTACTACGATGTGGAGT
ACAGTGAGGCCTATTTGGAGGGCAATATTACCCGGAAAAGCAACGACACC
AAGAGCTGCTCCTCCTACGTTTACGATCAGAGCAAGTATCTCAACAGTGC
GGTGACCGAATGGAATCTGGTTTGTGGCAGGGAGTTTCTGGCTGCCACCA
GCGATTCCCTCTTCATGTTCGGAGTGCTCCTGGGCAGCATCGTCTTTGGC
CAACTGAGCGACAAGTATGGAAGGAAGCCCATCCTCTTCGCCTCGCTGGT
AATCCAGGTGATATTCGGAGTGCTGGCTGGAGTGGCTCCGGAGTACTTTA
CCTACACCTTTGCGAGATTGATGGTGGGTGCCACCACCTCGGGCGTCTTC
CTGGTGGCCTATGTGGTGGCCATGGAAATGGTGGGTCCCGATAAGCGACT
CTACGCTGGCATCTTTGTGATGATGTTCTTCTCCGTGGGATTTATGTTGA
CCGCGGTCTTTGCCTACTTCGTTCACGATTGGAGATGGCTGCAGATTGCT
CTCACCTTGCCGGGATTGATTTTCATGTGCTACTACTGGATCATTCCCGA
ATCCGCCCGCTGGCTGCTCTCGAAGGGAAGGAAGGAGTGCGCCATTGCCA
ACATGCAGAAGGCAGCGCGATTCAACAAAGTGGAGGTCACCAATGAGGCT
TTGAGTGAGCTGCTCGACGAGGGAGAAACCTCCGAGGAGAAGGCCAAGCA
GAAGTTGGAGGATGAGGATAAGGATGAGGGACCTCCGCCCTCCGTTTGGG
ATCTCTTCTGCTACCCGAATCTCCGCCGGAAAACCCTTTTAATATTCCTG
GATTGGCTGGTAACTAGTGGTGTTTACTACGGACTCTCCTGGAACACCAA
CAACCTGGGTGGCAATGTGTTACTCAACTTTGTAATCTCTGGAGCCGTGG
AGATACCAGCCTATGTGTTCCTACTCCTCACTTTGAATCGCTGGGGCAGA
AGATCCATCCTTTGTGGTTGCTTGGTGATGGCAGGCTTGAGTCTCCTGGC
CACTGTGGTCATTCCAAGCAGGATGCACAGCCTGATTGTGGCCTGTGCCA
TGTTGGGCAAACTGGCCATCACTGCCTCCTATGGAACCGTTTACATATTC
TCCGCTGAGCAGTTTCCCACTGTGGTTAGGAATGTGGCTTTGGGCGCCGC
TTCCATGGTGGCCAGAATCAGCGGAATGATGGCGCCGTTTCTCACCTTTT
TGGCCACCATTTGGCAACCGCTGCCACTCCTCATCTGCGGATCCCTGGCC
CTGGCAGCGGGATTGCTATCGCTTCTCCTCCCAAAAACGCACAACAAACC
GATGCTGGAAACCATTGCGGATGGCGAGCGTTTTGGCAAGAAGACCAAGG
GCGATGTCTATCTGGAAACGGGCCAAGAAATGCGACAGACACCGGAGACG
CAGCCGCTGAATGGATCGGCTGACTCGAATGGA---CTCAAGAGCAATGG
CCAGAAG
>C1
MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENGoSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNET
KTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEA
LSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGR
RSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLT
LVAGLLSLLLPETHNKPMLETIADGERFGKKTKADVYLETGQELRoAPEA
QPLKGSGETNGSTIANGHK
>C2
MGYDEAIVHLGDFGRYQKIIYSLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENGoSTYELSPHLWNLSYPLDERCSYYDVEYSEAYLNGSIPRSSNNT
KSCTSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARVMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFIHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSELLDEGEDSEERAKQKLEDLEQVEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNDLGGNVLLNFIISGAVEIPGYIFLLLTLNRWGR
RSILCGSLVMAGLSLLATVIVPEEMHTLIIACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLKMLATIWKPLPLLICGSLS
LAAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRoVPEA
QPLKGSGEANGSAIANGHK
>C3
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCA
LPFENGoSSYELSPHLWNLSYPQNERCSYYDVDYTAEYLNGSIPRSSNDT
KSCSRYVYDQSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFG
QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFFHDWRWLQIA
LTLPGLIFMFYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEISDEA
LGELLDEGENSEEKAKQKLEDPEQDAGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVMAGLSLLATVVVPDSMHTLMIACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLS
LAAGLLSLLLPETHNQPMLETIADGERFGKKTKGDVYLETGQELRoAPEA
QPLKGTGEANGSSIANGHK
>C4
MGYDEAISHVGDFGRYQKIIYFLICLTSIPVAFHKFAGVFLLAKPDFRCE
LPYENGSATYELPTHLWNLSFPRGERCAYYDVEYSEEYLNGSIARSSNET
KACSRYVYDQSKYLNSAVTEWNLVCGRDFLAATSDSIFMLGVLLGSIVFG
QLSDRYGRKPILFASLVIQVLFGVMAGVAPEYITYTFSRLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAGFAYFVHDWRWLQIA
LTLPGIIFLCYYWIIPESARWLLSKGRKDCAIANMQKAARFNKVEISDEA
LSDLLDEGESTEEKAKQKLEDREoDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGDNVLLNFLISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVLAGVSLLATGIIPEKMNTLIVTCAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPYLSFLATIWRPLPLLICGSLS
LLAGLLSLLLPETHNKPMLETIADGERFGKKTKGDVYLETGQELRQTPET
QPLRGATEANGoLKTNGHK
>C5
MGYDEAIVHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCV
LPFENGoSSYDLEPHLWNLSYSGKDGCSYYDVEYSEAYLEGNITRKSNDT
KSCSSYVYDQSKYLNSAVTEWNLVCGREFLAATSDSLFMFGVLLGSIVFG
QLSDKYGRKPILFASLVIQVIFGVLAGVAPEYFTYTFARLMVGATTSGVF
LVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIA
LTLPGLIFMCYYWIIPESARWLLSKGRKECAIANMQKAARFNKVEVTNEA
LSELLDEGETSEEKAKQKLEDEDKDEGPPPSVWDLFCYPNLRRKTLLIFL
DWLVTSGVYYGLSWNTNNLGGNVLLNFVISGAVEIPAYVFLLLTLNRWGR
RSILCGCLVMAGLSLLATVVIPSRMHSLIVACAMLGKLAITASYGTVYIF
SAEQFPTVVRNVALGAASMVARISGMMAPFLTFLATIWQPLPLLICGSLA
LAAGLLSLLLPKTHNKPMLETIADGERFGKKTKGDVYLETGQEMRQTPET
QPLNGSADSNGoLKSNGQK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1707 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480083316
      Setting output file names to "/opt/ADOPS/336/Orct2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1368695502
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6681455288
      Seed = 1006068133
      Swapseed = 1480083316
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 68 unique site patterns
      Division 2 has 44 unique site patterns
      Division 3 has 149 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5482.568544 -- -25.624409
         Chain 2 -- -5645.469618 -- -25.624409
         Chain 3 -- -5654.280571 -- -25.624409
         Chain 4 -- -5674.366523 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5638.382372 -- -25.624409
         Chain 2 -- -5654.280571 -- -25.624409
         Chain 3 -- -5676.286819 -- -25.624409
         Chain 4 -- -5488.618093 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5482.569] (-5645.470) (-5654.281) (-5674.367) * [-5638.382] (-5654.281) (-5676.287) (-5488.618) 
        500 -- (-5208.116) (-5216.594) (-5218.847) [-5208.013] * (-5221.991) (-5225.804) (-5229.222) [-5210.645] -- 0:00:00
       1000 -- (-5183.116) (-5178.225) [-5133.862] (-5152.431) * (-5153.866) (-5127.389) [-5132.958] (-5170.968) -- 0:00:00
       1500 -- (-5140.065) (-5136.553) (-5093.519) [-5077.132] * (-5119.770) (-5058.490) [-5042.522] (-5129.722) -- 0:11:05
       2000 -- (-5109.775) (-5061.632) (-5052.971) [-5046.990] * (-5054.585) (-5047.482) [-5045.397] (-5090.822) -- 0:08:19
       2500 -- (-5058.080) (-5030.736) [-5034.891] (-5032.707) * [-5044.065] (-5036.826) (-5038.920) (-5064.628) -- 0:06:39
       3000 -- (-5055.747) (-5031.623) (-5035.887) [-5034.330] * [-5030.050] (-5031.095) (-5034.090) (-5048.074) -- 0:05:32
       3500 -- (-5048.049) (-5037.535) (-5038.458) [-5036.658] * [-5037.051] (-5044.815) (-5033.661) (-5051.109) -- 0:04:44
       4000 -- (-5045.736) (-5043.047) [-5036.638] (-5041.015) * (-5034.933) [-5039.094] (-5045.467) (-5039.045) -- 0:08:18
       4500 -- (-5044.942) [-5032.365] (-5034.554) (-5038.830) * [-5031.395] (-5038.622) (-5032.835) (-5039.459) -- 0:07:22
       5000 -- [-5040.147] (-5033.166) (-5033.408) (-5045.683) * (-5033.925) (-5036.265) [-5032.191] (-5042.020) -- 0:06:38

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-5036.036) (-5036.165) [-5033.689] (-5043.178) * (-5040.969) (-5045.894) (-5031.339) [-5037.483] -- 0:06:01
       6000 -- [-5035.116] (-5033.995) (-5035.058) (-5049.566) * (-5032.876) (-5046.043) [-5031.268] (-5033.547) -- 0:05:31
       6500 -- [-5032.132] (-5041.147) (-5035.404) (-5041.269) * [-5033.499] (-5035.568) (-5036.960) (-5042.059) -- 0:07:38
       7000 -- [-5037.347] (-5037.400) (-5040.891) (-5039.020) * (-5036.132) (-5039.005) [-5033.453] (-5041.307) -- 0:07:05
       7500 -- [-5034.377] (-5039.749) (-5039.124) (-5044.279) * (-5035.680) [-5042.172] (-5030.721) (-5037.322) -- 0:06:37
       8000 -- (-5034.165) (-5043.336) (-5039.116) [-5041.782] * (-5036.059) (-5034.445) (-5035.916) [-5032.378] -- 0:06:12
       8500 -- (-5039.249) [-5035.936] (-5040.210) (-5036.875) * (-5038.118) [-5033.392] (-5035.746) (-5036.480) -- 0:05:49
       9000 -- [-5029.514] (-5034.787) (-5040.224) (-5040.663) * [-5036.609] (-5033.382) (-5040.354) (-5035.136) -- 0:07:20
       9500 -- [-5033.345] (-5032.957) (-5038.865) (-5035.818) * [-5033.021] (-5033.910) (-5038.713) (-5034.773) -- 0:06:57
      10000 -- (-5040.793) (-5035.092) (-5039.442) [-5034.775] * (-5037.075) (-5037.961) (-5035.706) [-5027.607] -- 0:06:36

      Average standard deviation of split frequencies: 0.022097

      10500 -- (-5039.550) (-5037.043) [-5033.082] (-5034.163) * (-5031.114) (-5038.287) [-5035.827] (-5033.830) -- 0:06:16
      11000 -- (-5033.729) [-5031.699] (-5029.514) (-5032.411) * [-5040.213] (-5037.566) (-5035.756) (-5039.710) -- 0:05:59
      11500 -- (-5031.409) [-5037.509] (-5037.395) (-5033.726) * (-5038.281) [-5036.676] (-5036.639) (-5035.288) -- 0:07:09
      12000 -- [-5032.140] (-5035.933) (-5033.144) (-5035.773) * [-5039.729] (-5031.959) (-5035.465) (-5037.472) -- 0:06:51
      12500 -- [-5034.456] (-5038.305) (-5034.560) (-5034.077) * [-5028.820] (-5037.306) (-5039.312) (-5033.013) -- 0:06:35
      13000 -- (-5034.833) (-5036.102) [-5035.514] (-5034.933) * [-5032.101] (-5028.868) (-5035.039) (-5033.983) -- 0:06:19
      13500 -- (-5035.745) (-5039.841) [-5035.329] (-5039.959) * [-5032.291] (-5033.606) (-5034.199) (-5036.751) -- 0:06:05
      14000 -- [-5033.288] (-5043.583) (-5039.318) (-5043.070) * [-5034.884] (-5030.093) (-5037.144) (-5037.924) -- 0:07:02
      14500 -- (-5039.160) (-5043.934) (-5041.680) [-5034.854] * (-5035.204) [-5040.291] (-5046.041) (-5031.767) -- 0:06:47
      15000 -- [-5034.684] (-5033.605) (-5043.606) (-5039.954) * (-5050.834) (-5035.477) (-5036.534) [-5034.037] -- 0:06:34

      Average standard deviation of split frequencies: 0.019642

      15500 -- (-5036.870) [-5033.777] (-5035.140) (-5042.654) * (-5037.550) (-5035.876) [-5039.024] (-5041.300) -- 0:06:21
      16000 -- (-5038.964) (-5034.591) (-5042.901) [-5036.434] * (-5049.603) [-5033.191] (-5041.609) (-5034.105) -- 0:06:09
      16500 -- (-5036.044) [-5030.506] (-5034.809) (-5039.586) * (-5044.923) (-5040.413) (-5040.012) [-5037.110] -- 0:06:57
      17000 -- (-5045.325) (-5032.994) [-5035.726] (-5037.670) * (-5041.325) (-5036.546) (-5039.057) [-5034.937] -- 0:06:44
      17500 -- (-5040.866) [-5034.594] (-5033.282) (-5034.144) * (-5039.597) [-5035.631] (-5045.941) (-5032.443) -- 0:06:33
      18000 -- [-5034.135] (-5034.695) (-5035.415) (-5036.686) * (-5035.692) (-5037.903) [-5042.920] (-5032.349) -- 0:06:21
      18500 -- (-5036.581) [-5035.334] (-5032.867) (-5034.748) * (-5036.843) (-5032.939) (-5036.046) [-5030.113] -- 0:06:11
      19000 -- (-5037.489) (-5036.020) (-5036.393) [-5038.693] * [-5032.201] (-5029.735) (-5035.816) (-5035.960) -- 0:06:53
      19500 -- (-5040.498) (-5034.473) (-5033.446) [-5035.337] * (-5033.972) (-5037.652) [-5034.667] (-5031.649) -- 0:06:42
      20000 -- (-5038.737) (-5035.585) [-5034.047] (-5035.223) * (-5044.610) (-5037.092) (-5035.128) [-5031.448] -- 0:06:32

      Average standard deviation of split frequencies: 0.053223

      20500 -- (-5037.373) (-5040.457) (-5034.765) [-5038.787] * [-5036.193] (-5036.365) (-5041.142) (-5032.589) -- 0:06:22
      21000 -- [-5036.943] (-5035.786) (-5033.727) (-5033.888) * (-5038.902) (-5033.569) (-5035.389) [-5029.697] -- 0:06:12
      21500 -- (-5037.760) (-5047.358) (-5033.051) [-5034.796] * [-5038.603] (-5040.344) (-5032.723) (-5029.496) -- 0:06:49
      22000 -- (-5041.379) (-5036.221) (-5033.447) [-5038.083] * (-5048.206) [-5033.339] (-5033.618) (-5031.145) -- 0:06:40
      22500 -- [-5031.359] (-5035.493) (-5033.971) (-5044.710) * [-5040.233] (-5030.930) (-5038.404) (-5037.689) -- 0:06:31
      23000 -- (-5037.598) (-5037.137) (-5035.559) [-5032.002] * (-5037.249) [-5032.384] (-5035.458) (-5035.644) -- 0:06:22
      23500 -- (-5041.039) [-5034.778] (-5043.574) (-5041.780) * (-5034.272) (-5030.707) [-5033.597] (-5034.934) -- 0:06:13
      24000 -- (-5035.600) (-5043.448) (-5039.834) [-5031.799] * [-5037.815] (-5032.991) (-5030.905) (-5033.421) -- 0:06:46
      24500 -- (-5038.490) (-5036.217) (-5040.777) [-5029.495] * (-5030.805) (-5033.451) [-5030.436] (-5039.950) -- 0:06:38
      25000 -- (-5036.393) [-5038.215] (-5034.800) (-5036.428) * (-5033.513) (-5036.437) (-5036.051) [-5036.836] -- 0:06:30

      Average standard deviation of split frequencies: 0.045327

      25500 -- (-5039.340) (-5032.150) [-5032.834] (-5043.349) * (-5037.351) (-5040.582) [-5030.767] (-5032.912) -- 0:06:22
      26000 -- (-5036.793) (-5041.238) (-5036.999) [-5040.067] * (-5039.455) [-5035.044] (-5036.172) (-5037.965) -- 0:06:14
      26500 -- (-5029.203) (-5032.354) [-5032.144] (-5042.390) * [-5034.771] (-5032.731) (-5034.696) (-5036.966) -- 0:06:44
      27000 -- [-5031.769] (-5030.245) (-5030.281) (-5046.833) * (-5042.950) (-5036.603) (-5042.036) [-5034.813] -- 0:06:36
      27500 -- [-5037.035] (-5030.555) (-5040.640) (-5034.140) * [-5041.037] (-5040.371) (-5035.084) (-5033.639) -- 0:06:29
      28000 -- (-5035.049) [-5032.581] (-5043.322) (-5034.019) * (-5043.510) [-5040.974] (-5039.422) (-5034.734) -- 0:06:21
      28500 -- (-5030.561) [-5036.988] (-5038.003) (-5036.726) * (-5032.648) (-5045.040) (-5029.240) [-5035.227] -- 0:06:14
      29000 -- (-5030.687) [-5029.977] (-5037.724) (-5036.228) * (-5048.408) (-5048.967) [-5034.505] (-5033.463) -- 0:06:41
      29500 -- (-5031.098) (-5033.109) [-5031.515] (-5030.420) * [-5035.607] (-5045.762) (-5034.536) (-5033.155) -- 0:06:34
      30000 -- (-5037.261) [-5035.244] (-5037.001) (-5031.940) * (-5035.620) (-5045.529) [-5033.834] (-5038.295) -- 0:06:28

      Average standard deviation of split frequencies: 0.030744

      30500 -- [-5036.350] (-5034.369) (-5037.739) (-5030.177) * [-5032.173] (-5045.831) (-5034.290) (-5035.683) -- 0:06:21
      31000 -- (-5036.213) [-5037.383] (-5036.138) (-5033.992) * (-5035.300) (-5039.156) [-5034.514] (-5035.265) -- 0:06:15
      31500 -- (-5031.452) [-5029.792] (-5041.835) (-5031.710) * (-5036.733) (-5039.453) [-5031.779] (-5037.315) -- 0:06:08
      32000 -- [-5029.342] (-5035.061) (-5032.899) (-5031.576) * (-5030.798) (-5033.563) [-5031.950] (-5037.495) -- 0:06:33
      32500 -- (-5035.951) [-5036.029] (-5033.898) (-5028.420) * (-5036.519) (-5039.477) (-5047.570) [-5031.049] -- 0:06:27
      33000 -- [-5035.545] (-5042.223) (-5034.814) (-5040.395) * (-5036.257) [-5032.812] (-5039.129) (-5032.377) -- 0:06:20
      33500 -- [-5032.712] (-5031.523) (-5039.778) (-5037.657) * (-5034.528) (-5041.208) (-5030.921) [-5031.312] -- 0:06:15
      34000 -- (-5044.389) (-5041.107) [-5034.036] (-5041.343) * (-5036.968) [-5040.237] (-5040.800) (-5028.915) -- 0:06:09
      34500 -- (-5038.494) [-5034.308] (-5038.102) (-5031.660) * [-5040.008] (-5037.409) (-5033.901) (-5036.843) -- 0:06:31
      35000 -- [-5038.124] (-5036.453) (-5035.410) (-5029.334) * [-5030.718] (-5043.023) (-5034.569) (-5039.045) -- 0:06:26

      Average standard deviation of split frequencies: 0.039284

      35500 -- (-5039.379) (-5038.134) (-5035.716) [-5035.358] * (-5031.652) [-5035.678] (-5039.105) (-5032.078) -- 0:06:20
      36000 -- (-5038.754) [-5040.378] (-5040.320) (-5032.548) * (-5036.699) (-5038.092) [-5030.669] (-5038.388) -- 0:06:14
      36500 -- [-5036.861] (-5033.046) (-5032.589) (-5035.814) * (-5029.304) (-5039.330) (-5031.912) [-5038.621] -- 0:06:09
      37000 -- (-5037.164) [-5031.466] (-5034.873) (-5035.609) * (-5034.691) (-5038.179) (-5031.997) [-5029.986] -- 0:06:30
      37500 -- (-5041.956) (-5041.716) (-5037.006) [-5035.567] * [-5032.911] (-5032.996) (-5034.123) (-5036.096) -- 0:06:25
      38000 -- (-5039.045) (-5033.980) (-5040.729) [-5036.342] * (-5041.460) (-5033.580) [-5035.538] (-5037.302) -- 0:06:19
      38500 -- (-5031.101) [-5038.946] (-5031.145) (-5033.547) * [-5032.435] (-5033.458) (-5033.062) (-5036.087) -- 0:06:14
      39000 -- (-5042.340) (-5044.764) [-5035.876] (-5035.290) * [-5039.502] (-5031.274) (-5037.422) (-5038.294) -- 0:06:09
      39500 -- (-5034.222) (-5035.342) [-5029.399] (-5036.687) * (-5035.572) [-5031.598] (-5031.531) (-5038.033) -- 0:06:29
      40000 -- (-5035.233) (-5041.606) (-5035.400) [-5032.558] * (-5035.408) [-5032.016] (-5036.728) (-5043.588) -- 0:06:24

      Average standard deviation of split frequencies: 0.027048

      40500 -- (-5028.660) (-5050.475) [-5034.459] (-5032.226) * (-5036.819) (-5035.375) (-5051.439) [-5036.563] -- 0:06:19
      41000 -- [-5034.775] (-5037.005) (-5036.398) (-5032.566) * [-5036.802] (-5036.493) (-5046.456) (-5030.821) -- 0:06:14
      41500 -- (-5034.166) (-5034.742) [-5035.958] (-5032.880) * [-5033.107] (-5033.126) (-5044.823) (-5034.605) -- 0:06:09
      42000 -- (-5036.180) (-5036.259) [-5030.625] (-5040.030) * (-5045.453) [-5033.304] (-5039.897) (-5031.904) -- 0:06:27
      42500 -- (-5035.642) [-5041.082] (-5041.776) (-5039.057) * [-5035.602] (-5039.049) (-5042.907) (-5032.725) -- 0:06:23
      43000 -- (-5038.259) [-5031.099] (-5031.914) (-5034.673) * (-5037.512) [-5039.176] (-5036.751) (-5042.285) -- 0:06:18
      43500 -- (-5031.632) (-5033.757) (-5030.210) [-5038.671] * (-5033.898) [-5038.821] (-5036.920) (-5044.011) -- 0:06:13
      44000 -- [-5033.672] (-5033.131) (-5039.605) (-5032.669) * (-5048.408) [-5038.820] (-5038.551) (-5036.550) -- 0:06:09
      44500 -- (-5035.843) (-5031.589) (-5034.990) [-5035.082] * [-5046.039] (-5035.333) (-5034.940) (-5032.413) -- 0:06:26
      45000 -- (-5028.886) (-5037.844) (-5034.891) [-5037.060] * (-5038.608) [-5032.461] (-5035.647) (-5040.634) -- 0:06:22

      Average standard deviation of split frequencies: 0.040992

      45500 -- (-5033.558) [-5038.098] (-5038.427) (-5039.649) * (-5039.948) (-5033.355) [-5036.348] (-5033.719) -- 0:06:17
      46000 -- (-5038.660) (-5042.767) (-5035.342) [-5033.651] * (-5042.490) (-5036.034) [-5035.638] (-5037.684) -- 0:06:13
      46500 -- [-5032.200] (-5040.570) (-5036.515) (-5037.357) * (-5038.153) (-5042.750) (-5041.762) [-5035.573] -- 0:06:09
      47000 -- (-5033.490) [-5040.666] (-5040.292) (-5037.823) * (-5042.134) [-5037.153] (-5038.530) (-5035.889) -- 0:06:04
      47500 -- (-5042.068) (-5039.365) [-5031.771] (-5035.019) * [-5038.981] (-5040.889) (-5037.869) (-5043.274) -- 0:06:21
      48000 -- (-5034.222) (-5030.985) [-5031.543] (-5038.312) * (-5034.029) (-5030.648) (-5031.762) [-5035.153] -- 0:06:16
      48500 -- (-5034.940) (-5028.731) [-5034.720] (-5036.669) * [-5034.825] (-5035.814) (-5034.225) (-5033.483) -- 0:06:12
      49000 -- (-5030.459) (-5041.783) [-5033.331] (-5034.045) * (-5034.251) (-5037.353) [-5032.606] (-5038.543) -- 0:06:08
      49500 -- [-5033.825] (-5058.008) (-5035.245) (-5032.586) * [-5033.917] (-5030.988) (-5041.462) (-5037.420) -- 0:06:04
      50000 -- (-5032.915) (-5049.709) [-5035.287] (-5029.453) * [-5036.128] (-5038.532) (-5045.827) (-5038.895) -- 0:06:20

      Average standard deviation of split frequencies: 0.032564

      50500 -- [-5034.731] (-5034.238) (-5039.535) (-5035.491) * (-5038.039) (-5035.923) [-5040.116] (-5036.982) -- 0:06:16
      51000 -- (-5033.583) (-5050.450) (-5038.971) [-5034.721] * (-5031.177) (-5033.599) (-5034.608) [-5034.860] -- 0:06:12
      51500 -- (-5036.498) [-5038.054] (-5032.737) (-5034.318) * (-5035.643) (-5030.628) [-5043.353] (-5033.286) -- 0:06:08
      52000 -- (-5037.435) (-5038.401) (-5037.159) [-5036.875] * (-5034.621) [-5032.152] (-5035.547) (-5033.028) -- 0:06:04
      52500 -- (-5036.005) (-5044.429) [-5030.676] (-5034.552) * (-5035.000) (-5040.672) [-5034.049] (-5038.709) -- 0:06:19
      53000 -- (-5037.378) [-5031.981] (-5034.988) (-5035.709) * (-5037.635) (-5039.718) (-5038.722) [-5036.243] -- 0:06:15
      53500 -- (-5037.017) (-5036.549) (-5035.815) [-5029.488] * (-5035.450) [-5036.876] (-5036.582) (-5029.543) -- 0:06:11
      54000 -- [-5031.588] (-5036.549) (-5044.580) (-5037.286) * (-5032.415) (-5038.951) [-5036.111] (-5037.604) -- 0:06:07
      54500 -- (-5038.921) (-5043.329) (-5041.632) [-5033.669] * (-5041.651) (-5040.586) (-5033.456) [-5034.744] -- 0:06:04
      55000 -- (-5037.711) (-5036.940) [-5037.478] (-5038.091) * (-5036.400) (-5044.414) (-5038.594) [-5033.245] -- 0:06:18

      Average standard deviation of split frequencies: 0.021045

      55500 -- (-5032.031) (-5036.838) [-5032.204] (-5035.567) * [-5038.844] (-5042.329) (-5036.783) (-5035.714) -- 0:06:14
      56000 -- (-5035.340) (-5041.507) [-5033.251] (-5039.548) * (-5033.978) (-5034.530) [-5031.573] (-5044.103) -- 0:06:10
      56500 -- (-5042.546) (-5038.309) (-5033.822) [-5033.313] * (-5038.579) [-5042.025] (-5031.040) (-5038.487) -- 0:06:07
      57000 -- (-5034.168) (-5033.743) [-5039.872] (-5035.195) * (-5035.503) (-5038.210) [-5034.592] (-5033.905) -- 0:06:03
      57500 -- (-5032.406) [-5032.520] (-5032.407) (-5039.857) * (-5036.853) [-5031.521] (-5031.407) (-5034.785) -- 0:06:17
      58000 -- (-5040.443) (-5037.617) [-5033.498] (-5032.683) * (-5038.103) (-5042.188) (-5038.181) [-5038.175] -- 0:06:13
      58500 -- [-5039.210] (-5041.024) (-5035.970) (-5037.868) * [-5048.750] (-5040.616) (-5035.647) (-5039.644) -- 0:06:10
      59000 -- [-5042.026] (-5034.209) (-5030.635) (-5032.467) * (-5033.479) (-5039.952) (-5034.026) [-5036.323] -- 0:06:06
      59500 -- (-5030.848) (-5039.335) [-5035.346] (-5034.795) * [-5033.962] (-5035.928) (-5041.704) (-5042.579) -- 0:06:03
      60000 -- [-5034.811] (-5040.234) (-5036.696) (-5036.578) * (-5034.909) (-5034.954) (-5036.273) [-5033.308] -- 0:06:16

      Average standard deviation of split frequencies: 0.010361

      60500 -- (-5043.834) (-5042.244) [-5032.442] (-5033.848) * (-5039.507) [-5035.059] (-5036.200) (-5044.453) -- 0:06:12
      61000 -- (-5035.234) [-5031.182] (-5039.855) (-5037.401) * (-5035.129) (-5049.413) [-5033.680] (-5038.925) -- 0:06:09
      61500 -- (-5032.683) (-5032.245) (-5048.008) [-5030.955] * (-5037.599) (-5032.081) [-5035.444] (-5037.267) -- 0:06:06
      62000 -- [-5035.172] (-5036.461) (-5040.309) (-5030.214) * (-5045.282) (-5035.667) [-5035.583] (-5038.344) -- 0:06:03
      62500 -- (-5037.697) (-5036.378) (-5040.898) [-5029.201] * (-5044.749) [-5035.797] (-5037.793) (-5037.042) -- 0:06:00
      63000 -- [-5032.592] (-5045.745) (-5031.558) (-5030.507) * (-5035.859) (-5042.482) [-5040.013] (-5033.946) -- 0:06:11
      63500 -- (-5031.974) (-5034.878) [-5034.687] (-5046.193) * (-5036.834) (-5037.754) [-5035.323] (-5031.333) -- 0:06:08
      64000 -- [-5041.558] (-5038.408) (-5033.427) (-5031.586) * (-5034.377) (-5037.189) (-5033.332) [-5036.466] -- 0:06:05
      64500 -- (-5042.473) (-5035.608) [-5039.047] (-5032.165) * (-5034.105) (-5038.660) [-5035.636] (-5037.191) -- 0:06:02
      65000 -- (-5040.112) (-5037.646) (-5036.594) [-5040.344] * (-5033.353) (-5043.688) (-5044.117) [-5032.953] -- 0:05:59

      Average standard deviation of split frequencies: 0.014285

      65500 -- [-5034.762] (-5033.843) (-5030.916) (-5032.288) * [-5031.141] (-5042.591) (-5036.517) (-5035.567) -- 0:06:10
      66000 -- (-5033.079) (-5034.829) [-5034.499] (-5034.833) * (-5036.720) [-5036.949] (-5037.926) (-5036.985) -- 0:06:07
      66500 -- (-5031.435) (-5036.416) (-5034.456) [-5031.612] * [-5035.002] (-5042.304) (-5035.286) (-5035.669) -- 0:06:04
      67000 -- (-5036.813) [-5036.808] (-5039.360) (-5041.727) * [-5033.480] (-5034.900) (-5034.829) (-5034.676) -- 0:06:02
      67500 -- [-5033.063] (-5039.902) (-5030.542) (-5039.773) * (-5034.074) (-5037.611) (-5030.406) [-5037.989] -- 0:05:59
      68000 -- [-5044.295] (-5038.298) (-5033.929) (-5035.034) * (-5033.107) (-5034.673) [-5038.397] (-5033.853) -- 0:06:10
      68500 -- (-5041.847) (-5052.738) [-5035.051] (-5040.233) * (-5043.203) [-5033.634] (-5039.619) (-5036.258) -- 0:06:07
      69000 -- [-5037.192] (-5039.389) (-5037.733) (-5044.847) * (-5039.262) [-5034.821] (-5045.362) (-5043.414) -- 0:06:04
      69500 -- (-5031.262) (-5038.484) (-5042.201) [-5032.519] * (-5038.654) (-5034.038) [-5042.026] (-5037.972) -- 0:06:01
      70000 -- (-5034.955) [-5038.209] (-5049.786) (-5031.019) * (-5038.367) [-5033.250] (-5040.896) (-5031.087) -- 0:06:12

      Average standard deviation of split frequencies: 0.006671

      70500 -- (-5036.446) (-5040.689) [-5038.497] (-5037.281) * (-5038.014) (-5036.981) (-5034.545) [-5033.199] -- 0:06:09
      71000 -- (-5035.584) (-5040.019) (-5035.546) [-5039.654] * [-5036.066] (-5039.746) (-5037.648) (-5033.014) -- 0:06:06
      71500 -- [-5035.355] (-5045.268) (-5040.661) (-5041.943) * (-5038.352) (-5040.541) (-5038.554) [-5034.509] -- 0:06:16
      72000 -- [-5034.108] (-5044.784) (-5037.899) (-5041.591) * (-5033.081) [-5037.618] (-5038.043) (-5036.033) -- 0:06:13
      72500 -- (-5033.499) [-5031.540] (-5034.294) (-5035.810) * (-5030.403) (-5036.673) [-5033.221] (-5046.362) -- 0:06:11
      73000 -- (-5040.194) (-5035.432) (-5043.139) [-5034.492] * (-5039.246) [-5035.713] (-5033.217) (-5035.419) -- 0:06:08
      73500 -- (-5039.416) (-5038.637) [-5032.835] (-5034.085) * [-5033.082] (-5037.970) (-5035.548) (-5036.069) -- 0:06:05
      74000 -- (-5039.214) [-5030.764] (-5037.368) (-5033.949) * (-5031.577) (-5043.267) [-5033.693] (-5046.175) -- 0:06:15
      74500 -- (-5043.893) (-5035.183) (-5032.667) [-5033.113] * (-5039.508) (-5039.070) (-5032.471) [-5034.052] -- 0:06:12
      75000 -- (-5038.283) (-5032.931) (-5034.298) [-5031.003] * (-5030.792) (-5039.897) (-5043.464) [-5029.892] -- 0:06:10

      Average standard deviation of split frequencies: 0.004135

      75500 -- [-5042.151] (-5028.324) (-5034.577) (-5034.169) * [-5030.794] (-5034.609) (-5043.011) (-5032.701) -- 0:06:07
      76000 -- (-5039.402) (-5039.630) [-5030.719] (-5033.561) * (-5043.287) [-5034.087] (-5033.977) (-5042.653) -- 0:06:04
      76500 -- (-5032.159) (-5035.373) [-5035.610] (-5031.469) * (-5036.149) (-5042.062) [-5031.777] (-5037.362) -- 0:06:14
      77000 -- (-5035.742) (-5035.311) [-5030.403] (-5038.224) * (-5035.760) [-5038.193] (-5043.289) (-5036.518) -- 0:06:11
      77500 -- (-5037.561) (-5035.425) (-5032.507) [-5039.199] * [-5038.963] (-5037.683) (-5034.214) (-5038.481) -- 0:06:09
      78000 -- (-5046.511) [-5033.126] (-5031.868) (-5041.715) * [-5033.998] (-5030.035) (-5041.596) (-5041.751) -- 0:06:06
      78500 -- (-5037.808) (-5033.791) [-5039.227] (-5042.116) * (-5036.446) (-5035.245) [-5040.492] (-5048.195) -- 0:06:03
      79000 -- (-5038.117) (-5041.014) (-5039.719) [-5043.777] * [-5032.688] (-5037.171) (-5033.684) (-5046.726) -- 0:06:13
      79500 -- (-5034.768) (-5037.704) [-5031.532] (-5046.109) * (-5039.501) (-5030.553) [-5042.784] (-5034.843) -- 0:06:10
      80000 -- (-5031.821) (-5038.874) [-5036.635] (-5046.163) * (-5037.331) (-5029.554) (-5039.869) [-5034.989] -- 0:06:08

      Average standard deviation of split frequencies: 0.003896

      80500 -- (-5035.811) (-5039.485) [-5033.708] (-5045.812) * (-5036.600) (-5036.300) (-5035.774) [-5030.971] -- 0:06:05
      81000 -- (-5029.747) (-5042.004) [-5032.399] (-5035.544) * (-5026.934) [-5031.931] (-5036.853) (-5035.776) -- 0:06:03
      81500 -- (-5033.629) [-5038.729] (-5038.667) (-5033.043) * [-5036.930] (-5037.001) (-5039.234) (-5040.522) -- 0:06:11
      82000 -- (-5034.274) (-5041.420) (-5035.797) [-5033.981] * [-5036.681] (-5039.525) (-5037.981) (-5038.743) -- 0:06:09
      82500 -- (-5037.181) (-5040.146) (-5037.918) [-5037.966] * (-5042.071) (-5043.078) (-5031.837) [-5048.899] -- 0:06:07
      83000 -- (-5038.025) (-5043.834) [-5035.232] (-5036.575) * [-5036.333] (-5044.241) (-5031.951) (-5037.376) -- 0:06:04
      83500 -- (-5036.736) (-5038.031) (-5039.355) [-5034.835] * [-5036.762] (-5054.911) (-5035.893) (-5037.684) -- 0:06:02
      84000 -- [-5036.910] (-5037.105) (-5037.432) (-5032.716) * (-5043.451) (-5041.278) (-5042.826) [-5033.326] -- 0:05:59
      84500 -- (-5035.681) (-5035.418) [-5035.841] (-5038.197) * [-5038.670] (-5033.276) (-5048.927) (-5038.616) -- 0:06:08
      85000 -- [-5034.640] (-5033.934) (-5029.884) (-5036.141) * (-5030.149) (-5030.538) [-5030.902] (-5036.855) -- 0:06:06

      Average standard deviation of split frequencies: 0.012790

      85500 -- (-5036.838) (-5029.439) [-5033.291] (-5034.796) * (-5028.124) [-5038.068] (-5032.134) (-5040.288) -- 0:06:03
      86000 -- [-5036.095] (-5039.056) (-5033.378) (-5039.742) * [-5033.390] (-5033.354) (-5038.549) (-5040.020) -- 0:06:01
      86500 -- [-5038.123] (-5042.343) (-5038.344) (-5032.703) * [-5039.674] (-5034.714) (-5036.259) (-5032.455) -- 0:05:59
      87000 -- (-5032.347) (-5035.531) [-5032.666] (-5036.294) * [-5040.747] (-5038.277) (-5032.971) (-5037.028) -- 0:06:07
      87500 -- [-5033.972] (-5037.545) (-5042.546) (-5044.440) * (-5048.437) [-5035.549] (-5033.015) (-5035.651) -- 0:06:05
      88000 -- (-5037.972) (-5038.203) [-5035.568] (-5038.394) * (-5037.995) (-5039.863) (-5033.774) [-5036.575] -- 0:06:02
      88500 -- (-5036.151) (-5036.826) (-5034.309) [-5036.780] * [-5032.386] (-5042.270) (-5038.539) (-5037.605) -- 0:06:00
      89000 -- (-5039.955) (-5044.733) [-5035.832] (-5036.589) * (-5039.419) (-5042.041) (-5045.881) [-5033.156] -- 0:05:58
      89500 -- (-5033.628) [-5034.398] (-5038.198) (-5038.902) * [-5039.148] (-5030.907) (-5039.791) (-5033.923) -- 0:06:06
      90000 -- [-5033.624] (-5039.964) (-5036.379) (-5034.795) * (-5031.937) [-5031.743] (-5037.654) (-5037.181) -- 0:06:04

      Average standard deviation of split frequencies: 0.022530

      90500 -- [-5039.131] (-5036.891) (-5041.565) (-5034.979) * (-5030.165) (-5029.850) [-5035.524] (-5034.244) -- 0:06:01
      91000 -- (-5041.516) (-5031.796) (-5042.084) [-5038.380] * (-5030.718) (-5032.549) [-5030.447] (-5036.358) -- 0:05:59
      91500 -- (-5042.260) [-5040.146] (-5033.050) (-5037.699) * [-5031.966] (-5036.426) (-5035.480) (-5034.285) -- 0:05:57
      92000 -- [-5036.806] (-5035.199) (-5039.111) (-5033.108) * (-5036.472) (-5033.233) [-5045.402] (-5039.416) -- 0:06:05
      92500 -- [-5039.887] (-5036.397) (-5035.420) (-5035.853) * (-5035.608) [-5033.259] (-5038.579) (-5032.769) -- 0:06:03
      93000 -- (-5041.639) (-5032.878) (-5043.799) [-5037.832] * (-5034.924) [-5035.961] (-5040.384) (-5032.802) -- 0:06:00
      93500 -- [-5031.358] (-5035.928) (-5035.735) (-5035.953) * (-5036.021) (-5032.189) (-5039.524) [-5043.067] -- 0:05:58
      94000 -- (-5031.650) (-5039.793) [-5033.105] (-5041.434) * [-5031.045] (-5033.470) (-5044.541) (-5042.778) -- 0:05:56
      94500 -- (-5035.080) (-5038.025) [-5041.733] (-5038.314) * (-5034.722) (-5037.232) [-5037.260] (-5037.947) -- 0:06:04
      95000 -- [-5037.973] (-5035.126) (-5031.406) (-5041.755) * [-5037.452] (-5038.066) (-5038.914) (-5037.142) -- 0:06:02

      Average standard deviation of split frequencies: 0.032736

      95500 -- (-5034.152) [-5036.664] (-5034.053) (-5039.636) * (-5040.284) (-5036.256) (-5037.659) [-5034.002] -- 0:05:59
      96000 -- (-5042.884) [-5034.781] (-5037.578) (-5036.487) * (-5035.871) (-5038.535) [-5029.315] (-5039.944) -- 0:05:57
      96500 -- (-5042.280) (-5036.319) (-5040.416) [-5035.592] * [-5039.775] (-5039.174) (-5029.918) (-5033.943) -- 0:05:55
      97000 -- [-5036.579] (-5032.693) (-5039.690) (-5035.157) * (-5033.868) (-5042.175) (-5035.574) [-5036.973] -- 0:06:03
      97500 -- [-5030.839] (-5037.299) (-5043.662) (-5031.790) * (-5041.058) (-5035.622) (-5040.114) [-5038.334] -- 0:06:01
      98000 -- (-5032.185) (-5027.793) (-5033.549) [-5035.982] * (-5035.018) (-5038.771) (-5037.747) [-5037.936] -- 0:05:58
      98500 -- (-5031.572) [-5027.081] (-5030.944) (-5042.080) * (-5035.154) (-5038.300) [-5033.899] (-5039.485) -- 0:05:56
      99000 -- (-5038.974) (-5038.872) [-5032.136] (-5041.909) * (-5036.957) (-5034.826) (-5031.001) [-5035.657] -- 0:05:54
      99500 -- [-5037.334] (-5039.919) (-5029.696) (-5035.545) * (-5048.148) (-5035.002) [-5033.413] (-5031.289) -- 0:05:52
      100000 -- (-5039.739) (-5039.953) (-5034.385) [-5037.795] * (-5042.049) (-5035.884) [-5031.722] (-5034.947) -- 0:06:00

      Average standard deviation of split frequencies: 0.017170

      100500 -- (-5040.223) (-5036.511) [-5035.564] (-5032.676) * (-5041.266) [-5041.914] (-5035.932) (-5037.941) -- 0:05:58
      101000 -- (-5040.852) (-5035.727) (-5051.749) [-5031.402] * [-5038.752] (-5039.163) (-5036.707) (-5032.296) -- 0:05:56
      101500 -- (-5045.937) [-5034.606] (-5034.616) (-5037.544) * (-5033.475) (-5044.445) (-5038.731) [-5036.158] -- 0:05:54
      102000 -- (-5043.258) (-5038.268) [-5030.991] (-5033.694) * (-5041.541) (-5042.929) (-5031.207) [-5033.115] -- 0:05:52
      102500 -- (-5032.080) [-5036.896] (-5035.558) (-5040.610) * [-5044.825] (-5037.149) (-5037.193) (-5038.432) -- 0:05:59
      103000 -- (-5034.693) [-5034.734] (-5038.142) (-5035.158) * (-5042.714) [-5036.056] (-5044.873) (-5037.402) -- 0:05:57
      103500 -- (-5034.525) [-5042.764] (-5037.884) (-5038.064) * (-5035.803) (-5038.437) (-5035.814) [-5035.039] -- 0:05:55
      104000 -- (-5034.729) (-5035.373) [-5034.178] (-5039.106) * [-5038.904] (-5042.042) (-5037.333) (-5033.402) -- 0:05:53
      104500 -- (-5034.789) (-5034.126) (-5039.466) [-5037.006] * (-5041.907) (-5039.036) [-5034.279] (-5032.530) -- 0:05:51
      105000 -- [-5038.903] (-5033.560) (-5034.911) (-5039.161) * (-5037.720) (-5035.529) (-5037.639) [-5043.188] -- 0:05:58

      Average standard deviation of split frequencies: 0.022236

      105500 -- (-5040.564) [-5042.069] (-5030.501) (-5037.598) * (-5036.822) (-5035.412) (-5036.351) [-5033.395] -- 0:05:56
      106000 -- (-5042.985) (-5040.570) (-5040.809) [-5037.335] * (-5032.447) (-5030.309) (-5037.005) [-5029.941] -- 0:05:54
      106500 -- (-5045.555) (-5040.654) [-5032.183] (-5031.811) * (-5030.921) (-5037.515) [-5035.913] (-5033.482) -- 0:05:52
      107000 -- (-5040.512) (-5041.848) [-5034.154] (-5032.184) * (-5033.378) (-5037.361) [-5032.268] (-5033.669) -- 0:05:50
      107500 -- (-5046.943) (-5031.928) [-5042.232] (-5033.809) * (-5027.188) [-5032.890] (-5046.644) (-5031.547) -- 0:05:57
      108000 -- (-5040.752) [-5040.809] (-5051.004) (-5036.816) * [-5033.996] (-5036.602) (-5041.273) (-5033.207) -- 0:05:55
      108500 -- [-5037.946] (-5038.829) (-5042.785) (-5034.208) * [-5035.013] (-5035.689) (-5042.923) (-5039.814) -- 0:05:53
      109000 -- [-5037.281] (-5036.789) (-5034.081) (-5035.954) * (-5034.214) (-5040.305) [-5045.892] (-5034.171) -- 0:05:51
      109500 -- [-5044.372] (-5032.912) (-5035.764) (-5034.997) * (-5037.738) (-5033.873) [-5038.430] (-5038.780) -- 0:05:49
      110000 -- (-5034.212) (-5037.567) [-5036.932] (-5033.298) * (-5038.970) [-5034.130] (-5033.547) (-5040.261) -- 0:05:56

      Average standard deviation of split frequencies: 0.026978

      110500 -- [-5032.429] (-5038.943) (-5031.505) (-5036.615) * (-5031.382) (-5043.822) [-5034.808] (-5042.425) -- 0:05:54
      111000 -- [-5029.588] (-5043.205) (-5032.681) (-5038.176) * (-5032.090) (-5032.656) [-5038.115] (-5038.211) -- 0:05:52
      111500 -- (-5032.080) (-5034.649) (-5038.612) [-5032.100] * (-5038.410) [-5031.880] (-5039.863) (-5044.749) -- 0:05:50
      112000 -- (-5039.516) (-5032.811) (-5034.241) [-5038.561] * (-5036.691) (-5037.243) (-5032.700) [-5042.996] -- 0:05:48
      112500 -- [-5040.929] (-5030.180) (-5038.767) (-5031.793) * (-5042.130) [-5042.770] (-5029.919) (-5031.750) -- 0:05:55
      113000 -- (-5043.088) (-5034.820) [-5042.461] (-5032.692) * (-5035.512) (-5033.195) (-5034.453) [-5036.379] -- 0:05:53
      113500 -- (-5035.532) [-5037.658] (-5043.659) (-5034.923) * [-5029.774] (-5036.417) (-5031.668) (-5042.170) -- 0:05:51
      114000 -- (-5038.087) (-5039.030) [-5035.710] (-5035.555) * (-5030.628) (-5034.802) [-5038.883] (-5036.266) -- 0:05:49
      114500 -- (-5035.889) (-5037.068) (-5034.726) [-5033.546] * [-5031.526] (-5038.549) (-5032.019) (-5038.910) -- 0:05:48
      115000 -- (-5046.378) (-5034.994) [-5037.977] (-5035.503) * (-5041.677) [-5037.625] (-5034.146) (-5034.955) -- 0:05:54

      Average standard deviation of split frequencies: 0.036574

      115500 -- (-5042.222) (-5032.233) (-5037.601) [-5033.521] * (-5035.423) [-5034.586] (-5033.730) (-5033.082) -- 0:05:52
      116000 -- (-5036.267) (-5034.209) (-5037.870) [-5032.715] * [-5035.496] (-5032.188) (-5030.906) (-5035.756) -- 0:05:50
      116500 -- (-5041.029) (-5030.619) [-5038.539] (-5032.708) * [-5033.850] (-5032.478) (-5035.473) (-5034.394) -- 0:05:48
      117000 -- (-5038.520) (-5041.167) (-5040.655) [-5033.732] * (-5034.328) [-5034.627] (-5041.132) (-5037.319) -- 0:05:47
      117500 -- [-5033.052] (-5036.787) (-5038.772) (-5031.430) * (-5036.160) (-5038.534) (-5035.295) [-5036.252] -- 0:05:53
      118000 -- (-5032.490) (-5038.992) [-5036.893] (-5040.857) * (-5042.231) (-5038.631) (-5035.138) [-5034.749] -- 0:05:51
      118500 -- [-5033.391] (-5036.956) (-5036.776) (-5033.911) * (-5036.862) (-5034.595) [-5031.613] (-5033.932) -- 0:05:49
      119000 -- (-5035.066) (-5033.078) [-5030.978] (-5037.869) * [-5033.426] (-5033.928) (-5033.246) (-5040.672) -- 0:05:47
      119500 -- (-5039.052) (-5029.345) (-5036.357) [-5034.916] * (-5029.713) (-5035.287) [-5034.283] (-5035.892) -- 0:05:46
      120000 -- [-5035.066] (-5033.239) (-5035.671) (-5038.554) * (-5046.630) [-5033.221] (-5033.614) (-5034.014) -- 0:05:44

      Average standard deviation of split frequencies: 0.032556

      120500 -- [-5033.767] (-5037.757) (-5033.385) (-5035.612) * (-5045.890) [-5036.187] (-5034.566) (-5033.336) -- 0:05:50
      121000 -- (-5028.879) (-5035.230) (-5043.371) [-5036.962] * (-5038.973) (-5045.370) (-5041.988) [-5031.441] -- 0:05:48
      121500 -- [-5032.405] (-5038.211) (-5039.666) (-5035.395) * (-5041.639) [-5040.683] (-5038.597) (-5033.273) -- 0:05:47
      122000 -- (-5038.448) [-5035.941] (-5039.346) (-5042.219) * (-5038.727) (-5037.243) [-5034.519] (-5029.270) -- 0:05:45
      122500 -- (-5045.353) (-5038.236) (-5035.221) [-5036.002] * (-5032.295) (-5033.899) [-5036.838] (-5032.534) -- 0:05:43
      123000 -- (-5040.453) (-5038.761) [-5033.560] (-5036.317) * (-5032.234) (-5036.064) [-5035.447] (-5034.914) -- 0:05:49
      123500 -- (-5033.518) (-5037.078) (-5035.827) [-5035.542] * (-5034.988) (-5037.836) [-5034.864] (-5035.081) -- 0:05:47
      124000 -- (-5036.833) (-5030.418) [-5036.682] (-5034.319) * (-5033.121) (-5038.663) [-5038.803] (-5031.644) -- 0:05:46
      124500 -- (-5041.467) (-5035.409) (-5040.476) [-5032.753] * [-5032.816] (-5033.959) (-5036.302) (-5036.842) -- 0:05:44
      125000 -- [-5042.239] (-5034.570) (-5037.024) (-5040.249) * [-5040.531] (-5040.857) (-5030.669) (-5047.932) -- 0:05:43

      Average standard deviation of split frequencies: 0.036166

      125500 -- (-5035.209) [-5035.683] (-5044.707) (-5045.940) * (-5040.159) (-5031.295) [-5032.330] (-5039.301) -- 0:05:48
      126000 -- (-5035.595) [-5035.013] (-5038.324) (-5046.109) * (-5044.083) [-5034.998] (-5038.626) (-5037.228) -- 0:05:46
      126500 -- (-5042.297) [-5029.546] (-5034.340) (-5045.690) * [-5037.708] (-5040.211) (-5037.187) (-5038.296) -- 0:05:45
      127000 -- (-5035.848) (-5031.572) [-5036.552] (-5036.970) * [-5039.079] (-5034.229) (-5041.084) (-5033.331) -- 0:05:43
      127500 -- (-5037.603) [-5034.974] (-5038.526) (-5036.644) * (-5037.671) [-5036.708] (-5042.196) (-5034.182) -- 0:05:42
      128000 -- (-5037.733) (-5036.687) (-5031.303) [-5037.192] * [-5037.720] (-5041.573) (-5035.626) (-5030.972) -- 0:05:47
      128500 -- (-5031.837) [-5034.596] (-5031.190) (-5036.002) * (-5035.473) (-5035.721) (-5039.214) [-5034.664] -- 0:05:45
      129000 -- (-5034.808) [-5034.662] (-5036.787) (-5040.144) * [-5031.173] (-5029.149) (-5036.477) (-5040.277) -- 0:05:44
      129500 -- [-5036.926] (-5038.859) (-5036.940) (-5038.037) * (-5032.676) (-5028.133) [-5037.317] (-5036.768) -- 0:05:42
      130000 -- (-5038.827) (-5034.621) (-5034.773) [-5035.891] * (-5038.053) (-5030.742) [-5037.641] (-5041.978) -- 0:05:41

      Average standard deviation of split frequencies: 0.037279

      130500 -- (-5035.467) (-5037.407) (-5042.453) [-5033.739] * (-5041.398) [-5035.870] (-5032.992) (-5032.514) -- 0:05:46
      131000 -- (-5035.252) [-5033.805] (-5032.318) (-5042.983) * (-5041.536) (-5037.856) [-5031.293] (-5038.808) -- 0:05:44
      131500 -- [-5035.612] (-5033.706) (-5032.710) (-5046.475) * (-5032.977) (-5038.550) (-5035.384) [-5032.275] -- 0:05:43
      132000 -- [-5035.475] (-5030.863) (-5034.101) (-5040.301) * (-5033.567) (-5043.249) [-5031.946] (-5033.203) -- 0:05:41
      132500 -- [-5035.579] (-5046.794) (-5036.368) (-5034.236) * [-5037.019] (-5040.845) (-5037.086) (-5036.122) -- 0:05:40
      133000 -- (-5037.175) (-5033.429) (-5035.780) [-5035.910] * [-5037.254] (-5034.907) (-5042.148) (-5031.217) -- 0:05:38
      133500 -- (-5033.810) (-5035.322) [-5033.401] (-5036.879) * (-5034.961) [-5033.421] (-5034.947) (-5035.376) -- 0:05:44
      134000 -- (-5038.267) [-5036.380] (-5032.894) (-5038.913) * (-5038.594) (-5039.422) (-5039.207) [-5038.172] -- 0:05:42
      134500 -- (-5034.899) (-5035.051) (-5040.503) [-5037.655] * (-5038.261) (-5033.451) (-5037.254) [-5032.299] -- 0:05:41
      135000 -- [-5031.455] (-5035.060) (-5044.219) (-5030.410) * (-5036.089) (-5039.090) (-5041.119) [-5035.806] -- 0:05:39

      Average standard deviation of split frequencies: 0.039861

      135500 -- (-5035.302) (-5034.138) (-5042.916) [-5034.368] * (-5040.711) (-5042.148) (-5039.413) [-5039.329] -- 0:05:38
      136000 -- (-5037.359) (-5030.133) (-5039.285) [-5032.831] * (-5032.896) [-5036.986] (-5035.770) (-5036.922) -- 0:05:43
      136500 -- (-5032.449) (-5045.131) (-5030.401) [-5031.775] * (-5039.888) (-5034.822) [-5041.258] (-5035.585) -- 0:05:41
      137000 -- (-5036.457) [-5036.318] (-5038.883) (-5039.234) * (-5038.618) [-5030.129] (-5040.542) (-5030.923) -- 0:05:40
      137500 -- (-5036.323) [-5036.369] (-5037.715) (-5035.999) * [-5036.829] (-5034.156) (-5038.602) (-5035.572) -- 0:05:38
      138000 -- (-5039.826) (-5040.102) (-5035.870) [-5049.950] * [-5036.597] (-5032.931) (-5037.627) (-5034.305) -- 0:05:37
      138500 -- (-5036.020) (-5032.390) (-5037.047) [-5035.316] * [-5042.409] (-5034.032) (-5034.597) (-5033.924) -- 0:05:42
      139000 -- [-5035.009] (-5041.358) (-5033.956) (-5035.947) * (-5038.801) [-5034.172] (-5048.707) (-5038.121) -- 0:05:40
      139500 -- [-5035.321] (-5035.598) (-5038.620) (-5040.775) * (-5032.782) (-5034.494) [-5035.420] (-5038.972) -- 0:05:39
      140000 -- [-5035.552] (-5035.171) (-5037.406) (-5038.226) * [-5035.478] (-5041.251) (-5035.933) (-5053.875) -- 0:05:37

      Average standard deviation of split frequencies: 0.045241

      140500 -- (-5037.094) (-5033.861) [-5033.804] (-5035.979) * (-5038.314) (-5040.205) [-5032.718] (-5040.641) -- 0:05:36
      141000 -- (-5040.060) (-5037.089) (-5036.238) [-5034.377] * (-5040.242) (-5035.336) (-5030.302) [-5028.601] -- 0:05:41
      141500 -- [-5036.972] (-5037.013) (-5039.162) (-5035.262) * (-5031.348) (-5039.648) [-5041.380] (-5029.912) -- 0:05:39
      142000 -- [-5036.971] (-5034.745) (-5030.053) (-5034.213) * (-5032.853) (-5035.635) [-5033.846] (-5034.429) -- 0:05:38
      142500 -- [-5032.131] (-5035.692) (-5038.808) (-5038.914) * (-5045.240) [-5037.499] (-5035.656) (-5033.033) -- 0:05:36
      143000 -- (-5035.128) (-5037.640) [-5032.736] (-5040.990) * [-5031.575] (-5038.315) (-5038.913) (-5032.995) -- 0:05:35
      143500 -- (-5034.112) [-5038.744] (-5040.921) (-5034.481) * [-5032.024] (-5035.971) (-5037.412) (-5036.213) -- 0:05:40
      144000 -- (-5042.882) (-5040.325) [-5034.937] (-5040.895) * (-5034.104) [-5041.208] (-5046.945) (-5042.854) -- 0:05:38
      144500 -- (-5040.975) (-5037.229) [-5036.389] (-5031.588) * [-5032.274] (-5036.177) (-5036.555) (-5033.369) -- 0:05:37
      145000 -- (-5038.359) (-5033.418) [-5037.676] (-5034.660) * [-5038.192] (-5038.184) (-5040.821) (-5037.936) -- 0:05:36

      Average standard deviation of split frequencies: 0.041974

      145500 -- (-5037.199) (-5034.239) (-5032.345) [-5039.728] * (-5033.966) (-5039.292) [-5043.577] (-5038.034) -- 0:05:34
      146000 -- (-5037.430) (-5033.003) [-5036.660] (-5039.826) * [-5032.663] (-5035.460) (-5043.537) (-5035.873) -- 0:05:39
      146500 -- (-5039.985) (-5037.770) [-5034.768] (-5033.507) * (-5036.977) (-5033.409) [-5039.279] (-5035.808) -- 0:05:37
      147000 -- (-5031.930) (-5031.964) [-5031.611] (-5036.232) * (-5042.679) (-5036.306) [-5035.490] (-5034.223) -- 0:05:36
      147500 -- (-5040.765) (-5039.109) [-5037.660] (-5034.050) * (-5039.625) [-5034.922] (-5032.525) (-5046.017) -- 0:05:35
      148000 -- [-5042.029] (-5030.062) (-5039.482) (-5030.455) * (-5038.458) (-5035.832) [-5029.106] (-5038.260) -- 0:05:33
      148500 -- (-5041.723) (-5032.756) [-5030.966] (-5034.045) * [-5035.274] (-5038.119) (-5040.451) (-5035.366) -- 0:05:38
      149000 -- (-5039.430) [-5035.367] (-5032.498) (-5035.965) * (-5042.469) [-5038.881] (-5043.422) (-5040.530) -- 0:05:36
      149500 -- (-5037.018) (-5030.027) (-5035.507) [-5028.127] * (-5029.546) (-5036.255) (-5037.575) [-5043.693] -- 0:05:35
      150000 -- (-5039.781) (-5034.492) [-5038.733] (-5034.264) * [-5035.319] (-5038.101) (-5038.174) (-5040.248) -- 0:05:34

      Average standard deviation of split frequencies: 0.039110

      150500 -- (-5039.883) [-5036.887] (-5034.957) (-5032.879) * (-5040.929) (-5044.719) [-5031.690] (-5041.893) -- 0:05:33
      151000 -- (-5040.429) [-5036.035] (-5030.371) (-5035.824) * (-5033.207) [-5038.510] (-5036.097) (-5038.995) -- 0:05:31
      151500 -- [-5040.662] (-5033.989) (-5038.041) (-5039.279) * (-5031.383) [-5033.693] (-5034.188) (-5031.640) -- 0:05:36
      152000 -- (-5042.350) (-5032.891) [-5037.142] (-5036.673) * (-5031.880) [-5037.352] (-5035.280) (-5036.468) -- 0:05:34
      152500 -- (-5039.271) [-5038.886] (-5038.552) (-5032.788) * [-5030.973] (-5035.419) (-5031.732) (-5030.965) -- 0:05:33
      153000 -- [-5034.276] (-5031.594) (-5042.715) (-5033.180) * (-5034.788) (-5037.493) [-5038.139] (-5040.989) -- 0:05:32
      153500 -- (-5038.637) (-5034.256) [-5038.583] (-5037.088) * [-5032.263] (-5043.795) (-5043.802) (-5035.967) -- 0:05:30
      154000 -- (-5031.744) [-5035.828] (-5035.414) (-5033.890) * [-5031.692] (-5044.618) (-5039.158) (-5037.709) -- 0:05:35
      154500 -- [-5033.361] (-5037.260) (-5028.307) (-5035.902) * (-5032.477) [-5037.050] (-5040.004) (-5047.974) -- 0:05:33
      155000 -- (-5037.313) (-5035.898) [-5035.488] (-5036.435) * (-5037.409) [-5039.582] (-5040.415) (-5035.349) -- 0:05:32

      Average standard deviation of split frequencies: 0.037773

      155500 -- (-5033.174) (-5036.558) [-5030.105] (-5033.083) * [-5039.257] (-5039.240) (-5033.793) (-5037.787) -- 0:05:31
      156000 -- (-5035.660) (-5035.972) [-5037.876] (-5032.232) * (-5034.300) (-5040.134) [-5032.275] (-5033.759) -- 0:05:30
      156500 -- [-5037.821] (-5032.364) (-5036.765) (-5032.444) * [-5035.227] (-5039.911) (-5034.478) (-5043.177) -- 0:05:34
      157000 -- (-5035.260) (-5035.766) (-5034.561) [-5040.807] * (-5039.944) (-5043.333) [-5035.200] (-5029.711) -- 0:05:32
      157500 -- [-5032.430] (-5038.132) (-5038.076) (-5038.185) * (-5035.726) (-5038.025) [-5028.833] (-5036.502) -- 0:05:31
      158000 -- (-5038.817) (-5039.618) [-5045.115] (-5035.350) * (-5035.400) [-5037.176] (-5031.427) (-5034.533) -- 0:05:30
      158500 -- (-5036.973) [-5039.217] (-5039.377) (-5033.264) * (-5045.511) (-5036.259) [-5032.736] (-5032.922) -- 0:05:29
      159000 -- (-5028.200) (-5043.948) (-5042.966) [-5036.101] * (-5035.707) [-5034.911] (-5032.747) (-5030.693) -- 0:05:33
      159500 -- (-5036.351) (-5041.596) (-5037.429) [-5044.752] * (-5038.547) (-5034.086) [-5032.650] (-5037.678) -- 0:05:31
      160000 -- (-5047.197) (-5039.792) (-5041.827) [-5037.327] * (-5038.791) (-5038.802) (-5029.629) [-5035.170] -- 0:05:30

      Average standard deviation of split frequencies: 0.036676

      160500 -- (-5044.395) (-5037.076) [-5033.440] (-5036.412) * (-5038.857) (-5035.978) (-5041.761) [-5030.044] -- 0:05:29
      161000 -- (-5043.960) (-5032.663) (-5033.349) [-5029.510] * (-5038.432) (-5041.828) (-5043.310) [-5034.443] -- 0:05:33
      161500 -- (-5038.316) (-5053.616) [-5035.446] (-5032.889) * (-5040.291) [-5036.643] (-5033.010) (-5034.982) -- 0:05:32
      162000 -- (-5036.135) [-5044.493] (-5040.289) (-5038.392) * (-5028.425) (-5031.386) (-5035.430) [-5033.609] -- 0:05:31
      162500 -- (-5034.171) [-5036.550] (-5037.345) (-5045.598) * (-5042.872) (-5037.461) [-5034.190] (-5041.759) -- 0:05:29
      163000 -- [-5030.787] (-5037.471) (-5042.021) (-5040.401) * [-5037.609] (-5041.016) (-5032.037) (-5036.798) -- 0:05:28
      163500 -- (-5038.408) (-5040.022) [-5040.876] (-5040.718) * [-5032.106] (-5034.005) (-5038.046) (-5039.577) -- 0:05:32
      164000 -- (-5039.420) (-5037.751) [-5043.731] (-5039.643) * [-5038.955] (-5033.359) (-5036.332) (-5035.987) -- 0:05:31
      164500 -- (-5040.179) (-5034.222) [-5036.002] (-5035.395) * [-5038.312] (-5034.242) (-5036.322) (-5036.817) -- 0:05:30
      165000 -- (-5041.149) [-5032.213] (-5044.200) (-5034.874) * (-5035.384) (-5041.324) (-5032.418) [-5030.692] -- 0:05:28

      Average standard deviation of split frequencies: 0.034077

      165500 -- (-5039.857) (-5030.071) (-5040.615) [-5040.370] * (-5040.678) (-5039.263) (-5035.686) [-5032.369] -- 0:05:27
      166000 -- (-5038.467) [-5028.943] (-5038.421) (-5046.443) * [-5038.161] (-5033.461) (-5029.595) (-5035.605) -- 0:05:31
      166500 -- (-5030.496) [-5031.785] (-5039.871) (-5042.956) * [-5035.958] (-5037.886) (-5039.960) (-5031.546) -- 0:05:30
      167000 -- [-5030.763] (-5037.304) (-5043.588) (-5043.449) * (-5035.265) (-5031.450) (-5036.494) [-5034.764] -- 0:05:29
      167500 -- (-5033.795) (-5040.122) (-5049.980) [-5041.884] * (-5030.087) (-5038.358) [-5036.579] (-5038.662) -- 0:05:28
      168000 -- (-5040.120) [-5030.184] (-5041.950) (-5035.732) * (-5030.611) (-5036.583) [-5038.400] (-5044.940) -- 0:05:26
      168500 -- (-5035.491) (-5035.419) (-5039.283) [-5029.849] * (-5033.970) (-5031.127) (-5034.269) [-5041.309] -- 0:05:30
      169000 -- (-5035.041) (-5032.558) (-5034.890) [-5037.839] * [-5034.709] (-5033.842) (-5042.909) (-5037.873) -- 0:05:29
      169500 -- (-5043.690) (-5037.474) (-5032.715) [-5039.288] * (-5040.150) (-5036.024) [-5033.628] (-5039.525) -- 0:05:28
      170000 -- [-5034.641] (-5035.007) (-5039.244) (-5038.004) * [-5035.680] (-5040.348) (-5033.663) (-5034.356) -- 0:05:27

      Average standard deviation of split frequencies: 0.037289

      170500 -- [-5032.319] (-5033.113) (-5040.839) (-5033.501) * (-5031.443) [-5036.873] (-5040.370) (-5037.979) -- 0:05:25
      171000 -- [-5040.467] (-5033.737) (-5046.916) (-5041.454) * (-5044.998) (-5033.725) [-5036.670] (-5031.753) -- 0:05:29
      171500 -- (-5035.573) (-5041.835) (-5041.177) [-5034.231] * (-5037.786) (-5033.807) (-5042.597) [-5035.679] -- 0:05:28
      172000 -- [-5033.816] (-5042.767) (-5035.535) (-5044.815) * [-5032.082] (-5035.336) (-5043.761) (-5032.324) -- 0:05:27
      172500 -- [-5034.200] (-5041.260) (-5037.080) (-5041.139) * [-5038.798] (-5037.256) (-5032.609) (-5035.601) -- 0:05:26
      173000 -- [-5029.332] (-5036.832) (-5037.376) (-5033.918) * (-5033.357) (-5031.061) [-5035.976] (-5033.256) -- 0:05:25
      173500 -- (-5033.987) (-5039.220) (-5033.871) [-5032.149] * [-5035.440] (-5028.727) (-5035.465) (-5040.403) -- 0:05:28
      174000 -- (-5035.851) (-5034.385) [-5034.728] (-5035.936) * (-5030.883) [-5029.387] (-5029.288) (-5041.068) -- 0:05:27
      174500 -- (-5042.205) (-5037.722) [-5035.724] (-5033.284) * (-5033.972) (-5039.454) [-5038.130] (-5034.837) -- 0:05:26
      175000 -- (-5044.398) [-5031.264] (-5040.486) (-5035.762) * (-5041.030) (-5030.964) (-5034.111) [-5034.601] -- 0:05:25

      Average standard deviation of split frequencies: 0.036159

      175500 -- (-5036.143) [-5037.119] (-5036.226) (-5036.112) * [-5033.472] (-5037.210) (-5045.092) (-5035.569) -- 0:05:24
      176000 -- (-5036.139) [-5032.061] (-5031.589) (-5031.397) * [-5037.158] (-5039.738) (-5035.092) (-5038.300) -- 0:05:23
      176500 -- (-5035.411) [-5035.767] (-5032.999) (-5040.780) * [-5037.790] (-5037.191) (-5034.102) (-5034.314) -- 0:05:26
      177000 -- (-5037.899) (-5029.830) [-5030.444] (-5036.897) * (-5034.056) (-5031.241) [-5035.253] (-5042.987) -- 0:05:25
      177500 -- (-5042.160) (-5037.562) [-5034.376] (-5035.319) * (-5034.507) (-5037.629) (-5038.894) [-5036.482] -- 0:05:24
      178000 -- (-5034.891) (-5040.034) (-5036.464) [-5027.845] * (-5036.512) [-5040.038] (-5037.757) (-5034.418) -- 0:05:23
      178500 -- (-5035.579) (-5036.787) (-5030.734) [-5033.315] * (-5035.315) (-5042.879) (-5038.754) [-5038.873] -- 0:05:22
      179000 -- [-5035.562] (-5030.567) (-5035.579) (-5038.380) * [-5034.901] (-5040.310) (-5034.629) (-5029.793) -- 0:05:25
      179500 -- (-5037.363) [-5034.863] (-5034.507) (-5045.024) * (-5044.535) (-5033.949) [-5031.783] (-5034.954) -- 0:05:24
      180000 -- (-5034.434) [-5042.869] (-5038.913) (-5042.466) * [-5039.374] (-5031.486) (-5039.708) (-5039.902) -- 0:05:23

      Average standard deviation of split frequencies: 0.039139

      180500 -- [-5039.261] (-5042.342) (-5033.884) (-5037.953) * (-5033.829) (-5030.982) (-5035.536) [-5039.424] -- 0:05:22
      181000 -- [-5030.998] (-5045.083) (-5038.873) (-5049.624) * (-5035.427) [-5033.041] (-5033.684) (-5039.033) -- 0:05:21
      181500 -- [-5028.601] (-5037.829) (-5031.490) (-5036.459) * (-5032.045) [-5032.627] (-5034.476) (-5032.458) -- 0:05:24
      182000 -- (-5038.392) [-5033.650] (-5030.682) (-5036.663) * (-5038.325) [-5034.991] (-5032.469) (-5038.090) -- 0:05:23
      182500 -- [-5036.351] (-5039.857) (-5033.812) (-5031.760) * (-5031.371) (-5034.681) (-5039.294) [-5035.457] -- 0:05:22
      183000 -- (-5041.964) (-5034.221) [-5031.675] (-5041.832) * (-5038.375) [-5042.722] (-5033.276) (-5033.634) -- 0:05:21
      183500 -- (-5041.226) (-5040.551) (-5042.281) [-5034.028] * (-5044.686) [-5039.209] (-5031.483) (-5036.614) -- 0:05:20
      184000 -- (-5038.750) [-5037.460] (-5036.599) (-5033.944) * [-5033.459] (-5040.957) (-5035.068) (-5030.743) -- 0:05:23
      184500 -- (-5039.358) (-5034.929) (-5045.510) [-5032.615] * [-5035.859] (-5037.916) (-5034.241) (-5042.313) -- 0:05:22
      185000 -- (-5035.689) (-5035.933) (-5041.652) [-5034.713] * [-5036.214] (-5041.120) (-5032.880) (-5040.190) -- 0:05:21

      Average standard deviation of split frequencies: 0.040551

      185500 -- (-5030.344) [-5034.257] (-5044.476) (-5046.876) * [-5033.765] (-5038.368) (-5034.727) (-5044.970) -- 0:05:20
      186000 -- (-5038.018) (-5032.708) (-5035.454) [-5041.154] * [-5038.894] (-5036.641) (-5038.995) (-5039.477) -- 0:05:19
      186500 -- (-5037.301) [-5035.048] (-5033.060) (-5040.841) * (-5041.588) (-5032.562) (-5031.964) [-5039.533] -- 0:05:22
      187000 -- [-5034.719] (-5032.742) (-5040.076) (-5041.812) * (-5044.090) [-5036.479] (-5040.889) (-5037.457) -- 0:05:21
      187500 -- [-5034.178] (-5040.029) (-5036.578) (-5049.802) * [-5040.539] (-5033.406) (-5033.180) (-5042.372) -- 0:05:20
      188000 -- (-5038.385) (-5039.424) [-5035.633] (-5045.106) * (-5037.935) (-5041.890) (-5032.419) [-5045.968] -- 0:05:19
      188500 -- (-5033.073) (-5034.536) [-5030.077] (-5034.012) * (-5041.983) [-5037.183] (-5033.943) (-5036.392) -- 0:05:18
      189000 -- [-5035.713] (-5036.198) (-5035.957) (-5040.081) * (-5034.352) (-5039.609) [-5034.327] (-5046.168) -- 0:05:21
      189500 -- (-5034.948) (-5039.623) [-5030.556] (-5029.698) * (-5034.998) [-5033.631] (-5037.778) (-5037.020) -- 0:05:20
      190000 -- (-5036.787) (-5036.448) [-5036.996] (-5039.537) * (-5039.232) (-5039.623) (-5040.222) [-5037.536] -- 0:05:19

      Average standard deviation of split frequencies: 0.035850

      190500 -- (-5035.966) [-5030.968] (-5031.878) (-5038.097) * [-5042.123] (-5034.489) (-5032.744) (-5039.054) -- 0:05:18
      191000 -- [-5040.614] (-5036.805) (-5039.241) (-5037.029) * (-5043.114) (-5037.788) (-5039.367) [-5039.735] -- 0:05:17
      191500 -- (-5039.012) [-5036.326] (-5036.444) (-5034.739) * (-5039.863) (-5036.768) (-5038.443) [-5038.601] -- 0:05:16
      192000 -- (-5039.191) [-5033.330] (-5034.630) (-5035.191) * (-5036.781) [-5038.945] (-5038.818) (-5047.270) -- 0:05:19
      192500 -- (-5037.582) [-5031.355] (-5034.536) (-5041.170) * (-5039.720) (-5045.859) (-5028.381) [-5037.128] -- 0:05:18
      193000 -- (-5035.087) [-5032.292] (-5035.862) (-5045.589) * (-5043.988) (-5039.373) (-5030.183) [-5033.040] -- 0:05:17
      193500 -- (-5033.224) [-5030.614] (-5036.321) (-5042.756) * (-5037.473) (-5035.881) [-5038.952] (-5036.384) -- 0:05:16
      194000 -- (-5034.481) [-5028.666] (-5037.632) (-5038.891) * (-5039.448) [-5035.003] (-5036.352) (-5034.187) -- 0:05:15
      194500 -- (-5037.010) (-5044.008) (-5033.827) [-5033.471] * (-5034.497) [-5035.919] (-5040.171) (-5034.018) -- 0:05:18
      195000 -- (-5039.510) (-5043.882) (-5035.577) [-5034.958] * (-5037.327) [-5038.838] (-5038.457) (-5036.546) -- 0:05:17

      Average standard deviation of split frequencies: 0.034874

      195500 -- [-5032.585] (-5037.383) (-5034.498) (-5045.353) * (-5035.537) (-5038.111) (-5033.148) [-5038.190] -- 0:05:16
      196000 -- [-5029.782] (-5043.145) (-5030.856) (-5037.525) * (-5039.480) [-5036.754] (-5039.456) (-5036.890) -- 0:05:15
      196500 -- [-5037.650] (-5034.382) (-5035.288) (-5033.768) * (-5029.556) (-5033.794) (-5039.028) [-5034.441] -- 0:05:14
      197000 -- (-5032.662) [-5033.243] (-5045.585) (-5038.075) * (-5029.418) (-5029.024) [-5038.314] (-5035.615) -- 0:05:17
      197500 -- (-5037.449) [-5035.997] (-5033.587) (-5040.866) * (-5029.010) (-5036.682) (-5039.246) [-5036.045] -- 0:05:16
      198000 -- [-5039.460] (-5039.896) (-5037.401) (-5038.413) * (-5034.696) (-5041.742) (-5032.771) [-5031.279] -- 0:05:15
      198500 -- [-5031.523] (-5032.631) (-5036.853) (-5036.263) * (-5034.448) (-5036.059) [-5038.013] (-5039.344) -- 0:05:14
      199000 -- (-5035.311) (-5031.820) (-5034.621) [-5037.179] * (-5036.194) [-5034.448] (-5032.587) (-5042.511) -- 0:05:13
      199500 -- (-5031.064) (-5035.538) [-5030.219] (-5041.479) * (-5033.062) (-5041.337) (-5036.048) [-5034.522] -- 0:05:16
      200000 -- (-5030.746) [-5036.392] (-5035.951) (-5044.464) * [-5033.657] (-5040.528) (-5036.964) (-5036.567) -- 0:05:16

      Average standard deviation of split frequencies: 0.035238

      200500 -- (-5036.597) (-5038.394) [-5034.997] (-5046.628) * [-5032.194] (-5047.877) (-5039.208) (-5039.747) -- 0:05:15
      201000 -- (-5036.557) (-5034.378) (-5036.111) [-5039.564] * (-5038.059) (-5040.763) (-5029.760) [-5032.734] -- 0:05:14
      201500 -- (-5037.040) [-5042.527] (-5052.110) (-5039.915) * (-5033.418) [-5033.886] (-5042.166) (-5034.189) -- 0:05:13
      202000 -- (-5034.704) (-5038.846) [-5040.994] (-5044.565) * (-5039.764) (-5033.250) [-5038.457] (-5035.270) -- 0:05:16
      202500 -- [-5038.791] (-5036.042) (-5040.856) (-5035.197) * [-5038.405] (-5032.789) (-5042.679) (-5040.375) -- 0:05:15
      203000 -- (-5041.320) [-5037.604] (-5035.380) (-5032.647) * (-5032.971) (-5034.176) [-5030.419] (-5033.142) -- 0:05:14
      203500 -- (-5036.833) (-5030.534) [-5038.020] (-5031.051) * (-5041.977) [-5035.180] (-5038.961) (-5041.425) -- 0:05:13
      204000 -- (-5037.446) (-5037.743) [-5035.565] (-5035.479) * (-5043.261) (-5034.873) [-5038.428] (-5037.316) -- 0:05:12
      204500 -- (-5035.554) (-5036.510) [-5031.921] (-5042.602) * (-5039.808) (-5037.896) (-5040.612) [-5036.274] -- 0:05:15
      205000 -- (-5035.555) [-5031.935] (-5034.504) (-5035.129) * (-5035.450) (-5036.617) (-5040.309) [-5035.128] -- 0:05:14

      Average standard deviation of split frequencies: 0.037758

      205500 -- (-5032.853) [-5039.844] (-5033.591) (-5041.478) * (-5035.500) (-5034.551) (-5036.686) [-5039.820] -- 0:05:13
      206000 -- (-5033.501) [-5037.602] (-5039.154) (-5042.231) * (-5033.444) (-5034.491) (-5036.432) [-5037.918] -- 0:05:12
      206500 -- [-5044.307] (-5040.787) (-5049.483) (-5033.842) * (-5030.565) [-5033.607] (-5043.843) (-5038.210) -- 0:05:11
      207000 -- (-5042.383) (-5045.794) [-5037.034] (-5031.812) * (-5036.043) (-5039.738) (-5034.098) [-5035.564] -- 0:05:10
      207500 -- (-5039.044) [-5038.234] (-5034.513) (-5039.208) * (-5032.835) [-5034.908] (-5029.275) (-5035.451) -- 0:05:13
      208000 -- [-5034.147] (-5041.924) (-5031.837) (-5035.132) * (-5032.154) (-5037.592) (-5036.547) [-5030.836] -- 0:05:12
      208500 -- (-5043.220) (-5034.229) [-5037.091] (-5050.599) * (-5032.991) [-5038.369] (-5043.519) (-5035.853) -- 0:05:11
      209000 -- (-5041.585) [-5037.789] (-5040.154) (-5040.630) * (-5034.238) (-5032.618) [-5037.376] (-5034.071) -- 0:05:10
      209500 -- (-5032.556) (-5035.126) (-5036.214) [-5035.767] * [-5033.501] (-5031.560) (-5041.114) (-5028.041) -- 0:05:09
      210000 -- (-5035.644) (-5041.487) (-5038.299) [-5039.355] * (-5042.696) [-5035.335] (-5046.095) (-5030.443) -- 0:05:12

      Average standard deviation of split frequencies: 0.038041

      210500 -- (-5030.714) (-5034.921) [-5036.221] (-5038.724) * (-5045.124) (-5034.817) (-5044.109) [-5036.847] -- 0:05:11
      211000 -- [-5030.827] (-5035.665) (-5039.737) (-5031.970) * (-5034.770) (-5037.909) (-5042.514) [-5030.113] -- 0:05:10
      211500 -- [-5036.876] (-5041.515) (-5036.191) (-5036.078) * (-5032.695) [-5034.930] (-5044.578) (-5029.776) -- 0:05:09
      212000 -- (-5036.043) (-5031.990) (-5035.667) [-5032.575] * [-5031.453] (-5032.961) (-5039.398) (-5033.413) -- 0:05:08
      212500 -- (-5036.669) (-5034.043) [-5032.418] (-5031.796) * (-5033.653) [-5032.242] (-5039.367) (-5037.810) -- 0:05:11
      213000 -- (-5038.488) (-5036.758) (-5039.460) [-5036.756] * (-5036.272) (-5031.778) [-5037.043] (-5042.443) -- 0:05:10
      213500 -- [-5033.398] (-5037.741) (-5037.089) (-5036.736) * (-5036.519) (-5034.615) [-5036.798] (-5042.351) -- 0:05:09
      214000 -- [-5035.691] (-5037.943) (-5030.753) (-5033.563) * (-5036.689) (-5038.088) [-5037.270] (-5034.334) -- 0:05:08
      214500 -- (-5046.882) (-5041.437) [-5034.006] (-5032.372) * (-5037.919) [-5037.681] (-5034.075) (-5038.614) -- 0:05:07
      215000 -- (-5045.688) (-5038.232) (-5034.012) [-5037.029] * [-5036.580] (-5029.416) (-5042.862) (-5031.623) -- 0:05:10

      Average standard deviation of split frequencies: 0.034919

      215500 -- (-5037.232) (-5040.856) (-5041.660) [-5032.185] * (-5039.862) (-5041.127) [-5039.199] (-5036.209) -- 0:05:09
      216000 -- (-5043.217) (-5036.931) (-5038.621) [-5030.160] * [-5037.314] (-5033.940) (-5040.027) (-5031.639) -- 0:05:08
      216500 -- [-5035.389] (-5038.799) (-5047.634) (-5039.411) * (-5040.956) (-5037.589) [-5029.154] (-5036.546) -- 0:05:07
      217000 -- (-5041.005) [-5038.204] (-5034.764) (-5038.585) * (-5036.913) (-5035.885) (-5034.206) [-5033.637] -- 0:05:06
      217500 -- (-5046.639) (-5036.372) (-5036.099) [-5031.302] * [-5035.307] (-5039.200) (-5030.218) (-5035.975) -- 0:05:09
      218000 -- (-5038.404) (-5036.282) [-5035.259] (-5036.624) * (-5039.240) (-5039.576) (-5034.678) [-5036.430] -- 0:05:08
      218500 -- (-5035.008) (-5035.499) [-5030.680] (-5042.852) * (-5035.383) [-5032.739] (-5044.456) (-5030.675) -- 0:05:07
      219000 -- (-5038.988) (-5049.211) (-5038.661) [-5032.888] * (-5038.086) (-5035.099) (-5031.903) [-5033.506] -- 0:05:06
      219500 -- (-5030.384) (-5031.532) (-5040.711) [-5032.709] * (-5038.061) (-5039.911) (-5033.583) [-5037.099] -- 0:05:05
      220000 -- [-5034.827] (-5037.148) (-5034.688) (-5036.127) * (-5034.449) (-5039.668) (-5038.365) [-5049.239] -- 0:05:08

      Average standard deviation of split frequencies: 0.038453

      220500 -- [-5036.391] (-5035.914) (-5041.520) (-5033.365) * [-5037.960] (-5034.739) (-5035.971) (-5040.125) -- 0:05:07
      221000 -- (-5040.740) (-5035.587) (-5030.925) [-5038.739] * (-5032.484) [-5033.131] (-5043.922) (-5038.977) -- 0:05:06
      221500 -- (-5038.386) [-5031.986] (-5038.732) (-5040.443) * (-5031.057) (-5040.059) (-5035.783) [-5030.893] -- 0:05:05
      222000 -- (-5031.298) [-5034.438] (-5031.109) (-5034.144) * (-5035.239) (-5043.556) (-5038.233) [-5038.444] -- 0:05:04
      222500 -- [-5031.768] (-5040.869) (-5031.461) (-5038.247) * (-5036.787) (-5041.367) (-5039.225) [-5031.606] -- 0:05:07
      223000 -- (-5035.656) (-5036.794) (-5033.757) [-5035.688] * (-5040.336) (-5039.656) [-5033.659] (-5032.204) -- 0:05:06
      223500 -- [-5035.024] (-5034.872) (-5034.929) (-5040.425) * (-5041.207) (-5036.953) [-5030.591] (-5035.260) -- 0:05:05
      224000 -- (-5039.448) (-5041.037) [-5033.144] (-5043.571) * (-5043.870) (-5038.087) (-5037.408) [-5037.112] -- 0:05:04
      224500 -- (-5042.817) [-5033.486] (-5038.373) (-5035.941) * (-5035.430) [-5031.993] (-5035.697) (-5034.697) -- 0:05:03
      225000 -- (-5038.140) (-5041.412) [-5032.084] (-5036.501) * (-5039.706) (-5034.632) (-5038.746) [-5033.732] -- 0:05:03

      Average standard deviation of split frequencies: 0.036503

      225500 -- (-5040.742) (-5037.763) (-5033.658) [-5036.905] * [-5036.676] (-5039.544) (-5041.054) (-5040.046) -- 0:05:05
      226000 -- (-5049.981) (-5038.837) (-5034.230) [-5035.468] * (-5037.377) (-5035.688) (-5037.502) [-5032.581] -- 0:05:04
      226500 -- (-5038.685) (-5035.442) [-5038.836] (-5032.726) * (-5037.354) (-5035.793) [-5035.342] (-5038.708) -- 0:05:03
      227000 -- (-5036.639) (-5035.555) (-5038.798) [-5033.505] * (-5045.222) [-5035.037] (-5038.347) (-5028.599) -- 0:05:03
      227500 -- (-5035.543) (-5031.996) [-5037.675] (-5036.385) * (-5035.746) (-5035.432) [-5031.747] (-5040.400) -- 0:05:02
      228000 -- (-5040.857) (-5028.754) [-5031.181] (-5039.232) * (-5045.542) (-5030.522) [-5032.599] (-5037.070) -- 0:05:04
      228500 -- (-5034.082) (-5039.688) (-5035.479) [-5037.238] * (-5042.174) [-5031.374] (-5037.323) (-5031.955) -- 0:05:03
      229000 -- (-5035.356) (-5037.710) (-5036.574) [-5034.236] * (-5040.201) (-5038.428) [-5032.263] (-5039.343) -- 0:05:03
      229500 -- [-5035.790] (-5037.426) (-5033.447) (-5040.750) * (-5043.739) (-5040.920) [-5035.761] (-5035.969) -- 0:05:02
      230000 -- (-5034.672) (-5031.697) [-5034.918] (-5046.605) * (-5045.671) (-5035.730) [-5036.451] (-5041.043) -- 0:05:01

      Average standard deviation of split frequencies: 0.037808

      230500 -- (-5040.911) (-5036.569) [-5040.150] (-5034.466) * (-5051.560) (-5035.730) [-5037.697] (-5038.023) -- 0:05:03
      231000 -- [-5037.624] (-5036.004) (-5034.275) (-5035.640) * (-5049.052) (-5033.866) [-5038.811] (-5043.894) -- 0:05:02
      231500 -- [-5034.074] (-5036.768) (-5032.015) (-5032.089) * (-5043.434) (-5031.692) (-5036.578) [-5037.777] -- 0:05:02
      232000 -- (-5032.726) [-5030.806] (-5038.820) (-5032.731) * (-5040.681) [-5033.268] (-5032.260) (-5044.460) -- 0:05:01
      232500 -- (-5037.583) (-5031.467) (-5036.173) [-5033.102] * (-5038.265) (-5037.427) (-5034.066) [-5040.846] -- 0:05:03
      233000 -- [-5032.927] (-5031.751) (-5038.338) (-5035.719) * (-5036.827) [-5034.096] (-5033.989) (-5043.816) -- 0:05:02
      233500 -- (-5032.497) (-5041.464) (-5045.071) [-5032.327] * (-5033.634) [-5035.152] (-5039.158) (-5032.913) -- 0:05:02
      234000 -- [-5033.508] (-5038.184) (-5043.708) (-5037.544) * (-5032.085) (-5034.788) (-5046.239) [-5036.258] -- 0:05:01
      234500 -- [-5031.697] (-5039.148) (-5036.883) (-5039.853) * (-5031.053) [-5036.059] (-5036.771) (-5033.888) -- 0:05:00
      235000 -- (-5033.877) [-5035.600] (-5035.594) (-5039.349) * (-5039.319) [-5038.076] (-5041.200) (-5033.891) -- 0:05:02

      Average standard deviation of split frequencies: 0.047274

      235500 -- (-5035.441) (-5033.435) [-5035.494] (-5047.491) * (-5031.739) (-5037.977) (-5038.401) [-5034.203] -- 0:05:01
      236000 -- (-5037.435) [-5031.777] (-5038.251) (-5038.141) * (-5037.197) (-5033.273) (-5046.538) [-5033.421] -- 0:05:01
      236500 -- (-5040.772) (-5037.036) (-5040.797) [-5035.343] * (-5032.306) (-5032.768) (-5034.051) [-5033.407] -- 0:05:00
      237000 -- (-5037.843) [-5039.573] (-5034.310) (-5034.838) * (-5035.366) (-5035.592) [-5030.243] (-5033.938) -- 0:04:59
      237500 -- (-5040.690) (-5036.385) (-5039.832) [-5038.714] * (-5042.294) (-5034.798) (-5031.249) [-5029.762] -- 0:05:01
      238000 -- (-5028.655) [-5033.480] (-5042.325) (-5043.180) * (-5035.199) (-5040.223) (-5039.599) [-5034.271] -- 0:05:00
      238500 -- (-5039.192) (-5037.810) (-5033.569) [-5033.040] * [-5041.730] (-5031.534) (-5036.188) (-5038.544) -- 0:05:00
      239000 -- (-5037.390) (-5035.373) (-5028.987) [-5034.806] * (-5028.942) (-5042.631) (-5039.772) [-5034.198] -- 0:04:59
      239500 -- (-5037.107) [-5031.635] (-5032.849) (-5034.275) * (-5034.130) (-5040.117) [-5041.244] (-5033.217) -- 0:04:58
      240000 -- [-5035.140] (-5034.413) (-5036.466) (-5035.607) * (-5035.227) [-5030.519] (-5040.590) (-5035.894) -- 0:05:00

      Average standard deviation of split frequencies: 0.049622

      240500 -- [-5033.310] (-5032.900) (-5032.681) (-5035.059) * (-5034.125) [-5033.634] (-5039.973) (-5031.503) -- 0:05:00
      241000 -- [-5035.500] (-5035.501) (-5034.933) (-5035.956) * [-5036.495] (-5035.928) (-5046.474) (-5042.580) -- 0:04:59
      241500 -- (-5038.388) (-5040.294) [-5034.681] (-5037.479) * [-5036.827] (-5036.926) (-5039.114) (-5038.852) -- 0:04:58
      242000 -- (-5034.268) (-5048.395) (-5041.939) [-5033.453] * (-5032.378) [-5034.574] (-5033.775) (-5041.099) -- 0:05:00
      242500 -- (-5036.025) [-5035.136] (-5037.805) (-5036.885) * (-5040.260) (-5033.884) (-5037.241) [-5039.873] -- 0:04:59
      243000 -- (-5037.318) [-5036.558] (-5037.093) (-5041.612) * (-5041.635) (-5039.102) (-5031.793) [-5032.740] -- 0:04:59
      243500 -- [-5036.087] (-5032.317) (-5035.927) (-5042.735) * [-5030.885] (-5039.995) (-5041.879) (-5036.977) -- 0:04:58
      244000 -- (-5033.255) [-5030.887] (-5036.288) (-5035.755) * (-5034.962) (-5040.711) (-5041.974) [-5036.165] -- 0:04:57
      244500 -- (-5039.283) (-5033.472) [-5036.794] (-5045.157) * (-5033.740) [-5042.314] (-5037.651) (-5033.499) -- 0:04:59
      245000 -- (-5036.873) (-5034.932) [-5031.133] (-5046.208) * (-5040.349) [-5038.895] (-5036.081) (-5035.260) -- 0:04:58

      Average standard deviation of split frequencies: 0.044074

      245500 -- (-5035.286) (-5039.510) [-5032.850] (-5037.122) * (-5038.131) (-5036.722) (-5039.630) [-5033.643] -- 0:04:58
      246000 -- (-5033.289) (-5042.707) (-5041.715) [-5042.325] * (-5039.618) (-5038.264) (-5041.293) [-5034.812] -- 0:04:57
      246500 -- [-5034.723] (-5036.297) (-5032.131) (-5036.590) * (-5031.292) [-5032.644] (-5041.663) (-5031.448) -- 0:04:56
      247000 -- (-5031.743) [-5033.061] (-5034.177) (-5030.802) * (-5036.995) [-5031.037] (-5037.458) (-5035.862) -- 0:04:55
      247500 -- (-5036.742) (-5035.323) (-5039.325) [-5032.037] * (-5034.220) (-5037.740) (-5041.143) [-5034.378] -- 0:04:57
      248000 -- (-5038.937) (-5040.104) (-5038.653) [-5040.102] * (-5037.200) (-5037.002) [-5035.333] (-5044.693) -- 0:04:57
      248500 -- (-5037.643) (-5052.372) (-5041.877) [-5038.468] * (-5035.790) [-5036.710] (-5038.670) (-5041.991) -- 0:04:56
      249000 -- (-5036.868) (-5046.679) (-5045.866) [-5039.925] * [-5037.262] (-5041.746) (-5037.831) (-5039.652) -- 0:04:55
      249500 -- [-5035.153] (-5041.923) (-5038.925) (-5041.888) * (-5030.782) (-5033.058) [-5033.295] (-5037.210) -- 0:04:54
      250000 -- (-5032.976) (-5040.004) [-5040.981] (-5033.019) * (-5033.430) [-5034.014] (-5034.822) (-5038.006) -- 0:04:57

      Average standard deviation of split frequencies: 0.043254

      250500 -- (-5030.876) (-5035.784) (-5038.643) [-5036.168] * (-5040.987) (-5036.863) (-5036.384) [-5038.042] -- 0:04:56
      251000 -- (-5032.015) (-5031.318) (-5035.104) [-5033.607] * (-5039.599) (-5034.122) (-5036.571) [-5040.214] -- 0:04:55
      251500 -- [-5034.653] (-5039.166) (-5034.744) (-5036.799) * (-5035.627) [-5035.764] (-5032.782) (-5037.487) -- 0:04:54
      252000 -- (-5041.259) [-5033.472] (-5040.493) (-5032.075) * (-5042.554) [-5043.104] (-5035.891) (-5033.450) -- 0:04:53
      252500 -- (-5036.539) (-5036.400) [-5035.294] (-5037.610) * [-5033.646] (-5038.719) (-5032.974) (-5043.047) -- 0:04:56
      253000 -- (-5041.380) (-5034.353) (-5035.061) [-5031.353] * (-5040.207) (-5033.421) [-5035.115] (-5038.013) -- 0:04:55
      253500 -- (-5037.382) (-5031.367) (-5031.532) [-5034.012] * (-5039.691) (-5040.078) [-5035.702] (-5034.640) -- 0:04:54
      254000 -- (-5033.339) [-5032.549] (-5035.926) (-5032.262) * [-5030.175] (-5040.292) (-5037.884) (-5037.551) -- 0:04:53
      254500 -- (-5035.271) [-5037.744] (-5042.158) (-5033.423) * (-5035.613) (-5042.278) [-5045.985] (-5032.857) -- 0:04:52
      255000 -- (-5036.470) (-5033.413) [-5037.274] (-5037.707) * (-5031.186) [-5029.528] (-5039.172) (-5036.479) -- 0:04:55

      Average standard deviation of split frequencies: 0.043580

      255500 -- (-5042.282) (-5035.647) [-5034.100] (-5043.521) * (-5031.488) [-5035.568] (-5036.972) (-5036.043) -- 0:04:54
      256000 -- (-5039.626) (-5034.938) [-5032.817] (-5043.759) * (-5037.980) (-5032.760) [-5036.769] (-5035.824) -- 0:04:53
      256500 -- [-5037.532] (-5033.881) (-5039.676) (-5034.708) * (-5037.631) (-5031.014) [-5036.503] (-5033.277) -- 0:04:52
      257000 -- (-5037.496) (-5030.308) [-5032.258] (-5042.904) * [-5035.836] (-5037.247) (-5032.905) (-5038.064) -- 0:04:51
      257500 -- (-5031.719) (-5035.415) [-5033.424] (-5039.188) * [-5029.536] (-5040.925) (-5031.465) (-5031.737) -- 0:04:54
      258000 -- [-5035.363] (-5031.626) (-5035.403) (-5038.009) * [-5031.653] (-5032.618) (-5030.705) (-5035.630) -- 0:04:53
      258500 -- (-5033.071) (-5032.835) [-5037.313] (-5035.152) * (-5032.409) (-5031.434) [-5033.892] (-5032.531) -- 0:04:52
      259000 -- (-5032.738) [-5034.454] (-5031.931) (-5037.169) * [-5033.431] (-5040.003) (-5034.402) (-5038.458) -- 0:04:51
      259500 -- [-5038.780] (-5033.927) (-5033.255) (-5034.634) * (-5039.811) [-5036.849] (-5034.779) (-5039.825) -- 0:04:51
      260000 -- (-5036.272) (-5041.033) (-5034.989) [-5037.112] * [-5039.533] (-5032.095) (-5035.844) (-5035.791) -- 0:04:53

      Average standard deviation of split frequencies: 0.045211

      260500 -- (-5036.782) (-5034.232) (-5040.626) [-5032.687] * [-5039.236] (-5031.936) (-5037.496) (-5039.963) -- 0:04:52
      261000 -- (-5039.924) (-5037.602) [-5036.439] (-5038.092) * (-5040.340) [-5032.497] (-5035.446) (-5037.255) -- 0:04:51
      261500 -- (-5033.520) (-5031.910) [-5044.212] (-5031.351) * (-5042.329) (-5035.038) [-5032.858] (-5030.006) -- 0:04:50
      262000 -- (-5036.111) [-5032.041] (-5034.689) (-5030.405) * (-5047.740) [-5033.178] (-5040.570) (-5032.743) -- 0:04:50
      262500 -- (-5033.466) (-5041.031) (-5040.575) [-5031.299] * [-5039.668] (-5037.113) (-5034.295) (-5038.271) -- 0:04:52
      263000 -- (-5033.767) [-5039.013] (-5043.011) (-5033.175) * (-5043.357) [-5031.487] (-5034.304) (-5038.543) -- 0:04:51
      263500 -- (-5034.483) [-5033.237] (-5042.571) (-5037.355) * (-5039.394) (-5033.120) [-5031.829] (-5035.366) -- 0:04:50
      264000 -- (-5035.024) (-5034.020) [-5032.246] (-5032.905) * (-5039.489) (-5032.495) [-5031.828] (-5040.499) -- 0:04:49
      264500 -- [-5038.826] (-5038.785) (-5032.931) (-5038.423) * (-5034.091) (-5030.943) [-5038.464] (-5038.170) -- 0:04:49
      265000 -- (-5031.290) (-5035.830) (-5034.275) [-5030.349] * (-5031.978) [-5036.554] (-5031.806) (-5036.162) -- 0:04:48

      Average standard deviation of split frequencies: 0.047259

      265500 -- [-5034.416] (-5036.346) (-5031.011) (-5037.301) * (-5035.598) (-5038.589) (-5033.963) [-5041.174] -- 0:04:50
      266000 -- (-5031.668) (-5036.996) [-5031.973] (-5045.489) * (-5044.204) (-5035.061) [-5030.488] (-5037.264) -- 0:04:49
      266500 -- (-5030.810) [-5042.595] (-5042.054) (-5037.111) * (-5032.115) (-5038.362) [-5031.823] (-5035.271) -- 0:04:48
      267000 -- [-5035.673] (-5039.061) (-5039.206) (-5041.489) * (-5031.503) [-5031.752] (-5039.728) (-5032.346) -- 0:04:48
      267500 -- (-5037.771) (-5030.643) [-5038.653] (-5044.171) * (-5034.409) (-5036.015) [-5037.283] (-5032.322) -- 0:04:47
      268000 -- [-5030.153] (-5041.519) (-5034.325) (-5035.636) * (-5034.689) (-5037.306) (-5035.351) [-5034.523] -- 0:04:49
      268500 -- (-5037.347) [-5037.362] (-5036.411) (-5037.783) * (-5029.331) (-5039.999) (-5034.539) [-5028.857] -- 0:04:48
      269000 -- (-5036.560) (-5036.251) [-5034.796] (-5034.405) * (-5032.086) [-5039.459] (-5043.602) (-5027.500) -- 0:04:48
      269500 -- (-5036.806) (-5033.145) (-5037.474) [-5037.552] * [-5035.703] (-5035.812) (-5036.472) (-5032.647) -- 0:04:47
      270000 -- (-5036.008) (-5040.056) (-5035.464) [-5033.886] * (-5033.686) (-5039.521) [-5035.700] (-5045.100) -- 0:04:46

      Average standard deviation of split frequencies: 0.048766

      270500 -- (-5035.042) (-5038.556) (-5032.613) [-5043.637] * [-5033.107] (-5040.452) (-5034.876) (-5036.228) -- 0:04:48
      271000 -- [-5039.882] (-5035.603) (-5036.067) (-5044.613) * (-5046.425) (-5044.060) [-5036.520] (-5039.879) -- 0:04:47
      271500 -- (-5043.195) [-5038.905] (-5039.394) (-5039.380) * [-5031.320] (-5040.119) (-5033.157) (-5035.099) -- 0:04:47
      272000 -- [-5039.014] (-5031.598) (-5034.149) (-5037.303) * (-5034.810) (-5043.193) (-5040.524) [-5035.700] -- 0:04:46
      272500 -- (-5042.536) (-5034.358) [-5033.831] (-5033.556) * (-5039.909) (-5041.548) [-5031.426] (-5039.848) -- 0:04:45
      273000 -- (-5031.197) (-5036.665) (-5035.058) [-5038.190] * (-5039.452) (-5041.704) [-5035.617] (-5035.317) -- 0:04:47
      273500 -- (-5037.405) (-5030.463) [-5036.747] (-5033.040) * (-5045.494) [-5031.910] (-5035.211) (-5042.265) -- 0:04:46
      274000 -- (-5038.748) [-5035.736] (-5034.690) (-5031.425) * [-5039.571] (-5041.323) (-5037.638) (-5037.420) -- 0:04:46
      274500 -- (-5032.960) [-5033.724] (-5035.873) (-5037.965) * (-5039.409) (-5035.929) (-5038.238) [-5036.423] -- 0:04:45
      275000 -- (-5036.100) [-5035.655] (-5048.606) (-5039.791) * [-5032.238] (-5042.815) (-5031.197) (-5038.263) -- 0:04:44

      Average standard deviation of split frequencies: 0.043269

      275500 -- [-5041.656] (-5035.781) (-5034.666) (-5038.141) * (-5035.657) [-5032.858] (-5031.348) (-5038.462) -- 0:04:46
      276000 -- (-5034.761) [-5033.107] (-5041.583) (-5040.434) * (-5035.795) (-5043.706) [-5031.182] (-5031.619) -- 0:04:45
      276500 -- (-5033.757) [-5038.413] (-5039.725) (-5035.874) * (-5035.579) (-5044.245) [-5033.783] (-5034.296) -- 0:04:45
      277000 -- (-5037.520) (-5034.046) (-5041.252) [-5039.358] * (-5035.722) (-5033.300) (-5035.022) [-5036.967] -- 0:04:44
      277500 -- [-5033.693] (-5029.048) (-5046.050) (-5036.535) * (-5035.888) (-5030.070) (-5033.700) [-5034.009] -- 0:04:43
      278000 -- (-5036.025) [-5032.425] (-5035.993) (-5038.769) * [-5029.554] (-5029.583) (-5043.126) (-5036.321) -- 0:04:45
      278500 -- (-5032.912) (-5033.513) (-5039.059) [-5033.681] * (-5039.151) [-5033.917] (-5034.030) (-5040.832) -- 0:04:44
      279000 -- (-5032.472) (-5037.993) (-5033.563) [-5031.037] * [-5032.270] (-5031.581) (-5033.387) (-5031.378) -- 0:04:44
      279500 -- (-5035.688) [-5031.863] (-5035.973) (-5035.861) * (-5035.158) (-5033.679) (-5035.512) [-5039.545] -- 0:04:43
      280000 -- (-5042.174) (-5035.738) [-5033.210] (-5038.861) * (-5038.497) [-5036.983] (-5044.024) (-5036.764) -- 0:04:42

      Average standard deviation of split frequencies: 0.045909

      280500 -- [-5033.844] (-5035.072) (-5036.856) (-5033.569) * (-5033.134) (-5039.208) (-5045.892) [-5031.528] -- 0:04:42
      281000 -- [-5036.258] (-5031.705) (-5037.457) (-5044.221) * (-5039.924) (-5032.299) (-5037.368) [-5033.863] -- 0:04:44
      281500 -- (-5039.965) (-5031.536) (-5039.013) [-5037.836] * (-5033.845) (-5047.766) (-5040.116) [-5037.659] -- 0:04:43
      282000 -- (-5036.697) (-5033.996) (-5033.168) [-5034.998] * (-5030.803) [-5038.866] (-5032.276) (-5029.182) -- 0:04:42
      282500 -- [-5037.585] (-5040.806) (-5029.742) (-5043.043) * (-5035.264) (-5035.340) [-5037.512] (-5034.394) -- 0:04:41
      283000 -- (-5033.485) (-5045.293) (-5039.243) [-5038.376] * [-5034.458] (-5034.597) (-5031.403) (-5037.295) -- 0:04:41
      283500 -- (-5029.448) (-5036.952) [-5038.604] (-5036.255) * [-5033.901] (-5034.949) (-5033.547) (-5035.677) -- 0:04:43
      284000 -- (-5036.854) [-5037.004] (-5033.972) (-5036.268) * (-5045.048) (-5033.309) [-5037.481] (-5040.743) -- 0:04:42
      284500 -- (-5034.574) (-5038.439) (-5037.162) [-5033.211] * (-5046.850) (-5042.056) [-5035.491] (-5033.820) -- 0:04:41
      285000 -- (-5037.258) (-5037.921) (-5042.558) [-5036.529] * (-5032.557) (-5042.529) [-5032.138] (-5032.971) -- 0:04:40

      Average standard deviation of split frequencies: 0.044503

      285500 -- (-5036.710) [-5045.282] (-5045.615) (-5037.912) * (-5036.181) (-5042.359) (-5033.368) [-5031.270] -- 0:04:40
      286000 -- [-5037.715] (-5033.646) (-5038.900) (-5040.490) * (-5037.580) (-5037.430) [-5032.645] (-5040.263) -- 0:04:42
      286500 -- (-5046.034) (-5030.613) (-5039.026) [-5032.469] * (-5037.910) (-5041.428) [-5031.286] (-5040.370) -- 0:04:41
      287000 -- (-5040.296) (-5036.591) [-5035.784] (-5038.682) * (-5043.409) [-5031.300] (-5038.904) (-5036.547) -- 0:04:40
      287500 -- [-5044.631] (-5038.575) (-5042.378) (-5038.404) * (-5044.728) (-5040.998) [-5034.411] (-5029.498) -- 0:04:40
      288000 -- (-5047.463) (-5036.293) [-5034.996] (-5033.752) * (-5046.856) (-5038.369) (-5035.858) [-5038.536] -- 0:04:39
      288500 -- (-5035.527) [-5033.351] (-5032.052) (-5031.351) * (-5051.954) (-5045.686) [-5040.093] (-5039.336) -- 0:04:41
      289000 -- (-5039.838) [-5031.323] (-5029.309) (-5035.500) * (-5038.168) (-5037.539) (-5038.267) [-5034.923] -- 0:04:40
      289500 -- [-5038.944] (-5036.629) (-5031.435) (-5044.156) * (-5036.703) (-5038.665) [-5033.878] (-5041.547) -- 0:04:39
      290000 -- (-5040.240) [-5032.581] (-5032.750) (-5039.555) * [-5032.372] (-5033.446) (-5039.292) (-5034.035) -- 0:04:39

      Average standard deviation of split frequencies: 0.045411

      290500 -- (-5033.442) [-5036.730] (-5041.656) (-5042.634) * (-5039.619) (-5040.514) (-5032.280) [-5036.250] -- 0:04:38
      291000 -- [-5034.104] (-5029.899) (-5035.797) (-5046.055) * [-5033.769] (-5036.706) (-5036.244) (-5031.646) -- 0:04:40
      291500 -- [-5038.938] (-5035.202) (-5037.680) (-5038.896) * (-5034.123) (-5041.469) [-5038.177] (-5037.103) -- 0:04:39
      292000 -- (-5038.624) (-5035.708) (-5029.412) [-5031.599] * (-5037.920) [-5032.932] (-5034.883) (-5030.066) -- 0:04:38
      292500 -- (-5042.623) [-5038.650] (-5031.115) (-5036.828) * (-5042.370) (-5036.276) [-5031.989] (-5033.127) -- 0:04:38
      293000 -- (-5041.460) [-5040.047] (-5035.831) (-5036.574) * (-5034.514) (-5039.184) (-5033.795) [-5038.179] -- 0:04:37
      293500 -- (-5032.819) (-5037.527) [-5032.283] (-5040.721) * (-5032.135) [-5030.902] (-5039.362) (-5032.194) -- 0:04:39
      294000 -- [-5037.372] (-5037.025) (-5033.595) (-5035.584) * (-5035.482) (-5037.279) [-5030.344] (-5034.556) -- 0:04:38
      294500 -- [-5035.875] (-5036.190) (-5036.948) (-5042.976) * (-5032.112) (-5040.083) [-5042.278] (-5038.311) -- 0:04:37
      295000 -- (-5041.189) (-5033.059) (-5038.046) [-5031.935] * (-5035.544) [-5038.494] (-5043.299) (-5034.816) -- 0:04:37

      Average standard deviation of split frequencies: 0.042469

      295500 -- (-5036.813) (-5028.488) [-5038.917] (-5032.975) * (-5034.312) (-5037.253) [-5034.954] (-5045.431) -- 0:04:36
      296000 -- (-5034.017) (-5041.130) (-5040.612) [-5036.211] * (-5041.522) [-5035.954] (-5037.015) (-5044.960) -- 0:04:35
      296500 -- [-5033.713] (-5040.803) (-5038.413) (-5038.509) * (-5039.046) [-5033.700] (-5041.863) (-5039.951) -- 0:04:37
      297000 -- (-5035.781) [-5035.203] (-5036.865) (-5036.017) * [-5041.344] (-5043.670) (-5048.207) (-5031.504) -- 0:04:36
      297500 -- (-5036.591) (-5038.730) (-5040.615) [-5034.119] * (-5039.944) (-5037.988) [-5035.429] (-5037.509) -- 0:04:36
      298000 -- (-5039.520) (-5033.043) (-5047.418) [-5040.600] * [-5035.037] (-5033.216) (-5042.878) (-5034.334) -- 0:04:35
      298500 -- (-5032.015) [-5033.811] (-5040.565) (-5041.747) * (-5038.817) (-5040.006) [-5037.258] (-5038.420) -- 0:04:34
      299000 -- (-5045.681) (-5034.350) [-5034.535] (-5041.532) * (-5038.465) (-5032.978) (-5038.192) [-5032.324] -- 0:04:36
      299500 -- [-5034.586] (-5037.813) (-5035.106) (-5037.801) * (-5034.250) (-5034.303) [-5030.662] (-5031.762) -- 0:04:35
      300000 -- (-5030.074) [-5035.089] (-5029.910) (-5038.329) * (-5038.099) [-5033.472] (-5037.030) (-5037.327) -- 0:04:35

      Average standard deviation of split frequencies: 0.037629

      300500 -- [-5038.099] (-5036.089) (-5032.630) (-5033.915) * [-5032.065] (-5037.892) (-5035.984) (-5029.534) -- 0:04:34
      301000 -- (-5039.110) (-5032.978) [-5041.165] (-5038.146) * (-5035.004) [-5030.535] (-5031.095) (-5046.990) -- 0:04:34
      301500 -- (-5039.215) (-5037.682) (-5033.013) [-5033.110] * (-5036.619) (-5035.264) (-5040.850) [-5035.127] -- 0:04:35
      302000 -- (-5038.784) (-5042.754) [-5038.036] (-5032.792) * (-5032.162) [-5037.710] (-5038.358) (-5037.565) -- 0:04:35
      302500 -- (-5038.243) (-5044.298) (-5038.454) [-5034.937] * (-5028.547) (-5032.317) [-5046.422] (-5040.320) -- 0:04:34
      303000 -- (-5041.498) (-5032.542) (-5040.595) [-5035.678] * (-5044.865) (-5035.110) [-5035.969] (-5034.349) -- 0:04:33
      303500 -- [-5041.920] (-5033.942) (-5034.708) (-5045.296) * (-5035.004) [-5036.981] (-5035.783) (-5042.007) -- 0:04:33
      304000 -- (-5035.245) (-5031.899) (-5037.254) [-5046.328] * [-5034.028] (-5034.798) (-5038.985) (-5033.604) -- 0:04:34
      304500 -- [-5033.251] (-5033.547) (-5036.436) (-5038.699) * (-5028.925) (-5032.216) [-5040.164] (-5040.055) -- 0:04:34
      305000 -- (-5032.646) [-5033.580] (-5034.085) (-5033.718) * (-5039.287) [-5036.064] (-5034.843) (-5038.849) -- 0:04:33

      Average standard deviation of split frequencies: 0.035432

      305500 -- (-5036.943) [-5040.341] (-5038.250) (-5040.681) * [-5041.353] (-5032.997) (-5037.883) (-5036.210) -- 0:04:32
      306000 -- (-5045.989) (-5030.886) [-5039.851] (-5045.208) * (-5042.492) [-5035.140] (-5037.695) (-5036.376) -- 0:04:32
      306500 -- (-5038.425) (-5030.356) (-5035.684) [-5039.170] * (-5035.961) (-5031.137) [-5036.276] (-5042.356) -- 0:04:33
      307000 -- [-5037.247] (-5037.308) (-5038.994) (-5042.306) * (-5034.869) (-5036.666) (-5036.574) [-5043.010] -- 0:04:33
      307500 -- (-5042.087) (-5031.119) (-5035.763) [-5037.864] * [-5032.639] (-5034.445) (-5036.830) (-5036.750) -- 0:04:32
      308000 -- (-5042.910) (-5036.975) (-5045.059) [-5029.565] * (-5033.677) [-5034.700] (-5034.282) (-5035.558) -- 0:04:31
      308500 -- (-5046.833) (-5038.340) [-5042.437] (-5033.010) * (-5035.730) (-5037.719) [-5034.903] (-5033.522) -- 0:04:31
      309000 -- (-5040.730) [-5035.418] (-5037.691) (-5031.161) * [-5038.571] (-5036.017) (-5036.209) (-5031.203) -- 0:04:32
      309500 -- (-5033.481) (-5031.684) [-5031.217] (-5033.855) * [-5037.091] (-5034.378) (-5036.540) (-5032.436) -- 0:04:32
      310000 -- [-5039.470] (-5037.092) (-5031.119) (-5031.149) * (-5036.192) [-5034.176] (-5037.404) (-5039.513) -- 0:04:31

      Average standard deviation of split frequencies: 0.034900

      310500 -- (-5038.615) (-5038.511) (-5034.635) [-5042.020] * (-5040.217) (-5032.438) (-5032.032) [-5035.493] -- 0:04:30
      311000 -- (-5052.477) [-5034.383] (-5032.050) (-5028.854) * (-5048.667) [-5033.336] (-5033.132) (-5038.052) -- 0:04:30
      311500 -- (-5042.151) (-5035.883) (-5032.630) [-5035.371] * (-5048.145) (-5036.020) [-5034.776] (-5034.787) -- 0:04:29
      312000 -- [-5043.127] (-5037.179) (-5031.476) (-5034.107) * (-5037.871) (-5032.919) (-5038.544) [-5035.849] -- 0:04:31
      312500 -- (-5036.511) [-5031.601] (-5030.448) (-5040.844) * (-5038.956) [-5034.168] (-5036.065) (-5035.925) -- 0:04:30
      313000 -- (-5044.205) (-5040.953) [-5027.707] (-5036.966) * (-5038.553) (-5035.012) (-5033.461) [-5029.295] -- 0:04:29
      313500 -- (-5037.330) (-5034.646) [-5032.193] (-5034.794) * (-5032.932) [-5034.161] (-5033.737) (-5034.505) -- 0:04:29
      314000 -- (-5042.302) [-5043.163] (-5032.306) (-5035.362) * (-5038.608) (-5035.001) (-5033.340) [-5033.904] -- 0:04:28
      314500 -- [-5035.260] (-5042.726) (-5033.801) (-5034.330) * (-5043.406) [-5038.331] (-5035.824) (-5030.609) -- 0:04:30
      315000 -- [-5034.133] (-5050.571) (-5032.328) (-5039.832) * [-5038.286] (-5034.713) (-5029.891) (-5035.383) -- 0:04:29

      Average standard deviation of split frequencies: 0.036797

      315500 -- (-5038.102) (-5037.579) (-5033.989) [-5033.059] * [-5034.929] (-5037.249) (-5029.708) (-5038.661) -- 0:04:29
      316000 -- (-5032.234) (-5034.749) (-5038.511) [-5041.143] * (-5028.402) [-5040.478] (-5029.199) (-5043.150) -- 0:04:28
      316500 -- (-5037.143) (-5033.405) [-5036.128] (-5041.534) * [-5036.574] (-5037.628) (-5043.684) (-5043.360) -- 0:04:27
      317000 -- (-5037.227) (-5033.902) (-5034.840) [-5044.404] * (-5030.675) [-5041.781] (-5037.607) (-5037.725) -- 0:04:29
      317500 -- (-5038.565) (-5037.550) (-5033.149) [-5034.624] * [-5034.780] (-5036.196) (-5031.166) (-5042.758) -- 0:04:28
      318000 -- (-5033.048) (-5039.449) [-5035.068] (-5035.542) * (-5035.369) (-5038.302) (-5042.872) [-5036.788] -- 0:04:28
      318500 -- (-5041.933) (-5033.500) (-5036.435) [-5035.290] * (-5037.281) [-5039.987] (-5031.344) (-5036.647) -- 0:04:27
      319000 -- (-5041.114) (-5033.744) [-5032.252] (-5039.324) * [-5042.100] (-5037.805) (-5042.553) (-5036.737) -- 0:04:26
      319500 -- (-5033.581) [-5032.896] (-5039.746) (-5041.204) * (-5047.690) [-5044.629] (-5036.867) (-5036.866) -- 0:04:28
      320000 -- (-5036.168) [-5032.031] (-5032.829) (-5037.950) * [-5039.566] (-5034.459) (-5036.024) (-5038.373) -- 0:04:27

      Average standard deviation of split frequencies: 0.034792

      320500 -- (-5043.340) [-5033.939] (-5037.754) (-5036.510) * [-5038.195] (-5039.159) (-5039.567) (-5036.437) -- 0:04:27
      321000 -- [-5034.066] (-5041.755) (-5037.272) (-5039.237) * (-5037.445) [-5031.256] (-5039.565) (-5034.277) -- 0:04:26
      321500 -- (-5036.156) [-5038.025] (-5034.036) (-5040.771) * (-5035.561) [-5038.002] (-5034.454) (-5036.577) -- 0:04:25
      322000 -- (-5037.203) (-5036.051) (-5037.557) [-5042.702] * (-5041.392) [-5034.376] (-5036.306) (-5041.825) -- 0:04:27
      322500 -- (-5031.311) (-5032.670) (-5039.489) [-5032.012] * (-5036.612) (-5039.801) [-5036.586] (-5038.597) -- 0:04:26
      323000 -- (-5033.444) [-5043.567] (-5039.310) (-5030.792) * (-5032.654) [-5032.349] (-5034.554) (-5035.642) -- 0:04:26
      323500 -- (-5036.690) [-5036.514] (-5035.646) (-5044.578) * (-5035.527) (-5033.833) [-5037.355] (-5033.922) -- 0:04:25
      324000 -- (-5040.214) (-5036.582) [-5031.772] (-5042.684) * (-5036.843) [-5037.167] (-5043.282) (-5030.419) -- 0:04:24
      324500 -- [-5036.228] (-5036.436) (-5043.242) (-5034.559) * [-5043.666] (-5039.049) (-5041.818) (-5037.220) -- 0:04:26
      325000 -- (-5027.688) (-5036.136) [-5034.617] (-5037.276) * (-5039.649) (-5041.511) [-5035.959] (-5039.339) -- 0:04:25

      Average standard deviation of split frequencies: 0.031813

      325500 -- (-5033.452) (-5037.386) (-5034.820) [-5038.308] * (-5031.459) (-5043.790) [-5038.209] (-5042.983) -- 0:04:25
      326000 -- (-5035.757) (-5038.740) (-5035.178) [-5041.060] * (-5039.652) (-5034.091) [-5032.169] (-5031.768) -- 0:04:24
      326500 -- (-5040.313) (-5037.841) [-5036.153] (-5039.178) * (-5043.059) [-5036.972] (-5033.394) (-5035.715) -- 0:04:24
      327000 -- [-5036.210] (-5037.787) (-5040.216) (-5037.428) * [-5035.680] (-5036.551) (-5036.955) (-5029.448) -- 0:04:23
      327500 -- (-5041.529) (-5037.225) [-5029.499] (-5031.621) * (-5037.611) (-5033.714) (-5034.137) [-5034.812] -- 0:04:24
      328000 -- [-5033.893] (-5034.550) (-5030.726) (-5037.903) * (-5043.510) (-5038.254) (-5037.891) [-5036.598] -- 0:04:24
      328500 -- (-5036.663) (-5040.461) [-5035.670] (-5037.505) * (-5031.349) (-5044.299) (-5036.290) [-5032.640] -- 0:04:23
      329000 -- (-5041.575) [-5038.703] (-5047.479) (-5042.867) * (-5033.417) (-5033.157) [-5033.913] (-5036.195) -- 0:04:23
      329500 -- (-5041.195) (-5038.657) [-5037.529] (-5037.952) * [-5029.129] (-5038.814) (-5034.658) (-5037.688) -- 0:04:22
      330000 -- [-5047.534] (-5032.429) (-5039.521) (-5037.091) * (-5038.524) (-5037.194) [-5031.650] (-5035.248) -- 0:04:23

      Average standard deviation of split frequencies: 0.027087

      330500 -- (-5033.871) (-5038.745) [-5034.462] (-5034.627) * (-5038.579) (-5042.770) (-5042.014) [-5032.651] -- 0:04:23
      331000 -- (-5033.056) (-5039.664) [-5033.045] (-5040.456) * (-5045.575) [-5032.895] (-5037.865) (-5034.235) -- 0:04:22
      331500 -- (-5031.935) (-5037.299) (-5032.828) [-5036.681] * (-5042.136) (-5035.989) (-5037.219) [-5037.684] -- 0:04:22
      332000 -- (-5034.037) (-5034.010) [-5034.930] (-5033.855) * (-5037.822) (-5036.454) [-5035.145] (-5040.302) -- 0:04:21
      332500 -- (-5035.049) [-5032.090] (-5038.889) (-5031.789) * (-5030.111) (-5042.610) (-5042.723) [-5031.901] -- 0:04:22
      333000 -- [-5036.372] (-5046.039) (-5036.464) (-5037.344) * (-5034.218) (-5028.441) [-5036.051] (-5036.949) -- 0:04:22
      333500 -- [-5037.165] (-5042.780) (-5034.398) (-5034.204) * [-5034.320] (-5038.978) (-5036.073) (-5033.040) -- 0:04:21
      334000 -- [-5039.948] (-5032.912) (-5035.133) (-5031.868) * (-5033.570) (-5032.099) (-5028.974) [-5032.656] -- 0:04:21
      334500 -- (-5038.488) (-5034.926) [-5036.641] (-5035.817) * (-5041.801) (-5037.391) [-5042.579] (-5035.956) -- 0:04:20
      335000 -- (-5040.327) (-5032.234) [-5036.437] (-5034.650) * [-5035.529] (-5035.748) (-5042.576) (-5034.025) -- 0:04:22

      Average standard deviation of split frequencies: 0.030398

      335500 -- (-5039.000) (-5034.196) [-5036.859] (-5037.223) * (-5036.374) (-5043.755) [-5029.474] (-5035.049) -- 0:04:21
      336000 -- (-5037.390) [-5034.153] (-5034.954) (-5031.437) * (-5042.201) [-5035.205] (-5039.106) (-5035.955) -- 0:04:20
      336500 -- (-5035.808) [-5034.757] (-5036.939) (-5038.128) * (-5035.773) (-5039.378) [-5035.721] (-5033.373) -- 0:04:20
      337000 -- (-5034.925) (-5029.633) [-5035.278] (-5041.084) * (-5039.761) (-5045.576) (-5037.994) [-5034.141] -- 0:04:19
      337500 -- [-5039.914] (-5036.765) (-5035.087) (-5042.969) * (-5039.426) [-5035.572] (-5035.725) (-5031.357) -- 0:04:21
      338000 -- (-5037.508) (-5038.614) [-5031.783] (-5049.034) * (-5033.333) (-5036.943) (-5036.439) [-5030.147] -- 0:04:20
      338500 -- (-5045.436) (-5034.174) (-5035.582) [-5034.792] * (-5029.565) (-5042.894) (-5046.665) [-5033.575] -- 0:04:19
      339000 -- [-5038.013] (-5033.931) (-5031.254) (-5036.238) * (-5041.849) (-5049.183) (-5037.925) [-5035.381] -- 0:04:19
      339500 -- (-5033.012) (-5038.466) (-5033.437) [-5032.864] * (-5027.862) (-5047.195) (-5036.911) [-5036.151] -- 0:04:18
      340000 -- (-5035.433) (-5036.850) [-5030.484] (-5036.433) * (-5033.613) (-5041.307) [-5031.631] (-5035.733) -- 0:04:20

      Average standard deviation of split frequencies: 0.028137

      340500 -- (-5035.796) (-5037.818) [-5035.349] (-5042.760) * (-5035.862) [-5038.858] (-5032.875) (-5037.928) -- 0:04:19
      341000 -- (-5040.473) (-5033.858) [-5038.483] (-5041.683) * [-5034.582] (-5037.462) (-5035.609) (-5034.957) -- 0:04:18
      341500 -- (-5041.241) (-5032.286) [-5029.778] (-5037.008) * [-5032.570] (-5040.274) (-5037.108) (-5034.130) -- 0:04:18
      342000 -- (-5038.839) [-5036.614] (-5033.131) (-5044.686) * (-5028.849) [-5035.289] (-5037.444) (-5037.427) -- 0:04:17
      342500 -- (-5038.033) (-5038.377) [-5035.786] (-5042.686) * (-5034.585) (-5036.371) (-5037.982) [-5033.433] -- 0:04:17
      343000 -- [-5039.128] (-5041.227) (-5032.542) (-5036.454) * (-5039.844) [-5035.985] (-5041.369) (-5031.521) -- 0:04:18
      343500 -- (-5035.451) (-5036.428) [-5030.501] (-5034.571) * (-5039.610) (-5039.994) (-5035.257) [-5031.822] -- 0:04:18
      344000 -- [-5036.047] (-5031.977) (-5031.034) (-5037.937) * (-5045.734) (-5035.170) [-5031.639] (-5034.418) -- 0:04:17
      344500 -- (-5036.524) [-5031.019] (-5041.234) (-5040.845) * [-5033.868] (-5037.625) (-5031.882) (-5036.608) -- 0:04:16
      345000 -- (-5036.250) (-5033.046) (-5034.913) [-5033.840] * (-5033.289) [-5038.045] (-5038.440) (-5035.722) -- 0:04:16

      Average standard deviation of split frequencies: 0.026341

      345500 -- (-5033.218) (-5040.632) [-5040.380] (-5034.600) * (-5035.456) (-5040.254) (-5032.905) [-5033.388] -- 0:04:17
      346000 -- (-5037.004) [-5032.909] (-5039.909) (-5032.895) * (-5041.965) (-5035.246) [-5028.808] (-5036.093) -- 0:04:17
      346500 -- (-5043.013) [-5036.509] (-5043.420) (-5034.342) * (-5036.159) (-5042.692) (-5029.961) [-5038.274] -- 0:04:16
      347000 -- [-5038.438] (-5032.929) (-5039.296) (-5041.439) * [-5041.285] (-5037.356) (-5039.733) (-5037.933) -- 0:04:15
      347500 -- [-5034.046] (-5039.823) (-5038.333) (-5041.421) * (-5043.995) (-5038.858) [-5038.914] (-5042.514) -- 0:04:15
      348000 -- [-5034.529] (-5033.199) (-5034.242) (-5039.882) * [-5042.654] (-5029.474) (-5036.154) (-5035.802) -- 0:04:16
      348500 -- [-5036.829] (-5035.118) (-5034.524) (-5036.725) * (-5038.795) (-5038.441) (-5032.692) [-5038.639] -- 0:04:16
      349000 -- (-5043.179) [-5031.828] (-5036.587) (-5027.444) * (-5037.190) (-5038.251) (-5034.262) [-5037.016] -- 0:04:15
      349500 -- (-5032.716) [-5033.919] (-5040.048) (-5033.393) * (-5035.421) [-5035.650] (-5041.282) (-5041.172) -- 0:04:14
      350000 -- [-5035.459] (-5031.911) (-5036.372) (-5036.065) * (-5034.937) (-5033.950) (-5036.942) [-5037.913] -- 0:04:14

      Average standard deviation of split frequencies: 0.025094

      350500 -- [-5037.055] (-5032.408) (-5043.186) (-5041.658) * (-5038.587) (-5041.489) (-5038.487) [-5036.200] -- 0:04:15
      351000 -- (-5044.855) [-5036.426] (-5036.659) (-5037.050) * [-5031.627] (-5038.615) (-5031.449) (-5033.982) -- 0:04:15
      351500 -- [-5043.224] (-5037.160) (-5038.312) (-5037.824) * [-5037.195] (-5037.188) (-5031.780) (-5038.759) -- 0:04:14
      352000 -- (-5037.895) (-5034.711) [-5037.494] (-5048.180) * [-5031.949] (-5031.789) (-5037.905) (-5041.256) -- 0:04:14
      352500 -- (-5039.714) (-5032.511) [-5040.161] (-5040.409) * [-5031.078] (-5038.582) (-5042.524) (-5032.485) -- 0:04:13
      353000 -- (-5035.234) (-5036.225) [-5038.339] (-5033.650) * (-5035.091) (-5038.567) (-5032.574) [-5033.055] -- 0:04:14
      353500 -- (-5035.360) (-5033.685) [-5036.883] (-5035.509) * (-5038.488) [-5036.693] (-5027.957) (-5034.949) -- 0:04:14
      354000 -- [-5032.347] (-5039.171) (-5034.288) (-5032.053) * (-5036.243) (-5051.353) [-5030.959] (-5037.695) -- 0:04:13
      354500 -- [-5038.957] (-5039.564) (-5043.612) (-5033.776) * (-5034.221) (-5046.403) (-5033.758) [-5030.975] -- 0:04:13
      355000 -- (-5042.963) (-5033.872) (-5034.664) [-5038.232] * (-5043.885) (-5037.793) (-5034.240) [-5029.804] -- 0:04:12

      Average standard deviation of split frequencies: 0.023835

      355500 -- (-5033.254) (-5034.664) (-5035.022) [-5032.870] * (-5044.590) [-5040.448] (-5031.238) (-5035.928) -- 0:04:11
      356000 -- (-5038.330) [-5037.816] (-5041.976) (-5030.529) * (-5034.999) (-5031.526) (-5036.158) [-5034.072] -- 0:04:13
      356500 -- [-5034.575] (-5042.588) (-5039.247) (-5032.579) * [-5035.381] (-5031.759) (-5036.187) (-5031.635) -- 0:04:12
      357000 -- (-5032.874) (-5041.241) [-5038.555] (-5042.635) * (-5032.622) (-5036.195) [-5038.016] (-5035.136) -- 0:04:12
      357500 -- (-5044.561) (-5045.459) [-5036.330] (-5051.957) * (-5036.839) (-5043.671) (-5031.419) [-5043.637] -- 0:04:11
      358000 -- (-5038.428) [-5031.157] (-5041.527) (-5029.232) * (-5032.635) (-5034.817) (-5037.316) [-5037.602] -- 0:04:11
      358500 -- [-5032.216] (-5037.926) (-5035.858) (-5038.941) * [-5031.228] (-5037.344) (-5033.024) (-5036.415) -- 0:04:12
      359000 -- (-5045.608) (-5040.889) [-5035.611] (-5038.547) * (-5033.949) (-5037.721) [-5032.128] (-5032.763) -- 0:04:11
      359500 -- (-5029.364) [-5045.840] (-5029.669) (-5039.321) * (-5032.528) (-5036.585) (-5037.538) [-5039.058] -- 0:04:11
      360000 -- (-5037.751) (-5043.927) [-5037.025] (-5040.527) * (-5035.040) (-5039.091) [-5035.520] (-5036.473) -- 0:04:10

      Average standard deviation of split frequencies: 0.026576

      360500 -- (-5030.783) (-5044.973) (-5037.286) [-5036.678] * (-5031.946) [-5034.561] (-5032.353) (-5042.656) -- 0:04:10
      361000 -- (-5038.885) (-5035.066) [-5035.995] (-5042.635) * [-5035.885] (-5046.871) (-5031.338) (-5039.542) -- 0:04:11
      361500 -- (-5035.015) (-5042.415) [-5033.532] (-5034.080) * (-5036.450) (-5038.317) (-5033.681) [-5035.877] -- 0:04:10
      362000 -- (-5034.964) (-5039.560) [-5033.955] (-5034.324) * (-5036.166) (-5036.489) [-5030.620] (-5050.771) -- 0:04:10
      362500 -- (-5035.535) (-5040.597) [-5031.464] (-5038.110) * (-5032.809) (-5035.874) [-5035.880] (-5033.886) -- 0:04:09
      363000 -- (-5035.816) (-5036.720) (-5036.883) [-5039.305] * (-5040.698) [-5031.282] (-5043.423) (-5035.145) -- 0:04:09
      363500 -- (-5038.377) [-5038.783] (-5037.282) (-5036.816) * (-5038.190) (-5031.075) (-5039.856) [-5034.359] -- 0:04:10
      364000 -- (-5042.276) (-5034.532) [-5032.683] (-5034.404) * (-5037.646) [-5033.099] (-5041.514) (-5034.799) -- 0:04:09
      364500 -- (-5039.091) [-5046.281] (-5032.223) (-5037.744) * (-5042.300) (-5039.916) (-5046.145) [-5037.832] -- 0:04:09
      365000 -- (-5033.601) [-5041.940] (-5037.995) (-5038.172) * (-5030.342) (-5039.495) [-5038.792] (-5030.171) -- 0:04:08

      Average standard deviation of split frequencies: 0.025330

      365500 -- (-5036.275) (-5039.636) (-5033.392) [-5039.410] * (-5029.955) (-5035.228) (-5031.454) [-5031.452] -- 0:04:08
      366000 -- (-5040.472) (-5033.300) [-5037.185] (-5038.101) * (-5037.060) (-5036.928) [-5045.564] (-5038.239) -- 0:04:09
      366500 -- [-5032.568] (-5032.344) (-5032.039) (-5034.383) * (-5034.668) (-5038.092) [-5032.204] (-5038.012) -- 0:04:08
      367000 -- (-5036.460) (-5033.558) (-5035.775) [-5040.431] * (-5039.051) [-5030.280] (-5034.238) (-5040.884) -- 0:04:08
      367500 -- [-5031.634] (-5039.092) (-5039.773) (-5046.115) * (-5034.565) (-5031.753) (-5036.198) [-5035.751] -- 0:04:07
      368000 -- (-5037.336) (-5034.989) [-5035.449] (-5043.336) * (-5041.028) (-5036.019) [-5029.350] (-5036.535) -- 0:04:07
      368500 -- (-5030.586) (-5038.332) (-5035.018) [-5035.889] * (-5044.683) [-5031.258] (-5033.402) (-5034.090) -- 0:04:08
      369000 -- [-5036.680] (-5034.978) (-5039.413) (-5035.886) * (-5048.817) (-5041.459) [-5038.257] (-5034.094) -- 0:04:07
      369500 -- (-5034.685) (-5041.609) (-5032.325) [-5033.638] * (-5038.062) (-5038.403) [-5038.795] (-5042.242) -- 0:04:07
      370000 -- (-5029.788) [-5035.217] (-5040.488) (-5041.646) * (-5032.011) (-5036.807) (-5042.772) [-5039.873] -- 0:04:06

      Average standard deviation of split frequencies: 0.025859

      370500 -- (-5032.454) (-5037.218) (-5034.698) [-5031.369] * (-5039.395) (-5035.210) (-5034.555) [-5033.555] -- 0:04:06
      371000 -- (-5035.378) (-5040.305) [-5035.834] (-5036.033) * (-5036.165) (-5037.806) [-5032.889] (-5039.921) -- 0:04:05
      371500 -- [-5032.158] (-5033.046) (-5038.399) (-5032.275) * (-5038.223) (-5037.879) (-5035.488) [-5034.518] -- 0:04:07
      372000 -- (-5038.704) (-5036.297) (-5033.480) [-5034.202] * (-5040.306) [-5040.391] (-5039.474) (-5032.338) -- 0:04:06
      372500 -- (-5034.066) (-5033.946) (-5037.450) [-5033.086] * (-5032.242) (-5044.482) [-5040.463] (-5036.317) -- 0:04:05
      373000 -- (-5039.670) (-5040.364) (-5046.243) [-5035.922] * (-5040.788) [-5036.778] (-5036.275) (-5039.147) -- 0:04:05
      373500 -- (-5033.435) [-5037.768] (-5036.650) (-5034.434) * (-5031.461) [-5034.335] (-5036.945) (-5038.909) -- 0:04:04
      374000 -- (-5040.988) (-5037.649) (-5039.373) [-5034.274] * (-5032.381) (-5042.398) (-5033.584) [-5031.053] -- 0:04:06
      374500 -- (-5038.584) (-5039.699) [-5036.400] (-5037.318) * (-5032.515) (-5040.687) (-5038.773) [-5034.021] -- 0:04:05
      375000 -- (-5040.687) (-5037.788) [-5034.614] (-5041.834) * (-5033.897) (-5033.524) [-5037.474] (-5036.851) -- 0:04:05

      Average standard deviation of split frequencies: 0.023403

      375500 -- (-5042.422) (-5033.463) (-5035.502) [-5032.728] * (-5030.753) [-5035.920] (-5044.046) (-5049.977) -- 0:04:04
      376000 -- (-5040.469) (-5037.733) [-5034.375] (-5031.058) * (-5032.960) (-5032.330) (-5045.014) [-5038.207] -- 0:04:03
      376500 -- [-5038.253] (-5038.507) (-5035.970) (-5037.097) * [-5032.473] (-5035.597) (-5042.141) (-5035.707) -- 0:04:05
      377000 -- (-5035.632) (-5033.445) (-5036.673) [-5037.751] * (-5045.875) (-5041.567) (-5036.912) [-5033.973] -- 0:04:04
      377500 -- (-5036.804) [-5030.691] (-5045.895) (-5036.150) * [-5036.367] (-5033.000) (-5031.222) (-5029.782) -- 0:04:04
      378000 -- (-5035.941) (-5033.134) (-5036.981) [-5033.218] * (-5038.262) [-5036.133] (-5041.253) (-5028.876) -- 0:04:03
      378500 -- (-5036.414) (-5039.510) (-5034.159) [-5031.586] * (-5039.323) [-5039.709] (-5035.545) (-5038.978) -- 0:04:03
      379000 -- [-5032.250] (-5040.774) (-5036.151) (-5035.015) * [-5034.114] (-5046.057) (-5032.613) (-5039.662) -- 0:04:04
      379500 -- [-5036.477] (-5048.612) (-5035.171) (-5038.563) * (-5037.222) (-5036.434) [-5039.969] (-5036.194) -- 0:04:03
      380000 -- (-5036.639) (-5035.987) (-5036.008) [-5031.597] * [-5035.102] (-5040.019) (-5038.730) (-5043.059) -- 0:04:03

      Average standard deviation of split frequencies: 0.023529

      380500 -- [-5029.944] (-5040.618) (-5037.543) (-5040.879) * [-5041.188] (-5037.440) (-5039.931) (-5040.366) -- 0:04:02
      381000 -- [-5034.674] (-5037.323) (-5034.673) (-5033.921) * [-5036.615] (-5036.041) (-5032.828) (-5046.865) -- 0:04:02
      381500 -- (-5039.111) (-5033.753) (-5033.767) [-5029.965] * (-5032.112) (-5037.972) (-5036.368) [-5036.125] -- 0:04:03
      382000 -- (-5031.395) (-5034.706) (-5044.778) [-5035.473] * (-5038.292) (-5046.894) [-5032.135] (-5038.983) -- 0:04:02
      382500 -- (-5036.576) (-5034.632) (-5037.318) [-5030.095] * [-5029.940] (-5041.017) (-5034.124) (-5037.295) -- 0:04:02
      383000 -- (-5042.114) (-5043.060) (-5040.768) [-5037.693] * (-5038.015) (-5036.396) [-5032.232] (-5040.213) -- 0:04:01
      383500 -- (-5028.935) (-5038.158) (-5037.741) [-5043.228] * (-5035.856) (-5033.734) (-5034.231) [-5035.273] -- 0:04:01
      384000 -- (-5034.193) (-5033.608) [-5031.406] (-5035.660) * (-5035.373) (-5031.538) (-5030.862) [-5031.373] -- 0:04:02
      384500 -- [-5035.032] (-5045.207) (-5034.558) (-5038.197) * [-5035.182] (-5046.677) (-5031.144) (-5033.378) -- 0:04:01
      385000 -- (-5037.666) (-5040.172) (-5044.506) [-5030.827] * (-5033.720) (-5037.038) [-5040.648] (-5045.456) -- 0:04:01

      Average standard deviation of split frequencies: 0.024425

      385500 -- [-5036.033] (-5034.472) (-5044.670) (-5036.359) * (-5030.465) [-5037.334] (-5032.662) (-5040.062) -- 0:04:00
      386000 -- (-5034.529) [-5036.137] (-5041.580) (-5036.955) * (-5034.468) [-5041.803] (-5042.326) (-5036.577) -- 0:04:00
      386500 -- [-5036.122] (-5036.552) (-5031.946) (-5041.163) * [-5034.623] (-5041.904) (-5036.498) (-5037.290) -- 0:03:59
      387000 -- (-5038.085) [-5035.410] (-5045.611) (-5037.346) * (-5035.523) (-5035.738) [-5035.176] (-5039.877) -- 0:04:00
      387500 -- [-5034.211] (-5045.298) (-5039.632) (-5033.857) * (-5035.988) (-5036.685) (-5040.025) [-5033.785] -- 0:04:00
      388000 -- (-5041.521) (-5040.520) (-5047.339) [-5035.574] * (-5037.138) (-5035.721) [-5035.627] (-5037.073) -- 0:03:59
      388500 -- (-5031.757) [-5031.456] (-5039.108) (-5031.492) * (-5038.119) (-5036.674) [-5035.884] (-5050.768) -- 0:03:59
      389000 -- [-5029.981] (-5039.137) (-5038.621) (-5033.998) * (-5035.357) (-5034.751) [-5029.692] (-5046.334) -- 0:03:58
      389500 -- (-5031.768) (-5038.792) (-5038.892) [-5036.929] * [-5035.286] (-5040.251) (-5032.501) (-5046.839) -- 0:03:59
      390000 -- (-5030.464) (-5040.651) [-5034.710] (-5035.467) * (-5037.953) (-5033.873) (-5032.064) [-5041.856] -- 0:03:59

      Average standard deviation of split frequencies: 0.026144

      390500 -- [-5030.803] (-5042.687) (-5032.307) (-5038.761) * (-5040.135) (-5043.381) (-5035.502) [-5031.003] -- 0:03:58
      391000 -- (-5032.841) (-5038.924) (-5038.977) [-5030.178] * (-5038.752) [-5034.490] (-5032.096) (-5033.724) -- 0:03:58
      391500 -- (-5042.106) (-5032.914) (-5041.640) [-5040.761] * (-5040.588) (-5030.713) [-5034.468] (-5036.595) -- 0:03:57
      392000 -- (-5032.725) [-5031.993] (-5035.291) (-5041.983) * (-5033.795) (-5032.561) (-5037.598) [-5039.483] -- 0:03:58
      392500 -- [-5035.077] (-5027.888) (-5047.368) (-5040.278) * (-5032.989) (-5034.090) (-5037.003) [-5039.025] -- 0:03:58
      393000 -- (-5044.062) (-5031.330) [-5041.030] (-5047.442) * [-5039.063] (-5037.179) (-5036.323) (-5038.444) -- 0:03:57
      393500 -- (-5035.103) (-5044.037) (-5045.631) [-5042.288] * [-5036.109] (-5034.909) (-5035.288) (-5036.400) -- 0:03:57
      394000 -- (-5032.951) (-5043.498) (-5031.489) [-5037.161] * [-5038.161] (-5036.607) (-5034.609) (-5033.875) -- 0:03:56
      394500 -- [-5032.300] (-5033.743) (-5034.831) (-5045.965) * [-5035.109] (-5033.204) (-5033.098) (-5046.232) -- 0:03:57
      395000 -- (-5032.156) [-5040.156] (-5034.610) (-5039.047) * (-5034.301) [-5035.705] (-5037.860) (-5038.779) -- 0:03:57

      Average standard deviation of split frequencies: 0.028967

      395500 -- (-5042.848) (-5034.661) (-5031.382) [-5034.626] * [-5036.841] (-5033.459) (-5038.458) (-5032.790) -- 0:03:56
      396000 -- (-5041.484) (-5041.007) (-5038.554) [-5035.758] * (-5038.360) (-5033.482) (-5036.422) [-5039.253] -- 0:03:56
      396500 -- [-5041.739] (-5035.975) (-5037.026) (-5031.964) * (-5037.821) (-5034.871) [-5032.337] (-5036.883) -- 0:03:55
      397000 -- [-5036.735] (-5037.678) (-5035.990) (-5036.744) * (-5033.100) (-5039.915) [-5033.525] (-5046.293) -- 0:03:56
      397500 -- (-5033.348) (-5041.770) [-5035.307] (-5041.280) * (-5030.944) (-5032.234) [-5037.932] (-5038.638) -- 0:03:56
      398000 -- (-5039.207) (-5046.764) [-5031.136] (-5036.968) * [-5035.923] (-5029.253) (-5033.059) (-5034.342) -- 0:03:55
      398500 -- (-5044.282) (-5039.107) [-5029.340] (-5035.367) * [-5039.829] (-5035.446) (-5039.922) (-5042.645) -- 0:03:55
      399000 -- (-5034.816) (-5037.845) (-5031.594) [-5042.732] * (-5032.140) [-5029.136] (-5034.532) (-5039.115) -- 0:03:54
      399500 -- (-5031.088) [-5037.117] (-5034.464) (-5032.117) * (-5035.372) [-5032.266] (-5044.325) (-5037.196) -- 0:03:55
      400000 -- (-5041.582) [-5040.077] (-5034.055) (-5047.867) * (-5037.404) [-5034.772] (-5038.528) (-5044.256) -- 0:03:55

      Average standard deviation of split frequencies: 0.029022

      400500 -- (-5039.746) [-5037.372] (-5035.058) (-5049.716) * (-5036.760) (-5033.162) (-5038.695) [-5034.909] -- 0:03:55
      401000 -- (-5036.464) (-5037.595) [-5035.034] (-5037.263) * (-5038.701) [-5037.285] (-5032.105) (-5033.994) -- 0:03:54
      401500 -- (-5035.174) (-5030.227) [-5030.954] (-5038.055) * (-5038.068) [-5037.334] (-5034.836) (-5034.427) -- 0:03:54
      402000 -- [-5034.855] (-5036.224) (-5039.531) (-5032.637) * (-5039.960) [-5039.973] (-5038.494) (-5035.634) -- 0:03:55
      402500 -- [-5035.184] (-5033.571) (-5041.880) (-5031.549) * (-5037.838) (-5034.548) (-5031.885) [-5032.010] -- 0:03:54
      403000 -- (-5034.672) [-5033.151] (-5042.069) (-5041.812) * [-5035.690] (-5038.307) (-5033.196) (-5045.401) -- 0:03:54
      403500 -- [-5042.160] (-5036.041) (-5029.539) (-5034.736) * (-5036.493) [-5042.437] (-5030.460) (-5034.627) -- 0:03:53
      404000 -- [-5036.449] (-5036.859) (-5036.747) (-5039.183) * [-5035.038] (-5040.255) (-5030.938) (-5043.749) -- 0:03:53
      404500 -- [-5034.790] (-5046.088) (-5048.713) (-5037.080) * [-5042.228] (-5042.786) (-5029.275) (-5034.639) -- 0:03:52
      405000 -- (-5041.266) (-5043.148) (-5033.150) [-5040.429] * (-5033.093) (-5036.593) [-5036.039] (-5037.903) -- 0:03:53

      Average standard deviation of split frequencies: 0.030963

      405500 -- (-5040.158) (-5044.006) (-5034.221) [-5038.649] * (-5044.891) (-5033.402) [-5039.520] (-5040.944) -- 0:03:53
      406000 -- (-5031.417) (-5039.817) (-5030.481) [-5045.328] * (-5050.423) (-5034.734) (-5038.525) [-5034.214] -- 0:03:52
      406500 -- (-5031.392) [-5047.391] (-5036.391) (-5030.958) * (-5042.181) [-5034.840] (-5039.955) (-5032.862) -- 0:03:52
      407000 -- [-5034.851] (-5039.748) (-5042.147) (-5035.013) * (-5050.880) (-5041.754) (-5037.038) [-5036.819] -- 0:03:51
      407500 -- [-5033.278] (-5031.555) (-5032.227) (-5044.504) * (-5044.753) [-5030.716] (-5032.830) (-5042.930) -- 0:03:52
      408000 -- [-5031.983] (-5035.450) (-5036.865) (-5033.731) * (-5030.970) (-5039.104) [-5033.929] (-5037.242) -- 0:03:52
      408500 -- (-5034.589) (-5031.063) [-5037.345] (-5034.156) * (-5032.667) (-5040.088) [-5035.148] (-5035.369) -- 0:03:51
      409000 -- [-5045.072] (-5043.373) (-5038.227) (-5039.482) * (-5040.246) (-5049.688) (-5038.198) [-5038.650] -- 0:03:51
      409500 -- [-5034.252] (-5038.616) (-5035.997) (-5036.463) * (-5033.634) (-5035.649) [-5042.723] (-5035.188) -- 0:03:50
      410000 -- (-5030.118) (-5037.764) (-5036.613) [-5032.707] * (-5030.965) (-5031.746) [-5045.219] (-5031.482) -- 0:03:51

      Average standard deviation of split frequencies: 0.030228

      410500 -- [-5033.882] (-5031.922) (-5040.037) (-5033.435) * (-5034.213) [-5040.722] (-5029.646) (-5033.659) -- 0:03:51
      411000 -- (-5037.775) (-5040.077) [-5041.232] (-5043.749) * [-5032.548] (-5031.666) (-5037.375) (-5033.421) -- 0:03:50
      411500 -- (-5038.091) (-5030.982) [-5039.428] (-5037.070) * (-5034.505) (-5036.042) (-5038.157