--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 24 15:44:52 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/330/Nuf2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2632.69         -2642.17
2      -2632.80         -2643.27
--------------------------------------
TOTAL    -2632.74         -2642.86
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.292868    0.001361    0.224653    0.367981    0.289951    986.92   1073.57    1.000
r(A<->C){all}   0.050930    0.000446    0.009480    0.091528    0.049243    828.56    962.88    1.000
r(A<->G){all}   0.230984    0.001446    0.160011    0.307104    0.229374    943.49    980.67    1.001
r(A<->T){all}   0.196709    0.001489    0.124742    0.274732    0.194372    960.58   1031.38    1.000
r(C<->G){all}   0.074950    0.000425    0.036467    0.114605    0.072965   1077.02   1146.95    1.000
r(C<->T){all}   0.401968    0.002854    0.293142    0.498728    0.400924    859.86    899.34    1.001
r(G<->T){all}   0.044459    0.000424    0.007163    0.084166    0.041969    956.47   1055.02    1.000
pi(A){all}      0.304265    0.000159    0.280239    0.329815    0.304430   1079.01   1092.81    1.000
pi(C){all}      0.240237    0.000140    0.217410    0.262573    0.240090   1243.29   1305.74    1.000
pi(G){all}      0.268793    0.000150    0.245567    0.293464    0.268783   1224.14   1362.57    1.001
pi(T){all}      0.186705    0.000114    0.167092    0.207413    0.186623   1244.13   1295.38    1.000
alpha{1,2}      0.058569    0.001669    0.000154    0.133288    0.052753    885.29   1193.14    1.000
alpha{3}        2.072164    0.644669    0.758400    3.715849    1.941542   1269.79   1293.13    1.000
pinvar{all}     0.292851    0.009272    0.079044    0.459891    0.302357   1125.25   1200.08    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2545.585251
Model 2: PositiveSelection	-2545.585251
Model 0: one-ratio	-2549.397152
Model 3: discrete	-2545.563025
Model 7: beta	-2545.617532
Model 8: beta&w>1	-2545.578077


Model 0 vs 1	7.623802000000069

Model 2 vs 1	0.0

Model 8 vs 7	0.07891000000017812
>C1
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE
HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN
YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR
KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST
>C2
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE
HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN
YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR
KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST
>C3
MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR
LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP
TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ
LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ
TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE
HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN
YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR
KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST
>C4
MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR
MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ
LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH
NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE
HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN
YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR
KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=395 

C1              MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
C2              MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
C3              MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR
C4              MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR
                **:*.******:*************.********:**********.:***

C1              LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
C2              LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
C3              LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP
C4              MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP
                :*******:**.*******:**********************:*:*****

C1              AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
C2              AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
C3              TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ
C4              AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ
                :*******************:*****:******:***:**::*:*:****

C1              LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
C2              LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
C3              LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ
C4              LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH
                *:****:**:******:*********************:*.:***:  *:

C1              GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE
C2              SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE
C3              TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE
C4              NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE
                 * :******:*****:*********************:******* *:*

C1              HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN
C2              HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN
C3              HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN
C4              HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN
                ***:*******.::****** :* **:****** ****::****** ***

C1              YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR
C2              YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR
C3              YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR
C4              YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR
                *** ****:***:**.*  :*****.*********: .**::********

C1              KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST
C2              KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST
C3              KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST
C4              KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST
                *******.: *:****:** ***** :*.*****.*****: ***




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  395 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  395 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4740]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4740]--->[4740]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.253 Mb, Max= 30.560 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE
HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN
YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR
KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST
>C2
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE
HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN
YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR
KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST
>C3
MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR
LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP
TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ
LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ
TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE
HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN
YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR
KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST
>C4
MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR
MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ
LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH
NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE
HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN
YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR
KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST

FORMAT of file /tmp/tmp7887021195037828782aln Not Supported[FATAL:T-COFFEE]
>C1
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE
HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN
YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR
KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST
>C2
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE
HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN
YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR
KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST
>C3
MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR
LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP
TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ
LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ
TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE
HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN
YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR
KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST
>C4
MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR
MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ
LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH
NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE
HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN
YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR
KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:395 S:100 BS:395
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.71 C1	 C2	 96.71
TOP	    1    0	 96.71 C2	 C1	 96.71
BOT	    0    2	 88.61 C1	 C3	 88.61
TOP	    2    0	 88.61 C3	 C1	 88.61
BOT	    0    3	 87.34 C1	 C4	 87.34
TOP	    3    0	 87.34 C4	 C1	 87.34
BOT	    1    2	 89.62 C2	 C3	 89.62
TOP	    2    1	 89.62 C3	 C2	 89.62
BOT	    1    3	 87.59 C2	 C4	 87.59
TOP	    3    1	 87.59 C4	 C2	 87.59
BOT	    2    3	 83.54 C3	 C4	 83.54
TOP	    3    2	 83.54 C4	 C3	 83.54
AVG	 0	 C1	  *	 90.89
AVG	 1	 C2	  *	 91.31
AVG	 2	 C3	  *	 87.26
AVG	 3	 C4	  *	 86.16
TOT	 TOT	  *	 88.90
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCGTTATCAGTCGAAATTGAAAGGGTAATGGACCAGGGCAACTGCCT
C2              ATGGCGTTATCAGTCGAAATTGAGAGGGTAATGGACCAGGGCAACTGCCT
C3              ATGGCGTTTTCAGCCGAAATTGAGAGGGTGATGGACCAGGGCAACTGTCT
C4              ATGGCGCTTTCAGCCGAAATAGAGAGGGTTATGAACCAGGGCAACTGCCT
                ****** *:**** ******:**.***** ***.************* **

C1              GATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACCGAGC
C2              AATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACGGAGC
C3              GATGCCAGACATCAACATTTGCCAGAGCGACTTGGCCAATCCCACCGAAC
C4              GATGCCCGACATCAACATTTGCCAGAACGACTTGGCCAATCCCACCGAGC
                .*****.******** ** *****.*.****************** **.*

C1              CCATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC
C2              CGATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC
C3              CATTTGTCACCAAGATCATGGTGCACTATTTGCGGTGTTACGGTTTCCGC
C4              CCCTTGTCACCAAGATCATGGTGCACTATCTGCGTAGTTTCGGTTTCCGC
                *  ************************** **** :***:*** ** ***

C1              CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA
C2              CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA
C3              CTGGAGCCGCCATATAAGATTGGCTCCGAACTCGGCCACTCGTCGCGGGA
C4              ATGGAGCCGCCCTATAAGATTGGCACCGAACTCGCCCACTCATCGCGCGA
                .**********.************:*********  *****.***** **

C1              GGCGCGCGTCTTTCTTATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC
C2              GGCGCGCGTCTTTCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC
C3              GGCGCGCGTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC
C4              GGCGCGCCTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC
                ******* **** ** ***************************** ****

C1              AGATCAGCTTTCCCAACAAGACGTACACCTATATGGACATAATTAAACCA
C2              AGATCAGCTTTCCCAACAAGACCTACACCTATATGGACATAATTAAACCA
C3              AGATCAGCTTTCCCAACAAGACCTACTCCTATGTGGATATTATAAAACCA
C4              AGATCAGCTTTCCCAACAAGACCTACACCTATGTGGATATCATAAAGCCA
                ********************** ***:*****.**** ** **:**.***

C1              GCTGTTAAAAAAACGCTCGCCACGCTGAGCTACCTTTTCAACCATCTGGC
C2              GCTGTTAAAAAAACGCTCGCCACTCTGAGCTACCTTTTCAACCACCTGGC
C3              ACTGTTAAAAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC
C4              GCTGTTAAGAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC
                .*******.******** ** ** ******************** *****

C1              CTACTACAAGGTGTTCAAAAAGAAGGTGCTGGGACCTGTAGAGGAGGCCA
C2              CTACTACAAGGTGTTTAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA
C3              CTACTACAAAATGTTCAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA
C4              CTACTACAAAGTGTTCAAAAAGAAGGTGGTGGGGCCTGTAGAGGAGGCCC
                *********..**** ************ ****.**:************.

C1              TTAAGCTAAAGGATTCGCTGACCGCCGAGGTGAAGGCCAAAAGTCAACAG
C2              TTAAGCTAAAGGATTCGCTGACAGCCGAGGTGAAGGCCAAGAGTCAACAG
C3              TTAAGCTTAAAGAATCGCTGACAACCGAGGTGAAGGCCAAGAGTCAACAG
C4              TTAAGCTGAAGGACTCGCTGGCTGCCGAGCTGAAGACCAAGAGTCAACAG
                ******* **.** ******.* .***** *****.****.*********

C1              CTGGAGCAATGCAGCCAGAAGACGAAGGATTGCGAAGTGGCCATAAACAA
C2              CTGGAGCAATGCAGTCAGAAGACGAAGGATTGCGAAGTGGCCATCAACAA
C3              CTGGATCAATGCAGTCAGAAGACCAAGGATTGCGAAGTGGCCATCAACCA
C4              CTGGAGCAGTGCAGTCAGAACACCAAGGAATGCGAAGTGGCCATCAACCA
                ***** **.***** ***** ** *****:**************.***.*

C1              ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA
C2              ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA
C3              ACTCAAAAAGGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA
C4              ACTTAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCATTGAAAA
                *** **.**.********************************:*****.*

C1              AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATTGAGCAGCAGCAG
C2              AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATCGAGCAGCAGCAG
C3              AGTCCTGCAGCGAGCATGAAAGCACTCTGGAACTTCTCGCACAGCAGCAA
C4              AGTCCTGCAGCGAGCAGGAAAACGCTCTGGAACTTCTCGAGCTGCAGCAT
                ******* ******** ****.*.********** .* *..*:****** 

C1              GGTGAGCTGGACAAACGCATCGGTCACTGGGAACAGCTAGTGGTGGAGGA
C2              AGTGAGCTGGACAAACGCATCGGTCACTGGGAGCAGCTAGTGGTGGAGGA
C3              ACTGAGCAGGAGAAACGTATCGGTCACTGGAAGCAGCTAGTGGTAGAGGA
C4              AATGAGTTGGACAAACGTATAGGACACTGGGAGCAGCTAGTGGTGGAGGA
                . **** :*** ***** **.**:******.*.***********.*****

C1              CAGTCAAGTGACAGAGCTGCGAGAGAAAATTAAGAGCGCATCGTCGCATG
C2              CAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCGTCGCATG
C3              CAGCCAAGTGACTGAGCTGCGAGAGAAGATTAAGAGTGCATCCTCGCATG
C4              GAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCCTCGCATG
                 ** ********:**.***********.******** ***** *******

C1              TCGAGAGCTGCAAGACGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA
C2              TCGAGAGCTGCAAGGCGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA
C3              TGGAGAGCTGCAAGGCGGAGCTGGCCAGCAAAAAACAGGAGACGAATGAA
C4              TCGAGAGCTGCAAGACGGAGCTGGCCAGCAAAAAACAGGAGACGAAAGAA
                * ************.************* **********:******:***

C1              CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA
C2              CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA
C3              CACCGCCGGATAATTGAAAACAGTCAACATATAGCCACCGCTTTAGAGAA
C4              CATCGCCGGATAATCGAAAACAGCCAACACATAGTCGCCTCCTTGGAGAA
                ** ********.** ******** ***** **** *.** * **.*****

C1              GGCCACGGCTGTGCTTTCGCTGTGCAAGGTGGATGATTACAAAGAGAGCT
C2              GGCCACGGCTGTGCTTTCGCAGTGCAAAGTGGATGATTACAAAGAGAGCT
C3              GGCCACGGCTATGATTTCGCTGTGCAAACTGGATGACTACAAGGAGAGCT
C4              AGCCACGGCTGCGCTTTCGCTGTGCAAAGTGGATGACTACAAGGAGAGCT
                .*********. *.******:******. ******* *****.*******

C1              TCAAGCAGCTGGAGGCAGTGGAAAAGCAGTTGCCCACCTGTAAAGTTAAT
C2              TGAAGCAGCTGGAGGCAGTGGAGAAGCAGTTGCCCACCTGGAAGGTTAAT
C3              GCAAGCAGCTGGAGACGATGGAGAAGCAGTTGCCCACCTGCAAGGTAAAT
C4              TCAAGCAGCTGGAGGCGGTGGAGAAGCAGTTGCCCACCTGGAAGGTCAAT
                  ************.*..****.***************** **.** ***

C1              TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT
C2              TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT
C3              TATCAGAAGCGCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT
C4              TATCAGAAGCGCCTTCAGGATGCAAAGGCCAAGAAGGAGGAACTCGGTCT
                ********** *************.*********** ********* ***

C1              TTGTGCACATCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC
C2              TTGTGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC
C3              TCGAGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAACC
C4              TTGTGATCAGCGGTACGAGGAAAGAAGCCAGGAAAACGATGCCGAGAATC
                * *:*.:** ****************.********************* *

C1              ACAAGGTGCAAAATGAACTCAAAAAGCTGCAGGTCGATGTTGAGGATCGC
C2              ACAAGCTGCAAAACGAACTCAAACAGCTGCAGGTTGATGTTGAGGATCGC
C3              ACAAGCTGCATAGCGAACTCAATCAGCTGCAGGTCGACGTTGAGGATCGC
C4              ACAAGCTGCTTAACGAACTCAAACAGCTGCAGGTCGATGTTGAGGATCGC
                ***** ***::*. ********:.********** ** ************

C1              AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCA
C2              AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCG
C3              AAGAAACGCCTGGAGGATCTAAGTAATACCTTGATCGAGCTTGACCAGCA
C4              AAGAAACGCCTAGAGGATCTGAGTAAAAACTTGGTCGAGCTTGACCAGCG
                ******** **.********.*.***:..****.*******:*******.

C1              AAATTTGGAGCAAGATCAGCTATATGCCATATTAAATGAGCAAATCCATG
C2              AAATTTGGAGCAAGATCAGTTATATGCCATATTAAGTGAGCAAATCCATG
C3              AAATTTGGAGCAAGATCAGCTGTACGACATATTAAGTGAGCAAATCCACG
C4              AAATTTGGGGCAAGATCAGCTGTATGCCATGTTAAATGAGCAAATCCATG
                ********.********** *.** *.***.****.************ *

C1              AGGTTCTCGGACAAAACTGGCAGATGAATTCCACT
C2              AGGCTCTCGGCCAAAACTGGCAGACGAATTCCACT
C3              AGGCTCTCGGTCAAAACTGGCAGATAAATTCCACT
C4              AGGCTCTTGGCCAAAACTGGCATATGAATTCCACT
                *** *** ** *********** * .*********



>C1
ATGGCGTTATCAGTCGAAATTGAAAGGGTAATGGACCAGGGCAACTGCCT
GATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACCGAGC
CCATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC
CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA
GGCGCGCGTCTTTCTTATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC
AGATCAGCTTTCCCAACAAGACGTACACCTATATGGACATAATTAAACCA
GCTGTTAAAAAAACGCTCGCCACGCTGAGCTACCTTTTCAACCATCTGGC
CTACTACAAGGTGTTCAAAAAGAAGGTGCTGGGACCTGTAGAGGAGGCCA
TTAAGCTAAAGGATTCGCTGACCGCCGAGGTGAAGGCCAAAAGTCAACAG
CTGGAGCAATGCAGCCAGAAGACGAAGGATTGCGAAGTGGCCATAAACAA
ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA
AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATTGAGCAGCAGCAG
GGTGAGCTGGACAAACGCATCGGTCACTGGGAACAGCTAGTGGTGGAGGA
CAGTCAAGTGACAGAGCTGCGAGAGAAAATTAAGAGCGCATCGTCGCATG
TCGAGAGCTGCAAGACGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA
CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA
GGCCACGGCTGTGCTTTCGCTGTGCAAGGTGGATGATTACAAAGAGAGCT
TCAAGCAGCTGGAGGCAGTGGAAAAGCAGTTGCCCACCTGTAAAGTTAAT
TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT
TTGTGCACATCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC
ACAAGGTGCAAAATGAACTCAAAAAGCTGCAGGTCGATGTTGAGGATCGC
AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCA
AAATTTGGAGCAAGATCAGCTATATGCCATATTAAATGAGCAAATCCATG
AGGTTCTCGGACAAAACTGGCAGATGAATTCCACT
>C2
ATGGCGTTATCAGTCGAAATTGAGAGGGTAATGGACCAGGGCAACTGCCT
AATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACGGAGC
CGATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC
CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA
GGCGCGCGTCTTTCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC
AGATCAGCTTTCCCAACAAGACCTACACCTATATGGACATAATTAAACCA
GCTGTTAAAAAAACGCTCGCCACTCTGAGCTACCTTTTCAACCACCTGGC
CTACTACAAGGTGTTTAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA
TTAAGCTAAAGGATTCGCTGACAGCCGAGGTGAAGGCCAAGAGTCAACAG
CTGGAGCAATGCAGTCAGAAGACGAAGGATTGCGAAGTGGCCATCAACAA
ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA
AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATCGAGCAGCAGCAG
AGTGAGCTGGACAAACGCATCGGTCACTGGGAGCAGCTAGTGGTGGAGGA
CAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCGTCGCATG
TCGAGAGCTGCAAGGCGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA
CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA
GGCCACGGCTGTGCTTTCGCAGTGCAAAGTGGATGATTACAAAGAGAGCT
TGAAGCAGCTGGAGGCAGTGGAGAAGCAGTTGCCCACCTGGAAGGTTAAT
TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT
TTGTGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC
ACAAGCTGCAAAACGAACTCAAACAGCTGCAGGTTGATGTTGAGGATCGC
AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCG
AAATTTGGAGCAAGATCAGTTATATGCCATATTAAGTGAGCAAATCCATG
AGGCTCTCGGCCAAAACTGGCAGACGAATTCCACT
>C3
ATGGCGTTTTCAGCCGAAATTGAGAGGGTGATGGACCAGGGCAACTGTCT
GATGCCAGACATCAACATTTGCCAGAGCGACTTGGCCAATCCCACCGAAC
CATTTGTCACCAAGATCATGGTGCACTATTTGCGGTGTTACGGTTTCCGC
CTGGAGCCGCCATATAAGATTGGCTCCGAACTCGGCCACTCGTCGCGGGA
GGCGCGCGTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC
AGATCAGCTTTCCCAACAAGACCTACTCCTATGTGGATATTATAAAACCA
ACTGTTAAAAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC
CTACTACAAAATGTTCAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA
TTAAGCTTAAAGAATCGCTGACAACCGAGGTGAAGGCCAAGAGTCAACAG
CTGGATCAATGCAGTCAGAAGACCAAGGATTGCGAAGTGGCCATCAACCA
ACTCAAAAAGGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA
AGTCCTGCAGCGAGCATGAAAGCACTCTGGAACTTCTCGCACAGCAGCAA
ACTGAGCAGGAGAAACGTATCGGTCACTGGAAGCAGCTAGTGGTAGAGGA
CAGCCAAGTGACTGAGCTGCGAGAGAAGATTAAGAGTGCATCCTCGCATG
TGGAGAGCTGCAAGGCGGAGCTGGCCAGCAAAAAACAGGAGACGAATGAA
CACCGCCGGATAATTGAAAACAGTCAACATATAGCCACCGCTTTAGAGAA
GGCCACGGCTATGATTTCGCTGTGCAAACTGGATGACTACAAGGAGAGCT
GCAAGCAGCTGGAGACGATGGAGAAGCAGTTGCCCACCTGCAAGGTAAAT
TATCAGAAGCGCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT
TCGAGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAACC
ACAAGCTGCATAGCGAACTCAATCAGCTGCAGGTCGACGTTGAGGATCGC
AAGAAACGCCTGGAGGATCTAAGTAATACCTTGATCGAGCTTGACCAGCA
AAATTTGGAGCAAGATCAGCTGTACGACATATTAAGTGAGCAAATCCACG
AGGCTCTCGGTCAAAACTGGCAGATAAATTCCACT
>C4
ATGGCGCTTTCAGCCGAAATAGAGAGGGTTATGAACCAGGGCAACTGCCT
GATGCCCGACATCAACATTTGCCAGAACGACTTGGCCAATCCCACCGAGC
CCCTTGTCACCAAGATCATGGTGCACTATCTGCGTAGTTTCGGTTTCCGC
ATGGAGCCGCCCTATAAGATTGGCACCGAACTCGCCCACTCATCGCGCGA
GGCGCGCCTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC
AGATCAGCTTTCCCAACAAGACCTACACCTATGTGGATATCATAAAGCCA
GCTGTTAAGAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC
CTACTACAAAGTGTTCAAAAAGAAGGTGGTGGGGCCTGTAGAGGAGGCCC
TTAAGCTGAAGGACTCGCTGGCTGCCGAGCTGAAGACCAAGAGTCAACAG
CTGGAGCAGTGCAGTCAGAACACCAAGGAATGCGAAGTGGCCATCAACCA
ACTTAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCATTGAAAA
AGTCCTGCAGCGAGCAGGAAAACGCTCTGGAACTTCTCGAGCTGCAGCAT
AATGAGTTGGACAAACGTATAGGACACTGGGAGCAGCTAGTGGTGGAGGA
GAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCCTCGCATG
TCGAGAGCTGCAAGACGGAGCTGGCCAGCAAAAAACAGGAGACGAAAGAA
CATCGCCGGATAATCGAAAACAGCCAACACATAGTCGCCTCCTTGGAGAA
AGCCACGGCTGCGCTTTCGCTGTGCAAAGTGGATGACTACAAGGAGAGCT
TCAAGCAGCTGGAGGCGGTGGAGAAGCAGTTGCCCACCTGGAAGGTCAAT
TATCAGAAGCGCCTTCAGGATGCAAAGGCCAAGAAGGAGGAACTCGGTCT
TTGTGATCAGCGGTACGAGGAAAGAAGCCAGGAAAACGATGCCGAGAATC
ACAAGCTGCTTAACGAACTCAAACAGCTGCAGGTCGATGTTGAGGATCGC
AAGAAACGCCTAGAGGATCTGAGTAAAAACTTGGTCGAGCTTGACCAGCG
AAATTTGGGGCAAGATCAGCTGTATGCCATGTTAAATGAGCAAATCCATG
AGGCTCTTGGCCAAAACTGGCATATGAATTCCACT
>C1
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE
HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN
YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR
KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST
>C2
MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR
LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ
LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ
SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE
HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN
YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR
KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST
>C3
MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR
LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP
TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ
LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ
TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE
HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN
YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR
KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST
>C4
MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR
MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP
AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ
LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH
NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE
HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN
YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR
KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 1185 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480002065
      Setting output file names to "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1762552316
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0013591831
      Seed = 1446211906
      Swapseed = 1480002065
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 28 unique site patterns
      Division 2 has 27 unique site patterns
      Division 3 has 55 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2970.288287 -- -26.620141
         Chain 2 -- -2967.633263 -- -26.620141
         Chain 3 -- -2970.288287 -- -26.620141
         Chain 4 -- -2873.358094 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2970.288287 -- -26.620141
         Chain 2 -- -2967.633263 -- -26.620141
         Chain 3 -- -2967.633263 -- -26.620141
         Chain 4 -- -2967.633263 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2970.288] (-2967.633) (-2970.288) (-2873.358) * [-2970.288] (-2967.633) (-2967.633) (-2967.633) 
        500 -- (-2687.970) (-2667.577) (-2668.826) [-2674.652] * (-2684.571) (-2678.587) (-2683.423) [-2670.879] -- 0:00:00
       1000 -- (-2673.887) [-2652.788] (-2657.069) (-2659.025) * (-2673.949) [-2664.485] (-2670.629) (-2661.376) -- 0:00:00
       1500 -- (-2661.957) (-2643.096) [-2649.889] (-2658.673) * (-2661.806) (-2656.027) (-2668.599) [-2656.417] -- 0:00:00
       2000 -- (-2653.250) (-2645.773) [-2651.714] (-2645.252) * (-2655.516) [-2650.992] (-2668.350) (-2646.894) -- 0:00:00
       2500 -- [-2643.651] (-2645.960) (-2645.873) (-2645.535) * (-2646.135) [-2648.054] (-2659.226) (-2642.101) -- 0:00:00
       3000 -- (-2643.956) [-2633.575] (-2644.564) (-2641.461) * (-2646.176) (-2645.794) (-2654.042) [-2642.679] -- 0:00:00
       3500 -- [-2634.455] (-2634.575) (-2635.952) (-2642.991) * (-2644.546) (-2649.585) (-2644.636) [-2641.722] -- 0:04:44
       4000 -- (-2631.521) (-2636.519) (-2638.524) [-2635.211] * (-2641.337) (-2647.059) (-2636.975) [-2644.998] -- 0:04:09
       4500 -- (-2634.914) [-2649.456] (-2634.014) (-2631.336) * (-2634.925) (-2651.273) (-2640.161) [-2639.432] -- 0:03:41
       5000 -- (-2632.427) (-2648.275) (-2634.466) [-2633.847] * [-2636.928] (-2644.538) (-2645.036) (-2641.255) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-2640.066] (-2638.159) (-2635.242) (-2639.688) * [-2634.814] (-2634.980) (-2640.601) (-2644.930) -- 0:03:00
       6000 -- [-2637.191] (-2648.697) (-2634.255) (-2636.836) * (-2635.042) (-2641.014) [-2638.231] (-2647.639) -- 0:02:45
       6500 -- (-2635.271) (-2635.873) [-2632.417] (-2640.188) * (-2643.318) [-2636.383] (-2640.733) (-2633.807) -- 0:02:32
       7000 -- (-2638.833) (-2635.321) (-2632.916) [-2631.991] * (-2640.246) [-2635.177] (-2634.023) (-2639.506) -- 0:02:21
       7500 -- (-2634.919) [-2635.849] (-2640.993) (-2633.144) * (-2635.513) (-2631.356) [-2638.784] (-2632.231) -- 0:02:12
       8000 -- (-2637.261) (-2634.574) (-2632.630) [-2631.739] * [-2635.225] (-2633.365) (-2640.070) (-2641.230) -- 0:02:04
       8500 -- (-2644.533) [-2629.221] (-2633.029) (-2635.148) * (-2633.794) (-2653.191) [-2633.129] (-2635.404) -- 0:01:56
       9000 -- (-2633.282) [-2636.863] (-2638.635) (-2634.935) * [-2638.602] (-2640.743) (-2643.784) (-2637.118) -- 0:03:40
       9500 -- (-2638.507) [-2636.853] (-2637.224) (-2636.002) * [-2638.223] (-2641.887) (-2641.541) (-2631.503) -- 0:03:28
      10000 -- [-2637.999] (-2638.742) (-2643.013) (-2634.292) * [-2639.019] (-2635.174) (-2642.899) (-2635.524) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-2639.043) [-2638.643] (-2634.704) (-2631.164) * (-2640.367) [-2638.981] (-2633.583) (-2637.283) -- 0:03:08
      11000 -- (-2640.814) (-2641.430) (-2635.746) [-2636.566] * [-2634.316] (-2638.269) (-2635.536) (-2640.967) -- 0:02:59
      11500 -- (-2636.858) (-2641.860) [-2635.796] (-2637.541) * (-2633.765) [-2634.146] (-2635.301) (-2642.088) -- 0:02:51
      12000 -- [-2636.340] (-2641.927) (-2634.760) (-2635.611) * (-2634.424) (-2630.996) [-2632.247] (-2642.706) -- 0:02:44
      12500 -- (-2638.122) [-2634.804] (-2637.194) (-2641.493) * [-2634.309] (-2635.897) (-2639.743) (-2644.624) -- 0:02:38
      13000 -- (-2636.970) (-2640.396) [-2634.781] (-2649.285) * (-2637.545) [-2637.209] (-2636.784) (-2640.521) -- 0:02:31
      13500 -- [-2634.949] (-2633.435) (-2643.840) (-2638.515) * (-2639.747) [-2639.606] (-2637.226) (-2637.283) -- 0:02:26
      14000 -- (-2634.445) (-2636.967) [-2635.401] (-2638.800) * [-2633.061] (-2630.705) (-2632.803) (-2638.563) -- 0:02:20
      14500 -- (-2639.914) (-2639.099) [-2633.950] (-2631.142) * (-2634.843) [-2633.268] (-2638.850) (-2642.498) -- 0:03:23
      15000 -- (-2639.566) (-2638.546) [-2632.712] (-2631.502) * (-2633.825) (-2632.677) (-2637.277) [-2636.029] -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-2638.258) (-2634.689) (-2634.614) [-2632.611] * (-2633.965) (-2635.721) [-2634.877] (-2635.299) -- 0:03:10
      16000 -- (-2640.974) (-2645.318) (-2636.699) [-2631.499] * (-2639.790) (-2634.884) (-2640.259) [-2635.759] -- 0:03:04
      16500 -- [-2640.304] (-2640.249) (-2640.202) (-2632.067) * (-2644.932) [-2633.217] (-2636.263) (-2634.854) -- 0:02:58
      17000 -- (-2639.848) (-2639.924) [-2634.636] (-2638.613) * (-2637.875) [-2631.200] (-2637.557) (-2638.504) -- 0:02:53
      17500 -- (-2639.235) (-2640.852) (-2633.202) [-2634.805] * (-2633.535) [-2634.874] (-2638.292) (-2632.604) -- 0:02:48
      18000 -- [-2633.663] (-2635.737) (-2639.831) (-2635.428) * [-2632.802] (-2637.044) (-2645.167) (-2636.728) -- 0:02:43
      18500 -- [-2635.548] (-2636.320) (-2633.291) (-2635.847) * [-2636.115] (-2640.289) (-2641.442) (-2635.262) -- 0:02:39
      19000 -- (-2645.876) [-2636.515] (-2634.689) (-2632.333) * [-2641.638] (-2638.100) (-2636.742) (-2637.006) -- 0:02:34
      19500 -- (-2637.388) [-2629.073] (-2636.446) (-2633.064) * (-2636.034) (-2639.818) (-2640.334) [-2631.363] -- 0:02:30
      20000 -- (-2633.591) (-2632.487) (-2634.310) [-2635.302] * [-2633.370] (-2634.432) (-2644.641) (-2633.609) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-2636.822) (-2633.245) (-2632.566) [-2642.792] * (-2638.601) [-2632.789] (-2636.005) (-2637.977) -- 0:03:11
      21000 -- (-2639.436) [-2634.684] (-2633.009) (-2634.706) * (-2640.815) [-2634.255] (-2633.641) (-2637.471) -- 0:03:06
      21500 -- (-2643.866) (-2636.132) [-2638.532] (-2635.973) * (-2631.798) (-2632.035) [-2637.371] (-2635.191) -- 0:03:02
      22000 -- (-2647.856) (-2634.413) [-2634.202] (-2639.565) * [-2635.444] (-2637.191) (-2638.527) (-2632.992) -- 0:02:57
      22500 -- [-2641.891] (-2635.352) (-2633.755) (-2636.298) * (-2639.388) (-2641.107) (-2631.696) [-2636.209] -- 0:02:53
      23000 -- [-2634.289] (-2634.101) (-2638.628) (-2635.528) * [-2634.479] (-2645.970) (-2634.857) (-2634.220) -- 0:02:49
      23500 -- (-2638.151) [-2637.281] (-2635.865) (-2639.431) * (-2633.476) (-2639.189) [-2633.696] (-2635.264) -- 0:02:46
      24000 -- [-2632.011] (-2637.006) (-2635.609) (-2633.235) * [-2642.197] (-2638.278) (-2635.540) (-2640.576) -- 0:02:42
      24500 -- (-2632.250) [-2634.916] (-2633.626) (-2636.412) * (-2636.073) [-2634.572] (-2640.474) (-2635.782) -- 0:02:39
      25000 -- (-2635.297) (-2637.692) (-2634.745) [-2633.997] * (-2638.470) (-2635.095) (-2641.831) [-2635.118] -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-2636.366] (-2641.286) (-2640.054) (-2634.203) * (-2635.585) (-2640.081) [-2638.209] (-2636.427) -- 0:02:32
      26000 -- [-2634.772] (-2643.134) (-2633.951) (-2635.971) * (-2632.986) (-2638.486) (-2639.894) [-2632.530] -- 0:03:07
      26500 -- (-2635.154) (-2637.159) (-2639.689) [-2639.945] * (-2639.077) [-2636.746] (-2643.364) (-2643.548) -- 0:03:03
      27000 -- (-2630.978) (-2636.971) [-2630.805] (-2639.816) * [-2633.848] (-2635.541) (-2642.423) (-2636.989) -- 0:03:00
      27500 -- (-2640.889) [-2636.682] (-2632.162) (-2647.831) * (-2638.367) (-2635.397) (-2645.451) [-2631.644] -- 0:02:56
      28000 -- [-2634.340] (-2628.673) (-2642.427) (-2639.529) * (-2637.147) [-2638.592] (-2642.923) (-2635.828) -- 0:02:53
      28500 -- [-2634.685] (-2634.626) (-2637.373) (-2635.057) * [-2631.873] (-2638.694) (-2639.299) (-2634.796) -- 0:02:50
      29000 -- [-2639.073] (-2635.481) (-2633.304) (-2641.089) * (-2631.728) (-2636.384) (-2644.085) [-2635.911] -- 0:02:47
      29500 -- (-2639.177) (-2636.872) [-2630.608] (-2638.725) * (-2632.489) (-2635.624) (-2643.224) [-2636.685] -- 0:02:44
      30000 -- (-2635.035) [-2633.688] (-2632.334) (-2638.398) * [-2630.565] (-2638.219) (-2639.842) (-2638.872) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-2635.412) (-2634.966) [-2633.665] (-2639.034) * (-2634.082) [-2636.371] (-2644.397) (-2639.339) -- 0:02:38
      31000 -- (-2630.865) (-2633.463) [-2634.816] (-2643.457) * (-2632.875) (-2632.065) [-2634.176] (-2643.550) -- 0:02:36
      31500 -- [-2634.220] (-2636.393) (-2634.663) (-2638.680) * (-2634.456) (-2637.240) (-2637.857) [-2635.409] -- 0:03:04
      32000 -- [-2633.362] (-2631.527) (-2632.764) (-2638.394) * (-2637.092) (-2637.622) (-2635.105) [-2638.568] -- 0:03:01
      32500 -- [-2639.103] (-2637.927) (-2634.868) (-2637.071) * (-2633.378) (-2636.920) (-2639.140) [-2634.342] -- 0:02:58
      33000 -- (-2636.040) [-2639.245] (-2637.626) (-2645.645) * (-2635.345) [-2637.415] (-2643.907) (-2635.595) -- 0:02:55
      33500 -- (-2637.145) [-2639.886] (-2636.281) (-2634.811) * (-2632.582) [-2636.311] (-2641.807) (-2631.331) -- 0:02:53
      34000 -- (-2635.208) (-2637.809) (-2641.826) [-2631.049] * (-2640.268) (-2635.305) [-2634.366] (-2635.624) -- 0:02:50
      34500 -- [-2636.545] (-2638.613) (-2634.417) (-2632.627) * [-2635.238] (-2639.718) (-2630.148) (-2632.141) -- 0:02:47
      35000 -- (-2636.589) (-2633.498) [-2638.045] (-2628.803) * [-2640.408] (-2640.607) (-2630.789) (-2640.597) -- 0:02:45

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-2636.304) [-2633.620] (-2640.016) (-2633.290) * (-2636.191) [-2634.321] (-2639.905) (-2639.985) -- 0:02:43
      36000 -- (-2632.570) [-2638.442] (-2641.506) (-2634.025) * (-2636.741) (-2637.341) [-2642.322] (-2636.287) -- 0:02:40
      36500 -- (-2635.062) (-2636.721) [-2634.982] (-2634.045) * (-2636.547) (-2634.564) [-2633.017] (-2638.904) -- 0:02:38
      37000 -- (-2633.893) (-2640.770) (-2636.768) [-2632.895] * (-2634.319) (-2633.033) [-2635.031] (-2638.289) -- 0:03:02
      37500 -- (-2631.009) (-2632.749) (-2631.976) [-2635.785] * (-2633.226) [-2631.453] (-2635.126) (-2635.678) -- 0:02:59
      38000 -- [-2636.107] (-2639.857) (-2637.836) (-2636.494) * (-2633.999) (-2636.125) [-2635.454] (-2636.728) -- 0:02:57
      38500 -- (-2637.578) [-2638.517] (-2632.099) (-2643.699) * (-2631.190) (-2630.993) (-2636.236) [-2637.058] -- 0:02:54
      39000 -- (-2637.449) (-2639.441) [-2631.292] (-2638.792) * (-2638.376) [-2637.639] (-2644.134) (-2636.267) -- 0:02:52
      39500 -- (-2641.886) [-2637.284] (-2635.485) (-2635.641) * (-2632.505) (-2631.136) [-2635.927] (-2635.317) -- 0:02:50
      40000 -- (-2640.631) (-2636.158) [-2637.846] (-2636.368) * (-2634.377) [-2631.863] (-2633.399) (-2636.553) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-2634.130) (-2640.848) [-2632.266] (-2636.477) * (-2635.692) (-2635.655) [-2636.326] (-2633.776) -- 0:02:45
      41000 -- (-2635.799) (-2634.059) (-2640.625) [-2634.461] * [-2631.655] (-2637.660) (-2640.533) (-2636.829) -- 0:02:43
      41500 -- (-2634.093) [-2638.810] (-2640.326) (-2638.679) * (-2636.866) (-2633.417) [-2631.031] (-2643.392) -- 0:02:41
      42000 -- (-2636.173) [-2637.631] (-2637.150) (-2638.247) * (-2637.490) (-2642.901) (-2631.811) [-2637.302] -- 0:02:39
      42500 -- (-2635.917) (-2635.948) (-2641.227) [-2634.958] * (-2643.405) (-2638.244) (-2635.766) [-2638.997] -- 0:03:00
      43000 -- (-2634.375) [-2634.011] (-2641.029) (-2644.112) * (-2640.641) (-2635.774) [-2637.534] (-2631.308) -- 0:02:58
      43500 -- (-2633.042) [-2634.133] (-2636.191) (-2640.242) * (-2632.317) (-2632.170) [-2633.707] (-2638.884) -- 0:02:55
      44000 -- (-2640.393) (-2634.558) [-2636.978] (-2635.976) * [-2638.919] (-2638.409) (-2632.360) (-2640.835) -- 0:02:53
      44500 -- (-2638.968) (-2636.884) [-2637.529] (-2634.902) * (-2632.467) (-2632.791) (-2641.714) [-2632.999] -- 0:02:51
      45000 -- (-2634.763) (-2643.091) (-2635.997) [-2637.329] * (-2632.324) [-2638.967] (-2639.555) (-2632.338) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-2631.526) [-2638.751] (-2635.247) (-2635.710) * (-2633.706) (-2636.506) (-2637.675) [-2634.911] -- 0:02:47
      46000 -- (-2631.721) (-2637.668) [-2634.979] (-2632.499) * (-2637.032) (-2632.589) [-2634.623] (-2635.044) -- 0:02:45
      46500 -- (-2636.414) (-2637.501) (-2641.266) [-2634.794] * (-2636.608) (-2636.461) (-2641.801) [-2634.724] -- 0:02:44
      47000 -- (-2638.640) (-2637.931) [-2636.939] (-2634.045) * (-2637.542) [-2641.024] (-2633.676) (-2639.621) -- 0:02:42
      47500 -- [-2637.726] (-2644.605) (-2639.567) (-2637.996) * [-2636.650] (-2636.741) (-2632.467) (-2640.260) -- 0:02:40
      48000 -- [-2639.999] (-2638.641) (-2633.555) (-2633.680) * [-2641.356] (-2631.991) (-2635.895) (-2635.135) -- 0:02:38
      48500 -- [-2634.714] (-2632.302) (-2633.175) (-2633.406) * (-2636.787) [-2632.714] (-2636.088) (-2636.900) -- 0:02:56
      49000 -- [-2633.071] (-2639.945) (-2643.510) (-2635.125) * (-2636.465) [-2633.209] (-2636.766) (-2640.024) -- 0:02:54
      49500 -- (-2643.489) (-2633.448) (-2640.228) [-2637.173] * (-2636.493) (-2632.680) (-2633.232) [-2648.178] -- 0:02:52
      50000 -- (-2633.968) [-2631.944] (-2648.548) (-2634.082) * (-2633.030) [-2640.271] (-2639.770) (-2636.110) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-2634.530] (-2632.184) (-2636.435) (-2633.588) * (-2638.255) (-2639.307) [-2633.230] (-2637.730) -- 0:02:49
      51000 -- (-2638.662) [-2642.203] (-2636.555) (-2633.103) * [-2638.392] (-2634.840) (-2631.743) (-2636.398) -- 0:02:47
      51500 -- [-2636.105] (-2632.294) (-2637.944) (-2635.600) * (-2633.408) (-2644.001) [-2632.024] (-2636.319) -- 0:02:45
      52000 -- (-2637.722) (-2636.513) (-2634.481) [-2642.742] * [-2636.117] (-2641.596) (-2633.312) (-2637.422) -- 0:02:44
      52500 -- (-2641.136) [-2641.414] (-2631.937) (-2633.074) * (-2636.087) (-2641.260) [-2635.236] (-2634.350) -- 0:02:42
      53000 -- (-2637.514) (-2630.885) [-2631.804] (-2639.379) * (-2636.575) (-2638.066) (-2636.607) [-2633.063] -- 0:02:40
      53500 -- (-2641.069) [-2636.683] (-2635.377) (-2634.442) * (-2637.978) (-2644.051) (-2638.770) [-2632.805] -- 0:02:39
      54000 -- [-2634.652] (-2635.724) (-2634.903) (-2637.955) * (-2636.302) (-2637.428) (-2637.777) [-2631.686] -- 0:02:55
      54500 -- (-2637.533) [-2634.779] (-2637.989) (-2634.883) * [-2638.633] (-2646.145) (-2633.164) (-2634.366) -- 0:02:53
      55000 -- [-2633.003] (-2635.169) (-2632.965) (-2643.594) * (-2635.058) (-2642.660) [-2639.237] (-2632.896) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2631.882) (-2637.351) (-2636.011) [-2636.727] * (-2637.147) (-2634.112) [-2639.748] (-2631.104) -- 0:02:50
      56000 -- (-2642.980) (-2632.994) [-2634.382] (-2640.493) * (-2640.091) [-2630.965] (-2639.988) (-2632.242) -- 0:02:48
      56500 -- (-2641.065) (-2632.769) [-2633.827] (-2640.256) * [-2640.575] (-2642.486) (-2637.761) (-2639.716) -- 0:02:46
      57000 -- [-2638.790] (-2641.277) (-2633.845) (-2637.901) * (-2639.245) (-2641.643) (-2641.554) [-2635.679] -- 0:02:45
      57500 -- (-2645.945) (-2641.477) (-2633.492) [-2634.784] * (-2638.408) [-2633.281] (-2641.323) (-2635.207) -- 0:02:43
      58000 -- (-2635.523) (-2636.056) (-2632.680) [-2635.646] * (-2637.323) [-2632.439] (-2640.012) (-2636.991) -- 0:02:42
      58500 -- (-2637.680) (-2633.273) [-2635.615] (-2635.551) * (-2633.365) (-2630.851) [-2641.104] (-2636.077) -- 0:02:40
      59000 -- (-2640.481) [-2634.371] (-2634.364) (-2631.764) * (-2637.119) (-2630.414) (-2641.518) [-2638.161] -- 0:02:39
      59500 -- (-2635.218) [-2637.384] (-2634.403) (-2634.523) * (-2633.775) (-2635.875) (-2638.623) [-2638.793] -- 0:02:38
      60000 -- (-2637.442) (-2638.387) [-2631.266] (-2645.725) * (-2633.721) (-2636.162) [-2632.930] (-2638.901) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-2642.040) (-2649.234) [-2633.592] (-2637.557) * (-2633.822) (-2634.407) (-2632.151) [-2633.365] -- 0:02:50
      61000 -- (-2640.611) (-2637.563) [-2635.641] (-2636.791) * [-2634.283] (-2637.654) (-2633.057) (-2640.250) -- 0:02:49
      61500 -- (-2636.200) (-2640.110) (-2635.563) [-2639.576] * (-2639.363) [-2633.426] (-2636.770) (-2642.268) -- 0:02:47
      62000 -- [-2634.414] (-2642.676) (-2636.574) (-2637.558) * (-2633.523) (-2634.783) (-2631.017) [-2635.561] -- 0:02:46
      62500 -- [-2637.409] (-2635.542) (-2635.160) (-2635.053) * [-2638.600] (-2639.587) (-2633.778) (-2632.663) -- 0:02:45
      63000 -- (-2636.088) (-2638.385) [-2630.994] (-2640.510) * (-2638.883) [-2632.148] (-2633.707) (-2642.995) -- 0:02:43
      63500 -- (-2637.846) (-2637.199) [-2632.597] (-2638.218) * (-2643.706) (-2636.833) (-2631.240) [-2639.731] -- 0:02:42
      64000 -- [-2636.998] (-2639.649) (-2640.472) (-2638.184) * [-2634.540] (-2643.141) (-2643.580) (-2636.537) -- 0:02:40
      64500 -- (-2631.579) (-2639.846) [-2638.309] (-2643.151) * (-2634.849) [-2633.055] (-2632.762) (-2640.533) -- 0:02:39
      65000 -- (-2635.101) [-2635.403] (-2636.476) (-2643.761) * (-2635.136) [-2634.857] (-2633.780) (-2636.675) -- 0:02:38

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-2632.048) [-2637.155] (-2635.891) (-2638.300) * (-2639.778) (-2636.026) (-2635.410) [-2637.882] -- 0:02:51
      66000 -- (-2633.904) (-2636.962) [-2634.085] (-2640.051) * (-2636.082) (-2635.334) [-2630.208] (-2635.342) -- 0:02:49
      66500 -- (-2636.603) [-2636.424] (-2630.575) (-2636.846) * (-2634.491) (-2637.608) [-2634.491] (-2639.530) -- 0:02:48
      67000 -- (-2639.883) [-2637.342] (-2643.751) (-2640.989) * [-2635.136] (-2643.399) (-2634.097) (-2640.470) -- 0:02:47
      67500 -- (-2643.888) (-2640.346) [-2641.042] (-2638.776) * [-2632.749] (-2633.810) (-2633.936) (-2639.374) -- 0:02:45
      68000 -- (-2633.425) [-2633.905] (-2644.106) (-2639.575) * [-2633.363] (-2640.343) (-2636.637) (-2644.528) -- 0:02:44
      68500 -- (-2637.908) [-2633.354] (-2648.108) (-2635.548) * (-2636.157) (-2634.168) (-2634.079) [-2643.649] -- 0:02:43
      69000 -- (-2635.304) [-2630.750] (-2645.185) (-2637.075) * (-2637.302) (-2640.378) (-2634.211) [-2637.153] -- 0:02:41
      69500 -- (-2634.188) (-2631.930) (-2639.274) [-2637.321] * (-2645.888) (-2637.465) [-2635.671] (-2640.418) -- 0:02:40
      70000 -- [-2634.665] (-2634.650) (-2641.071) (-2644.862) * (-2642.546) (-2637.284) [-2633.180] (-2637.736) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-2633.817) (-2634.493) (-2635.202) [-2636.327] * (-2640.231) (-2637.945) [-2633.244] (-2634.589) -- 0:02:38
      71000 -- (-2633.690) (-2634.386) [-2634.098] (-2639.761) * (-2643.076) [-2635.171] (-2635.054) (-2633.845) -- 0:02:50
      71500 -- [-2631.459] (-2634.258) (-2637.640) (-2634.642) * (-2640.753) (-2640.365) (-2636.218) [-2636.507] -- 0:02:48
      72000 -- [-2639.545] (-2637.059) (-2637.421) (-2640.132) * (-2637.613) (-2640.154) (-2634.955) [-2638.368] -- 0:02:47
      72500 -- (-2644.238) (-2635.483) [-2634.801] (-2641.953) * (-2636.319) (-2641.619) (-2636.970) [-2640.159] -- 0:02:46
      73000 -- (-2639.251) (-2642.219) (-2636.512) [-2632.306] * (-2631.042) (-2641.453) (-2633.011) [-2631.412] -- 0:02:45
      73500 -- (-2638.043) (-2641.922) (-2638.781) [-2638.063] * [-2637.836] (-2636.924) (-2640.038) (-2637.541) -- 0:02:43
      74000 -- (-2634.144) (-2638.975) (-2641.556) [-2638.801] * [-2631.802] (-2636.460) (-2640.774) (-2632.042) -- 0:02:42
      74500 -- [-2638.710] (-2637.762) (-2636.908) (-2630.453) * [-2636.882] (-2644.352) (-2648.639) (-2636.307) -- 0:02:41
      75000 -- (-2642.853) (-2637.865) [-2635.607] (-2633.742) * (-2632.967) (-2638.498) (-2639.312) [-2638.067] -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-2641.079) (-2637.098) [-2637.142] (-2635.792) * [-2633.066] (-2639.613) (-2637.193) (-2633.044) -- 0:02:39
      76000 -- [-2633.278] (-2635.287) (-2637.633) (-2639.576) * [-2638.596] (-2639.070) (-2638.721) (-2633.095) -- 0:02:38
      76500 -- (-2633.651) [-2637.121] (-2638.987) (-2640.758) * (-2633.538) (-2637.119) (-2639.255) [-2637.255] -- 0:02:49
      77000 -- [-2635.995] (-2637.696) (-2645.871) (-2638.371) * (-2639.103) (-2637.229) (-2643.123) [-2631.546] -- 0:02:47
      77500 -- (-2639.743) (-2634.473) [-2636.210] (-2637.525) * (-2645.218) (-2635.342) (-2634.039) [-2639.056] -- 0:02:46
      78000 -- (-2640.074) [-2632.239] (-2637.102) (-2638.256) * [-2638.284] (-2638.159) (-2637.373) (-2635.329) -- 0:02:45
      78500 -- (-2637.249) [-2635.894] (-2640.209) (-2633.777) * (-2636.112) (-2633.905) (-2638.687) [-2638.361] -- 0:02:44
      79000 -- (-2637.740) [-2629.732] (-2636.721) (-2632.310) * (-2635.223) (-2641.940) (-2630.505) [-2634.258] -- 0:02:43
      79500 -- (-2641.358) (-2639.087) [-2636.005] (-2638.749) * [-2631.321] (-2635.619) (-2633.275) (-2638.450) -- 0:02:42
      80000 -- (-2636.573) [-2637.980] (-2633.834) (-2634.693) * (-2642.320) [-2637.994] (-2634.508) (-2638.664) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-2638.989) (-2634.625) [-2635.056] (-2635.727) * (-2637.663) (-2633.243) [-2635.589] (-2633.616) -- 0:02:39
      81000 -- (-2636.794) (-2636.576) [-2633.399] (-2636.957) * (-2640.644) (-2631.809) (-2635.134) [-2632.144] -- 0:02:38
      81500 -- [-2639.655] (-2647.264) (-2637.442) (-2639.310) * (-2636.732) (-2636.351) [-2634.799] (-2646.124) -- 0:02:37
      82000 -- (-2635.809) (-2636.953) (-2637.860) [-2633.042] * (-2635.781) (-2632.237) [-2631.437] (-2639.591) -- 0:02:36
      82500 -- (-2638.157) (-2638.890) (-2634.128) [-2632.138] * [-2633.851] (-2634.388) (-2632.920) (-2632.807) -- 0:02:46
      83000 -- (-2637.238) (-2645.040) (-2643.275) [-2636.643] * (-2634.528) (-2633.084) (-2631.837) [-2638.194] -- 0:02:45
      83500 -- (-2635.175) (-2638.747) (-2644.014) [-2634.438] * (-2639.544) [-2634.246] (-2639.617) (-2641.657) -- 0:02:44
      84000 -- (-2638.959) (-2638.718) [-2631.032] (-2636.244) * (-2635.906) (-2635.082) [-2640.436] (-2635.884) -- 0:02:43
      84500 -- (-2635.426) (-2643.625) (-2633.863) [-2634.841] * (-2634.765) [-2636.845] (-2642.262) (-2641.013) -- 0:02:42
      85000 -- (-2634.989) (-2638.723) [-2629.537] (-2636.990) * (-2638.474) (-2632.006) [-2642.187] (-2634.746) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-2639.905) [-2638.015] (-2633.618) (-2635.261) * (-2638.306) (-2640.761) (-2635.675) [-2640.324] -- 0:02:40
      86000 -- (-2633.579) (-2634.053) (-2639.616) [-2633.387] * (-2635.732) (-2634.991) [-2631.344] (-2641.173) -- 0:02:39
      86500 -- (-2633.481) [-2637.219] (-2637.259) (-2631.621) * [-2640.573] (-2640.807) (-2635.586) (-2644.608) -- 0:02:38
      87000 -- (-2641.726) [-2642.768] (-2642.106) (-2634.612) * (-2639.950) [-2634.715] (-2646.411) (-2638.287) -- 0:02:37
      87500 -- (-2640.091) (-2641.643) [-2643.768] (-2636.049) * (-2638.185) [-2638.022] (-2637.782) (-2642.368) -- 0:02:36
      88000 -- (-2638.485) [-2635.450] (-2630.908) (-2635.642) * [-2636.609] (-2643.461) (-2636.044) (-2642.219) -- 0:02:45
      88500 -- (-2631.775) (-2639.523) [-2640.468] (-2639.387) * (-2633.197) (-2642.554) [-2632.457] (-2635.148) -- 0:02:44
      89000 -- (-2636.311) (-2633.483) (-2633.635) [-2642.122] * (-2634.698) (-2635.304) [-2636.616] (-2637.496) -- 0:02:43
      89500 -- (-2641.924) (-2636.857) [-2633.468] (-2632.589) * [-2633.892] (-2636.276) (-2634.450) (-2637.999) -- 0:02:42
      90000 -- (-2637.833) (-2635.923) (-2632.838) [-2638.674] * (-2639.031) (-2637.672) (-2645.619) [-2638.082] -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      90500 -- [-2633.341] (-2640.417) (-2638.238) (-2634.723) * (-2635.815) (-2634.410) (-2637.893) [-2636.132] -- 0:02:40
      91000 -- (-2635.714) (-2634.257) (-2634.269) [-2632.331] * (-2636.987) (-2632.257) [-2635.506] (-2639.629) -- 0:02:39
      91500 -- [-2631.249] (-2638.031) (-2636.883) (-2636.682) * (-2636.352) (-2633.625) (-2633.996) [-2632.774] -- 0:02:38
      92000 -- [-2636.379] (-2638.986) (-2639.587) (-2636.736) * (-2637.965) (-2635.636) (-2641.928) [-2631.629] -- 0:02:37
      92500 -- (-2634.695) (-2633.234) [-2634.297] (-2634.001) * (-2630.872) (-2633.892) (-2635.484) [-2632.469] -- 0:02:36
      93000 -- [-2634.254] (-2637.401) (-2646.351) (-2632.965) * [-2630.111] (-2634.770) (-2633.363) (-2636.954) -- 0:02:36
      93500 -- (-2635.289) (-2633.327) [-2638.814] (-2640.049) * (-2639.857) [-2635.200] (-2633.478) (-2633.088) -- 0:02:44
      94000 -- [-2634.411] (-2634.478) (-2637.031) (-2637.156) * [-2633.462] (-2637.194) (-2649.882) (-2634.088) -- 0:02:43
      94500 -- [-2633.618] (-2637.501) (-2636.257) (-2637.667) * (-2636.143) (-2635.656) (-2631.787) [-2635.276] -- 0:02:42
      95000 -- [-2636.902] (-2641.914) (-2639.969) (-2636.882) * (-2639.878) (-2635.546) [-2632.623] (-2639.699) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-2638.358) [-2647.850] (-2635.420) (-2639.284) * (-2637.462) (-2633.109) [-2637.460] (-2630.361) -- 0:02:41
      96000 -- (-2636.075) (-2638.791) [-2637.821] (-2635.275) * [-2636.332] (-2632.077) (-2637.325) (-2640.806) -- 0:02:40
      96500 -- (-2634.692) (-2633.413) [-2638.444] (-2637.571) * (-2644.508) (-2635.901) (-2637.744) [-2638.081] -- 0:02:39
      97000 -- [-2634.267] (-2638.127) (-2634.647) (-2634.474) * [-2636.107] (-2632.836) (-2635.436) (-2642.879) -- 0:02:38
      97500 -- (-2640.220) (-2638.353) [-2635.356] (-2633.495) * (-2632.032) (-2635.431) (-2637.969) [-2640.789] -- 0:02:37
      98000 -- (-2633.928) [-2636.007] (-2630.547) (-2635.730) * [-2635.141] (-2632.978) (-2636.119) (-2639.156) -- 0:02:36
      98500 -- (-2640.173) (-2635.718) (-2632.534) [-2634.031] * (-2636.403) [-2635.275] (-2638.906) (-2639.595) -- 0:02:35
      99000 -- (-2636.972) (-2637.317) [-2635.429] (-2635.473) * [-2639.022] (-2639.804) (-2641.638) (-2640.568) -- 0:02:43
      99500 -- (-2632.287) [-2631.483] (-2634.903) (-2642.002) * (-2635.892) (-2635.679) [-2634.274] (-2635.322) -- 0:02:42
      100000 -- (-2637.151) [-2635.598] (-2637.451) (-2641.647) * [-2635.117] (-2634.786) (-2637.741) (-2636.687) -- 0:02:42

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-2635.377) [-2631.890] (-2638.670) (-2647.446) * (-2638.500) [-2636.767] (-2641.344) (-2636.077) -- 0:02:41
      101000 -- (-2637.017) [-2632.507] (-2634.257) (-2635.677) * (-2642.578) [-2631.836] (-2637.343) (-2635.457) -- 0:02:40
      101500 -- (-2635.830) (-2637.602) (-2642.312) [-2639.676] * (-2642.471) (-2632.931) [-2636.620] (-2639.128) -- 0:02:39
      102000 -- (-2641.259) [-2632.834] (-2641.007) (-2635.883) * (-2632.870) (-2640.296) (-2639.342) [-2634.158] -- 0:02:38
      102500 -- (-2636.470) [-2637.390] (-2635.527) (-2634.063) * (-2636.871) [-2636.795] (-2639.370) (-2636.476) -- 0:02:37
      103000 -- [-2640.363] (-2635.929) (-2634.588) (-2646.665) * [-2634.337] (-2633.001) (-2633.720) (-2646.859) -- 0:02:36
      103500 -- (-2643.774) [-2636.776] (-2632.987) (-2644.002) * (-2634.610) [-2631.403] (-2639.911) (-2640.320) -- 0:02:35
      104000 -- (-2633.631) (-2638.454) [-2636.488] (-2641.636) * (-2634.127) [-2637.781] (-2634.477) (-2638.617) -- 0:02:35
      104500 -- (-2640.013) (-2647.420) [-2638.275] (-2640.604) * (-2637.282) (-2637.000) [-2634.051] (-2643.148) -- 0:02:42
      105000 -- (-2638.928) (-2646.471) [-2636.667] (-2639.138) * (-2635.371) [-2639.029] (-2635.313) (-2639.900) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-2632.313) (-2631.309) [-2633.926] (-2636.470) * (-2635.150) [-2632.367] (-2636.603) (-2641.036) -- 0:02:41
      106000 -- (-2636.118) [-2637.733] (-2634.429) (-2635.475) * [-2641.685] (-2633.782) (-2635.657) (-2638.151) -- 0:02:40
      106500 -- [-2629.387] (-2634.617) (-2635.768) (-2635.600) * (-2634.956) (-2634.819) (-2638.752) [-2634.700] -- 0:02:39
      107000 -- (-2630.874) [-2634.608] (-2634.843) (-2636.990) * [-2631.852] (-2646.582) (-2636.375) (-2637.534) -- 0:02:38
      107500 -- (-2633.032) [-2633.638] (-2637.761) (-2639.559) * (-2633.781) (-2634.994) (-2636.247) [-2644.116] -- 0:02:37
      108000 -- [-2634.826] (-2632.458) (-2632.654) (-2642.916) * (-2637.574) [-2632.736] (-2640.418) (-2637.287) -- 0:02:36
      108500 -- [-2631.395] (-2636.026) (-2633.195) (-2646.814) * (-2635.681) [-2636.807] (-2641.361) (-2635.825) -- 0:02:36
      109000 -- (-2633.943) [-2639.035] (-2628.997) (-2634.770) * [-2641.153] (-2637.086) (-2635.285) (-2633.207) -- 0:02:35
      109500 -- (-2637.435) (-2631.516) [-2634.660] (-2635.026) * (-2635.986) (-2643.380) [-2632.213] (-2641.975) -- 0:02:34
      110000 -- [-2630.746] (-2635.114) (-2633.405) (-2636.311) * (-2639.726) (-2641.180) [-2634.789] (-2634.691) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-2635.043] (-2638.196) (-2643.163) (-2632.188) * [-2635.176] (-2642.303) (-2638.399) (-2634.025) -- 0:02:40
      111000 -- (-2638.929) [-2640.290] (-2640.596) (-2635.549) * [-2633.345] (-2631.910) (-2634.019) (-2634.403) -- 0:02:40
      111500 -- [-2633.293] (-2635.445) (-2646.083) (-2640.589) * (-2635.871) (-2639.951) [-2635.337] (-2638.734) -- 0:02:39
      112000 -- (-2634.500) [-2640.542] (-2645.343) (-2637.159) * (-2635.315) (-2641.516) [-2634.751] (-2638.134) -- 0:02:38
      112500 -- (-2634.612) [-2633.401] (-2642.339) (-2639.043) * (-2634.365) [-2638.331] (-2642.042) (-2634.643) -- 0:02:37
      113000 -- (-2633.782) [-2632.966] (-2638.139) (-2635.229) * (-2644.857) (-2636.627) (-2637.358) [-2633.964] -- 0:02:36
      113500 -- (-2636.869) [-2636.235] (-2634.280) (-2633.416) * [-2634.037] (-2634.772) (-2639.187) (-2638.387) -- 0:02:36
      114000 -- (-2635.073) (-2638.347) [-2632.196] (-2632.490) * [-2638.040] (-2635.467) (-2635.224) (-2641.956) -- 0:02:35
      114500 -- (-2635.054) (-2636.523) (-2636.258) [-2633.992] * (-2634.512) [-2634.203] (-2636.959) (-2633.986) -- 0:02:34
      115000 -- (-2635.960) [-2641.569] (-2639.277) (-2639.627) * (-2635.089) [-2635.619] (-2633.810) (-2636.706) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-2637.755) (-2638.174) (-2638.741) [-2636.577] * (-2638.767) (-2639.644) (-2636.915) [-2633.231] -- 0:02:33
      116000 -- (-2634.983) (-2639.950) (-2634.794) [-2643.686] * (-2632.592) (-2634.493) [-2635.588] (-2640.929) -- 0:02:40
      116500 -- (-2639.791) [-2634.994] (-2632.041) (-2647.274) * (-2635.655) [-2632.184] (-2637.065) (-2643.189) -- 0:02:39
      117000 -- (-2641.648) [-2635.743] (-2638.185) (-2641.425) * [-2637.637] (-2640.663) (-2641.408) (-2636.465) -- 0:02:38
      117500 -- (-2634.057) (-2638.169) [-2635.111] (-2637.088) * [-2634.705] (-2632.372) (-2640.219) (-2643.731) -- 0:02:37
      118000 -- (-2633.276) [-2636.738] (-2634.045) (-2641.117) * (-2636.765) [-2640.273] (-2636.093) (-2636.431) -- 0:02:36
      118500 -- (-2635.305) (-2639.244) (-2635.389) [-2637.507] * (-2635.876) [-2636.576] (-2643.663) (-2635.775) -- 0:02:36
      119000 -- (-2640.224) (-2635.068) (-2638.425) [-2636.034] * [-2638.947] (-2636.013) (-2636.126) (-2631.328) -- 0:02:35
      119500 -- (-2638.674) (-2639.617) (-2642.116) [-2641.417] * (-2642.079) (-2634.855) [-2634.923] (-2629.430) -- 0:02:34
      120000 -- [-2635.268] (-2634.027) (-2636.076) (-2635.636) * (-2637.197) (-2635.235) (-2640.581) [-2633.048] -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-2636.150] (-2634.516) (-2639.007) (-2639.515) * [-2634.652] (-2642.354) (-2636.751) (-2640.219) -- 0:02:33
      121000 -- (-2639.898) (-2635.545) (-2637.142) [-2632.658] * (-2638.462) [-2636.024] (-2636.483) (-2640.831) -- 0:02:32
      121500 -- (-2647.035) (-2638.043) [-2634.602] (-2638.105) * (-2638.101) (-2637.905) (-2635.468) [-2640.936] -- 0:02:39
      122000 -- (-2637.189) (-2633.790) (-2641.435) [-2632.865] * [-2636.608] (-2634.961) (-2637.121) (-2635.985) -- 0:02:38
      122500 -- (-2635.888) [-2636.862] (-2641.889) (-2632.454) * (-2634.426) (-2633.165) (-2636.574) [-2631.603] -- 0:02:37
      123000 -- [-2637.632] (-2637.980) (-2636.298) (-2632.253) * [-2637.789] (-2632.985) (-2640.328) (-2632.229) -- 0:02:36
      123500 -- (-2628.867) (-2636.304) [-2644.618] (-2634.263) * (-2636.473) (-2633.677) (-2636.456) [-2637.839] -- 0:02:36
      124000 -- (-2633.720) [-2635.381] (-2642.616) (-2633.118) * (-2642.841) (-2633.186) [-2634.994] (-2639.361) -- 0:02:35
      124500 -- (-2637.875) (-2635.323) (-2633.532) [-2633.926] * (-2637.102) (-2632.932) (-2638.265) [-2634.337] -- 0:02:34
      125000 -- (-2633.517) (-2641.962) (-2639.472) [-2632.367] * (-2640.794) (-2638.101) (-2642.578) [-2636.160] -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-2639.774) (-2636.769) (-2639.144) [-2632.620] * [-2634.004] (-2634.286) (-2640.744) (-2635.836) -- 0:02:33
      126000 -- (-2636.952) (-2630.887) [-2640.826] (-2637.041) * (-2634.354) (-2634.616) (-2636.566) [-2642.493] -- 0:02:32
      126500 -- [-2632.661] (-2639.772) (-2634.009) (-2636.235) * (-2636.703) (-2641.049) [-2632.890] (-2637.856) -- 0:02:31
      127000 -- (-2634.394) (-2644.741) [-2634.222] (-2635.519) * (-2636.178) (-2637.869) [-2636.476] (-2640.212) -- 0:02:31
      127500 -- (-2635.661) (-2636.745) (-2635.464) [-2639.841] * (-2635.708) (-2632.729) [-2634.041] (-2641.921) -- 0:02:37
      128000 -- (-2642.589) [-2636.769] (-2632.605) (-2634.612) * [-2631.515] (-2636.992) (-2635.142) (-2644.359) -- 0:02:36
      128500 -- [-2636.276] (-2637.926) (-2631.783) (-2634.875) * (-2637.027) (-2641.631) [-2635.311] (-2646.394) -- 0:02:35
      129000 -- [-2644.623] (-2637.751) (-2640.776) (-2641.380) * [-2639.957] (-2635.190) (-2632.940) (-2635.977) -- 0:02:35
      129500 -- (-2635.270) [-2636.652] (-2636.585) (-2637.488) * [-2634.245] (-2639.671) (-2636.088) (-2633.499) -- 0:02:34
      130000 -- (-2643.863) [-2633.705] (-2643.346) (-2636.706) * [-2634.602] (-2639.284) (-2641.076) (-2634.938) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-2636.022) [-2639.187] (-2641.364) (-2638.077) * (-2639.657) [-2637.860] (-2645.327) (-2632.181) -- 0:02:33
      131000 -- [-2635.322] (-2642.687) (-2635.136) (-2633.577) * (-2633.895) (-2634.144) [-2634.821] (-2640.669) -- 0:02:32
      131500 -- (-2636.121) (-2641.066) [-2635.868] (-2636.451) * (-2639.014) [-2635.597] (-2635.206) (-2636.209) -- 0:02:31
      132000 -- [-2635.600] (-2632.995) (-2636.440) (-2638.296) * (-2633.771) (-2637.820) (-2634.814) [-2629.960] -- 0:02:31
      132500 -- (-2637.943) (-2635.026) (-2636.099) [-2631.011] * (-2637.006) (-2636.535) [-2641.977] (-2632.045) -- 0:02:30
      133000 -- (-2635.583) (-2640.724) [-2632.035] (-2632.171) * [-2637.050] (-2637.076) (-2638.823) (-2637.102) -- 0:02:36
      133500 -- [-2635.738] (-2641.782) (-2637.663) (-2638.006) * (-2637.551) (-2642.579) [-2636.664] (-2638.132) -- 0:02:35
      134000 -- (-2635.182) (-2643.617) [-2637.283] (-2633.727) * (-2636.925) [-2636.081] (-2633.872) (-2639.158) -- 0:02:35
      134500 -- (-2632.644) (-2638.520) (-2637.888) [-2631.287] * (-2642.650) (-2637.669) (-2631.561) [-2637.395] -- 0:02:34
      135000 -- (-2635.373) (-2637.817) (-2641.019) [-2636.241] * (-2634.388) [-2636.329] (-2637.941) (-2641.992) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-2637.607) (-2639.556) [-2635.009] (-2638.114) * (-2633.191) [-2633.758] (-2636.806) (-2644.770) -- 0:02:33
      136000 -- [-2634.268] (-2641.114) (-2635.568) (-2633.087) * [-2636.870] (-2635.467) (-2640.325) (-2643.963) -- 0:02:32
      136500 -- (-2637.677) (-2637.056) (-2640.843) [-2632.637] * (-2640.700) [-2631.010] (-2639.827) (-2636.076) -- 0:02:31
      137000 -- (-2632.397) (-2637.211) (-2635.492) [-2636.769] * (-2643.140) (-2632.759) (-2635.781) [-2642.994] -- 0:02:31
      137500 -- (-2634.236) (-2635.809) [-2640.956] (-2636.809) * [-2633.111] (-2632.596) (-2634.780) (-2638.624) -- 0:02:30
      138000 -- [-2631.541] (-2636.425) (-2641.005) (-2636.460) * (-2633.831) (-2635.114) [-2638.317] (-2633.968) -- 0:02:29
      138500 -- (-2632.618) (-2636.636) [-2635.071] (-2639.957) * [-2632.096] (-2635.395) (-2637.280) (-2643.252) -- 0:02:35
      139000 -- (-2638.382) (-2633.924) [-2632.543] (-2634.759) * (-2632.981) (-2636.402) [-2639.608] (-2643.263) -- 0:02:34
      139500 -- (-2642.145) [-2634.443] (-2638.131) (-2636.843) * [-2638.241] (-2632.789) (-2641.698) (-2636.053) -- 0:02:34
      140000 -- (-2654.753) (-2638.827) [-2634.979] (-2646.818) * (-2631.730) [-2639.376] (-2637.663) (-2634.310) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      140500 -- [-2637.823] (-2636.880) (-2629.258) (-2639.903) * (-2637.642) (-2634.711) [-2632.502] (-2638.287) -- 0:02:32
      141000 -- [-2635.810] (-2632.963) (-2636.507) (-2636.012) * [-2639.540] (-2636.776) (-2640.642) (-2635.745) -- 0:02:32
      141500 -- (-2637.316) [-2634.923] (-2637.202) (-2633.719) * (-2633.799) (-2636.505) (-2639.277) [-2633.451] -- 0:02:31
      142000 -- (-2641.428) (-2636.092) (-2641.507) [-2630.133] * (-2633.779) (-2639.299) (-2633.263) [-2638.287] -- 0:02:31
      142500 -- [-2635.131] (-2638.250) (-2633.488) (-2646.384) * (-2636.270) [-2635.200] (-2636.942) (-2634.478) -- 0:02:30
      143000 -- (-2635.023) (-2640.954) [-2634.998] (-2640.803) * [-2635.756] (-2637.913) (-2637.482) (-2642.559) -- 0:02:29
      143500 -- (-2633.482) [-2634.103] (-2637.140) (-2636.207) * (-2635.294) (-2643.189) (-2637.797) [-2635.114] -- 0:02:29
      144000 -- (-2635.751) [-2633.833] (-2633.694) (-2632.722) * (-2635.969) (-2640.243) [-2631.310] (-2636.303) -- 0:02:34
      144500 -- (-2640.832) (-2639.609) (-2639.518) [-2634.479] * (-2635.825) (-2639.976) (-2641.256) [-2634.771] -- 0:02:33
      145000 -- (-2637.124) [-2632.832] (-2643.760) (-2631.879) * (-2634.285) [-2636.434] (-2638.600) (-2634.337) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-2635.895) (-2637.617) [-2637.713] (-2631.962) * [-2638.541] (-2633.498) (-2640.940) (-2636.317) -- 0:02:32
      146000 -- (-2633.744) [-2633.260] (-2648.361) (-2636.292) * (-2648.429) [-2636.814] (-2635.216) (-2636.800) -- 0:02:32
      146500 -- (-2633.628) (-2644.493) (-2637.079) [-2632.737] * (-2636.432) [-2636.818] (-2635.883) (-2635.149) -- 0:02:31
      147000 -- (-2632.704) [-2636.409] (-2638.259) (-2639.047) * (-2634.742) (-2638.703) (-2634.758) [-2634.701] -- 0:02:30
      147500 -- (-2633.543) (-2633.446) (-2635.038) [-2633.500] * [-2632.717] (-2635.508) (-2638.996) (-2633.769) -- 0:02:30
      148000 -- (-2638.668) (-2639.123) (-2633.952) [-2633.533] * (-2640.846) (-2638.293) [-2635.702] (-2641.245) -- 0:02:29
      148500 -- (-2635.315) [-2635.120] (-2637.984) (-2635.187) * [-2637.098] (-2636.370) (-2640.802) (-2640.597) -- 0:02:29
      149000 -- (-2636.189) (-2645.188) [-2633.702] (-2638.837) * (-2633.580) [-2636.431] (-2637.588) (-2636.489) -- 0:02:28
      149500 -- (-2637.626) [-2634.817] (-2636.336) (-2635.884) * (-2636.087) [-2636.919] (-2634.555) (-2633.375) -- 0:02:33
      150000 -- (-2633.726) [-2636.041] (-2638.387) (-2639.327) * (-2639.644) (-2636.624) [-2638.463] (-2645.889) -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-2632.701) (-2635.044) (-2640.680) [-2634.474] * (-2631.405) (-2636.797) [-2639.290] (-2643.946) -- 0:02:32
      151000 -- [-2633.714] (-2634.163) (-2639.410) (-2638.448) * (-2636.522) (-2632.865) (-2639.644) [-2640.484] -- 0:02:31
      151500 -- (-2632.741) (-2636.836) [-2636.487] (-2635.842) * (-2636.618) [-2633.272] (-2639.960) (-2636.070) -- 0:02:31
      152000 -- (-2638.374) (-2635.075) (-2634.997) [-2640.485] * [-2634.380] (-2639.477) (-2637.954) (-2638.998) -- 0:02:30
      152500 -- [-2632.015] (-2636.314) (-2636.332) (-2633.785) * [-2640.045] (-2636.523) (-2631.095) (-2639.808) -- 0:02:30
      153000 -- (-2635.246) [-2636.180] (-2635.827) (-2637.648) * (-2638.910) [-2640.100] (-2636.660) (-2641.184) -- 0:02:29
      153500 -- (-2635.836) (-2635.519) [-2632.867] (-2643.265) * [-2644.849] (-2642.419) (-2635.915) (-2642.552) -- 0:02:28
      154000 -- [-2637.622] (-2638.892) (-2635.532) (-2644.184) * (-2638.742) (-2644.004) (-2634.897) [-2634.358] -- 0:02:28
      154500 -- (-2631.542) (-2638.417) [-2636.887] (-2634.054) * (-2640.259) (-2636.136) (-2648.356) [-2639.158] -- 0:02:27
      155000 -- (-2641.055) (-2636.024) (-2642.124) [-2635.284] * (-2633.921) (-2637.105) (-2630.987) [-2638.818] -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-2639.336) (-2631.972) [-2633.212] (-2640.181) * [-2632.036] (-2635.991) (-2632.355) (-2637.284) -- 0:02:32
      156000 -- (-2638.984) (-2635.706) (-2639.599) [-2632.064] * (-2636.568) [-2633.598] (-2636.659) (-2639.953) -- 0:02:31
      156500 -- (-2635.132) (-2632.766) (-2634.737) [-2636.445] * (-2633.936) (-2641.515) [-2634.789] (-2636.988) -- 0:02:30
      157000 -- (-2641.537) (-2636.432) [-2634.747] (-2639.071) * (-2635.373) (-2633.633) (-2640.744) [-2634.158] -- 0:02:30
      157500 -- (-2635.663) [-2631.802] (-2637.574) (-2637.730) * (-2638.474) (-2637.833) (-2637.074) [-2637.452] -- 0:02:29
      158000 -- (-2635.260) (-2634.921) [-2634.160] (-2639.130) * (-2633.282) (-2636.620) (-2640.071) [-2633.176] -- 0:02:29
      158500 -- (-2634.939) (-2636.009) (-2638.354) [-2637.516] * [-2636.156] (-2636.112) (-2636.672) (-2634.016) -- 0:02:28
      159000 -- [-2632.894] (-2639.724) (-2636.994) (-2634.906) * (-2637.862) (-2631.963) (-2635.925) [-2633.950] -- 0:02:28
      159500 -- (-2637.197) (-2633.320) (-2632.822) [-2636.089] * [-2635.677] (-2637.144) (-2634.911) (-2639.799) -- 0:02:27
      160000 -- (-2631.173) [-2631.726] (-2635.013) (-2629.735) * (-2634.238) (-2636.081) (-2634.841) [-2637.853] -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      160500 -- [-2634.104] (-2634.608) (-2637.331) (-2635.221) * (-2634.403) [-2633.563] (-2642.213) (-2636.386) -- 0:02:26
      161000 -- (-2632.207) (-2634.224) (-2632.990) [-2636.108] * (-2637.072) [-2634.466] (-2632.915) (-2635.379) -- 0:02:31
      161500 -- (-2638.281) [-2637.005] (-2635.444) (-2643.056) * [-2637.312] (-2637.315) (-2637.543) (-2638.808) -- 0:02:30
      162000 -- [-2632.578] (-2638.253) (-2633.142) (-2632.619) * (-2636.097) [-2633.759] (-2640.494) (-2641.255) -- 0:02:30
      162500 -- (-2635.291) (-2640.107) (-2638.993) [-2632.168] * [-2632.997] (-2635.568) (-2639.675) (-2639.312) -- 0:02:29
      163000 -- (-2641.243) (-2634.240) [-2635.592] (-2645.677) * (-2631.871) (-2636.332) [-2637.723] (-2637.945) -- 0:02:28
      163500 -- (-2631.999) [-2635.080] (-2633.324) (-2638.683) * (-2637.650) (-2634.836) [-2642.084] (-2638.281) -- 0:02:28
      164000 -- (-2642.675) (-2634.827) [-2632.419] (-2639.220) * (-2634.470) [-2634.514] (-2638.366) (-2638.454) -- 0:02:27
      164500 -- (-2635.062) (-2637.886) [-2632.920] (-2642.425) * [-2639.220] (-2637.329) (-2631.105) (-2635.275) -- 0:02:27
      165000 -- (-2638.299) (-2635.953) (-2641.496) [-2637.569] * [-2634.106] (-2636.346) (-2635.021) (-2636.620) -- 0:02:26

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-2630.640] (-2632.506) (-2635.760) (-2637.794) * (-2642.049) [-2637.969] (-2639.576) (-2639.460) -- 0:02:26
      166000 -- (-2636.483) (-2634.335) (-2639.437) [-2634.746] * (-2635.276) (-2634.418) (-2634.434) [-2632.969] -- 0:02:25
      166500 -- [-2632.635] (-2639.547) (-2635.926) (-2634.603) * (-2641.371) [-2631.649] (-2639.693) (-2638.265) -- 0:02:30
      167000 -- (-2637.295) (-2638.195) [-2634.470] (-2638.451) * [-2634.500] (-2633.978) (-2638.220) (-2636.111) -- 0:02:29
      167500 -- [-2634.301] (-2635.875) (-2642.047) (-2636.455) * (-2633.057) [-2632.473] (-2637.284) (-2640.384) -- 0:02:29
      168000 -- [-2632.654] (-2636.369) (-2631.725) (-2633.584) * [-2634.660] (-2635.625) (-2635.751) (-2641.602) -- 0:02:28
      168500 -- [-2631.760] (-2639.360) (-2637.088) (-2652.322) * (-2637.200) (-2639.505) [-2632.202] (-2634.955) -- 0:02:28
      169000 -- [-2633.268] (-2633.148) (-2638.175) (-2642.908) * [-2641.089] (-2636.223) (-2637.273) (-2633.719) -- 0:02:27
      169500 -- (-2632.917) (-2637.086) [-2634.618] (-2641.850) * (-2638.624) (-2636.263) (-2639.129) [-2638.169] -- 0:02:26
      170000 -- (-2633.761) (-2639.862) [-2634.749] (-2641.390) * (-2648.419) (-2638.583) (-2639.715) [-2632.416] -- 0:02:26

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-2630.149) (-2632.964) (-2638.412) [-2637.418] * (-2640.625) [-2638.764] (-2643.168) (-2634.113) -- 0:02:25
      171000 -- (-2636.683) [-2636.856] (-2634.617) (-2638.161) * (-2633.320) (-2633.479) (-2634.292) [-2634.135] -- 0:02:25
      171500 -- (-2641.279) (-2637.577) (-2632.675) [-2633.230] * (-2633.428) (-2631.008) [-2633.653] (-2633.814) -- 0:02:24
      172000 -- (-2637.608) [-2632.845] (-2633.400) (-2638.294) * [-2637.517] (-2634.891) (-2637.647) (-2634.988) -- 0:02:29
      172500 -- (-2637.878) (-2636.850) [-2636.380] (-2635.849) * (-2635.327) [-2633.753] (-2635.184) (-2646.323) -- 0:02:28
      173000 -- (-2637.876) (-2639.236) [-2634.404] (-2633.454) * (-2631.521) (-2637.079) (-2633.916) [-2638.990] -- 0:02:28
      173500 -- (-2634.976) (-2636.167) (-2641.791) [-2636.266] * [-2638.318] (-2640.010) (-2631.659) (-2639.435) -- 0:02:27
      174000 -- [-2634.848] (-2641.629) (-2634.047) (-2638.105) * (-2639.173) [-2642.031] (-2634.035) (-2636.942) -- 0:02:27
      174500 -- [-2636.198] (-2643.703) (-2635.477) (-2632.491) * [-2631.807] (-2643.309) (-2638.370) (-2636.111) -- 0:02:26
      175000 -- (-2635.000) (-2638.627) (-2642.655) [-2633.212] * [-2642.749] (-2635.767) (-2641.223) (-2643.492) -- 0:02:26

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-2641.165) (-2635.620) [-2633.855] (-2636.676) * [-2636.556] (-2642.028) (-2635.845) (-2638.367) -- 0:02:25
      176000 -- (-2632.531) (-2633.794) [-2634.510] (-2636.521) * (-2639.316) (-2638.717) [-2636.967] (-2641.005) -- 0:02:25
      176500 -- [-2636.271] (-2635.809) (-2635.058) (-2637.727) * (-2639.796) (-2640.810) (-2636.196) [-2638.877] -- 0:02:24
      177000 -- (-2640.933) (-2635.471) [-2634.240] (-2632.052) * [-2637.931] (-2638.742) (-2639.379) (-2638.597) -- 0:02:24
      177500 -- (-2646.282) (-2635.980) (-2638.783) [-2637.782] * (-2639.947) [-2635.285] (-2638.813) (-2641.428) -- 0:02:23
      178000 -- [-2635.634] (-2633.847) (-2634.471) (-2639.337) * (-2635.202) [-2634.534] (-2640.591) (-2635.883) -- 0:02:27
      178500 -- (-2632.845) (-2633.083) (-2635.590) [-2636.722] * (-2635.255) (-2638.933) (-2638.539) [-2635.009] -- 0:02:27
      179000 -- [-2633.031] (-2634.822) (-2632.236) (-2644.367) * [-2630.637] (-2634.392) (-2638.381) (-2635.589) -- 0:02:26
      179500 -- [-2634.710] (-2639.146) (-2636.106) (-2635.129) * (-2630.022) (-2632.329) [-2635.307] (-2635.760) -- 0:02:26
      180000 -- (-2632.608) (-2645.057) [-2638.380] (-2633.082) * (-2636.740) (-2632.586) (-2640.760) [-2637.819] -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      180500 -- [-2632.579] (-2635.648) (-2638.197) (-2640.779) * [-2632.511] (-2632.909) (-2634.856) (-2634.311) -- 0:02:25
      181000 -- (-2639.675) [-2633.080] (-2632.181) (-2637.021) * (-2636.915) [-2638.492] (-2636.221) (-2637.690) -- 0:02:24
      181500 -- [-2636.108] (-2639.304) (-2639.477) (-2646.328) * [-2633.872] (-2635.863) (-2632.375) (-2632.414) -- 0:02:24
      182000 -- (-2643.434) (-2634.334) (-2635.527) [-2637.240] * (-2637.913) (-2634.159) (-2631.973) [-2634.560] -- 0:02:23
      182500 -- [-2636.139] (-2636.346) (-2637.393) (-2639.536) * [-2637.482] (-2632.863) (-2632.691) (-2631.958) -- 0:02:23
      183000 -- [-2636.174] (-2639.684) (-2635.897) (-2634.754) * (-2634.512) (-2631.959) [-2632.912] (-2635.277) -- 0:02:22
      183500 -- (-2632.949) (-2634.588) [-2633.958] (-2635.568) * (-2636.573) [-2637.867] (-2635.086) (-2640.977) -- 0:02:26
      184000 -- (-2636.576) (-2634.721) (-2634.582) [-2642.640] * (-2636.312) (-2638.339) [-2636.183] (-2646.818) -- 0:02:26
      184500 -- (-2641.666) (-2638.754) [-2632.895] (-2642.749) * (-2639.235) (-2637.748) [-2635.534] (-2636.196) -- 0:02:25
      185000 -- [-2638.612] (-2639.261) (-2634.404) (-2638.108) * (-2634.264) (-2633.545) [-2633.251] (-2639.750) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-2635.333) (-2641.257) [-2633.637] (-2638.291) * (-2633.948) (-2633.373) [-2634.102] (-2637.972) -- 0:02:24
      186000 -- (-2633.406) (-2636.451) (-2632.900) [-2638.804] * [-2641.491] (-2636.526) (-2638.945) (-2639.469) -- 0:02:24
      186500 -- (-2635.502) [-2634.686] (-2631.271) (-2635.170) * (-2637.964) (-2634.419) [-2632.212] (-2641.372) -- 0:02:23
      187000 -- [-2634.613] (-2644.895) (-2635.555) (-2635.690) * (-2640.101) [-2636.608] (-2634.729) (-2638.677) -- 0:02:23
      187500 -- (-2635.621) (-2639.097) [-2636.761] (-2637.745) * (-2635.530) [-2630.026] (-2637.599) (-2632.290) -- 0:02:23
      188000 -- (-2634.706) [-2643.267] (-2637.418) (-2635.314) * (-2635.165) [-2636.366] (-2637.370) (-2638.696) -- 0:02:22
      188500 -- (-2633.455) (-2641.204) [-2634.024] (-2634.547) * (-2635.230) (-2640.113) [-2634.938] (-2635.960) -- 0:02:22
      189000 -- (-2631.024) (-2642.192) (-2634.539) [-2635.594] * (-2640.688) (-2638.902) [-2634.088] (-2644.045) -- 0:02:25
      189500 -- (-2641.182) (-2636.456) [-2634.065] (-2635.716) * (-2645.303) [-2634.360] (-2638.638) (-2637.343) -- 0:02:25
      190000 -- [-2640.376] (-2633.809) (-2640.884) (-2636.801) * [-2637.272] (-2639.246) (-2638.298) (-2634.041) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-2640.782) (-2634.011) (-2636.072) [-2634.888] * (-2636.967) (-2637.743) [-2634.130] (-2637.740) -- 0:02:24
      191000 -- (-2633.688) [-2632.979] (-2639.473) (-2632.607) * (-2639.389) [-2639.422] (-2637.747) (-2632.512) -- 0:02:24
      191500 -- (-2634.935) [-2632.324] (-2638.762) (-2635.872) * (-2638.429) [-2638.114] (-2633.823) (-2637.595) -- 0:02:23
      192000 -- [-2634.361] (-2631.403) (-2637.359) (-2639.520) * (-2642.639) [-2638.223] (-2642.261) (-2633.050) -- 0:02:23
      192500 -- (-2635.380) (-2637.945) [-2641.083] (-2632.339) * (-2636.034) (-2641.435) [-2630.203] (-2638.788) -- 0:02:22
      193000 -- (-2632.807) [-2632.106] (-2642.467) (-2632.972) * [-2635.157] (-2639.533) (-2637.519) (-2636.908) -- 0:02:22
      193500 -- (-2636.084) (-2639.364) (-2638.757) [-2634.474] * (-2635.967) (-2639.919) [-2631.898] (-2636.415) -- 0:02:21
      194000 -- [-2637.372] (-2640.636) (-2633.552) (-2634.799) * (-2636.945) [-2637.416] (-2637.754) (-2632.025) -- 0:02:21
      194500 -- (-2639.847) (-2636.808) (-2642.280) [-2636.339] * (-2631.372) (-2635.420) [-2637.918] (-2636.141) -- 0:02:24
      195000 -- (-2643.062) (-2649.479) (-2640.200) [-2631.480] * (-2636.452) [-2637.206] (-2636.137) (-2637.457) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-2642.742) (-2647.004) [-2640.615] (-2632.969) * (-2635.135) (-2642.640) [-2636.340] (-2636.906) -- 0:02:24
      196000 -- (-2634.804) [-2635.475] (-2637.328) (-2632.271) * (-2640.065) [-2635.662] (-2638.182) (-2636.141) -- 0:02:23
      196500 -- (-2635.373) (-2641.051) [-2637.803] (-2631.989) * (-2639.439) [-2636.105] (-2631.861) (-2638.316) -- 0:02:23
      197000 -- (-2635.268) [-2640.345] (-2640.639) (-2637.345) * (-2638.146) (-2635.600) [-2637.224] (-2636.668) -- 0:02:22
      197500 -- (-2637.718) [-2640.013] (-2634.622) (-2634.695) * (-2639.618) (-2635.158) (-2643.383) [-2631.522] -- 0:02:22
      198000 -- (-2631.409) (-2642.471) [-2641.782] (-2632.190) * (-2630.831) (-2635.546) (-2634.933) [-2633.666] -- 0:02:21
      198500 -- (-2640.745) (-2636.029) [-2635.986] (-2631.540) * (-2639.109) (-2636.538) (-2636.346) [-2639.221] -- 0:02:21
      199000 -- (-2640.405) [-2635.587] (-2638.162) (-2633.631) * (-2635.155) [-2637.043] (-2636.882) (-2637.423) -- 0:02:20
      199500 -- [-2636.129] (-2639.156) (-2635.471) (-2631.725) * (-2634.696) (-2634.427) [-2635.763] (-2636.967) -- 0:02:20
      200000 -- (-2632.860) [-2640.306] (-2638.822) (-2635.312) * (-2638.908) [-2632.726] (-2634.192) (-2638.414) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-2631.540) (-2639.903) [-2633.474] (-2639.485) * (-2635.262) (-2637.339) [-2635.162] (-2636.342) -- 0:02:23
      201000 -- [-2636.663] (-2640.603) (-2633.480) (-2634.404) * [-2637.169] (-2637.095) (-2632.221) (-2637.969) -- 0:02:23
      201500 -- (-2632.942) [-2633.491] (-2632.563) (-2636.170) * (-2633.644) (-2643.079) [-2638.088] (-2636.073) -- 0:02:22
      202000 -- [-2631.629] (-2635.228) (-2634.643) (-2639.476) * (-2634.874) [-2634.526] (-2636.977) (-2635.089) -- 0:02:22
      202500 -- (-2638.418) (-2637.514) (-2635.860) [-2639.308] * (-2630.281) (-2634.741) [-2633.706] (-2638.727) -- 0:02:21
      203000 -- [-2632.715] (-2635.976) (-2636.930) (-2645.125) * (-2629.350) (-2631.179) [-2634.741] (-2635.411) -- 0:02:21
      203500 -- [-2630.698] (-2631.605) (-2636.374) (-2636.160) * (-2631.166) (-2636.251) [-2634.040] (-2637.870) -- 0:02:20
      204000 -- (-2635.221) [-2635.570] (-2635.686) (-2638.054) * [-2633.752] (-2634.686) (-2634.595) (-2634.804) -- 0:02:20
      204500 -- (-2637.416) (-2632.188) (-2640.740) [-2634.227] * [-2630.119] (-2639.999) (-2629.446) (-2645.700) -- 0:02:20
      205000 -- (-2638.753) (-2640.484) (-2635.457) [-2631.910] * (-2639.816) (-2635.049) (-2631.995) [-2635.687] -- 0:02:19

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-2636.867) (-2632.284) [-2638.403] (-2635.018) * (-2633.352) (-2634.056) [-2639.884] (-2632.921) -- 0:02:19
      206000 -- (-2634.355) [-2635.934] (-2639.839) (-2640.250) * [-2635.252] (-2634.575) (-2642.309) (-2633.632) -- 0:02:22
      206500 -- (-2638.049) (-2635.329) [-2637.209] (-2633.062) * (-2634.948) (-2632.494) [-2638.479] (-2633.606) -- 0:02:22
      207000 -- (-2637.384) [-2632.790] (-2642.941) (-2638.572) * (-2634.425) (-2634.938) [-2636.081] (-2633.229) -- 0:02:21
      207500 -- (-2640.070) [-2637.600] (-2635.973) (-2632.030) * [-2633.776] (-2631.913) (-2636.128) (-2636.008) -- 0:02:21
      208000 -- (-2638.385) (-2635.565) (-2634.063) [-2633.613] * [-2633.300] (-2631.802) (-2630.786) (-2637.409) -- 0:02:20
      208500 -- (-2636.866) (-2636.550) [-2632.018] (-2636.492) * (-2630.299) [-2634.994] (-2636.447) (-2636.021) -- 0:02:20
      209000 -- (-2632.352) [-2640.544] (-2643.767) (-2631.934) * (-2633.438) [-2632.572] (-2637.652) (-2635.641) -- 0:02:20
      209500 -- (-2631.593) (-2634.185) (-2638.599) [-2631.850] * (-2635.335) (-2631.122) (-2638.639) [-2640.332] -- 0:02:19
      210000 -- (-2638.667) (-2630.964) (-2637.251) [-2636.860] * (-2639.987) [-2633.273] (-2636.815) (-2635.523) -- 0:02:19

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-2649.173) (-2638.784) (-2634.447) [-2635.567] * (-2637.596) (-2634.679) [-2634.184] (-2637.872) -- 0:02:18
      211000 -- (-2637.685) (-2633.186) (-2632.021) [-2636.911] * (-2639.001) (-2638.303) [-2633.252] (-2637.021) -- 0:02:18
      211500 -- [-2636.920] (-2638.643) (-2635.764) (-2639.782) * (-2644.678) (-2632.127) (-2636.120) [-2632.129] -- 0:02:21
      212000 -- (-2635.306) (-2629.979) (-2639.020) [-2632.605] * (-2641.963) [-2634.396] (-2634.959) (-2637.759) -- 0:02:21
      212500 -- (-2640.575) (-2641.885) (-2638.212) [-2633.768] * (-2641.527) (-2635.415) (-2639.624) [-2633.836] -- 0:02:20
      213000 -- (-2638.126) [-2635.471] (-2636.704) (-2637.972) * (-2638.164) (-2637.845) [-2633.405] (-2635.650) -- 0:02:20
      213500 -- [-2643.587] (-2636.927) (-2635.184) (-2641.612) * (-2638.990) (-2634.347) (-2630.651) [-2633.462] -- 0:02:19
      214000 -- (-2637.172) (-2639.852) [-2638.262] (-2642.282) * (-2640.731) (-2637.082) [-2640.615] (-2637.739) -- 0:02:19
      214500 -- [-2637.442] (-2634.775) (-2638.414) (-2638.722) * (-2633.625) (-2636.591) (-2634.663) [-2637.025] -- 0:02:19
      215000 -- [-2637.639] (-2642.399) (-2640.980) (-2643.484) * (-2631.109) (-2635.151) (-2637.146) [-2632.636] -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-2636.273) [-2633.932] (-2638.724) (-2636.655) * (-2630.631) (-2638.003) [-2633.012] (-2637.367) -- 0:02:18
      216000 -- (-2633.157) (-2635.713) (-2643.000) [-2631.471] * (-2631.938) (-2637.960) [-2631.759] (-2639.855) -- 0:02:17
      216500 -- [-2635.294] (-2635.902) (-2638.316) (-2634.238) * (-2641.597) [-2632.005] (-2634.137) (-2635.342) -- 0:02:17
      217000 -- (-2635.903) (-2636.864) [-2636.792] (-2632.905) * [-2638.384] (-2636.673) (-2637.614) (-2639.201) -- 0:02:20
      217500 -- (-2633.236) (-2638.842) (-2635.687) [-2631.946] * (-2634.391) (-2638.373) (-2635.534) [-2630.167] -- 0:02:20
      218000 -- (-2637.269) [-2637.103] (-2637.788) (-2636.877) * (-2634.571) (-2642.568) (-2635.595) [-2633.113] -- 0:02:19
      218500 -- [-2632.973] (-2639.449) (-2629.853) (-2639.176) * (-2634.490) [-2643.023] (-2643.806) (-2635.086) -- 0:02:19
      219000 -- (-2635.063) [-2633.908] (-2637.300) (-2638.710) * [-2632.992] (-2636.338) (-2635.440) (-2633.958) -- 0:02:19
      219500 -- (-2636.303) (-2635.900) (-2636.477) [-2639.573] * [-2637.944] (-2636.011) (-2636.159) (-2636.949) -- 0:02:18
      220000 -- [-2634.512] (-2636.476) (-2639.534) (-2635.965) * (-2634.951) (-2636.570) (-2637.644) [-2631.427] -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      220500 -- [-2635.654] (-2635.109) (-2637.655) (-2641.397) * (-2638.651) [-2638.521] (-2637.593) (-2638.782) -- 0:02:17
      221000 -- (-2639.452) [-2634.217] (-2632.616) (-2634.193) * (-2630.384) [-2633.238] (-2634.532) (-2632.149) -- 0:02:17
      221500 -- (-2639.594) (-2632.689) [-2631.509] (-2634.522) * (-2633.728) (-2635.113) [-2633.558] (-2637.214) -- 0:02:17
      222000 -- (-2632.948) (-2637.294) (-2636.592) [-2632.480] * (-2639.212) [-2633.593] (-2643.878) (-2639.629) -- 0:02:16
      222500 -- (-2636.446) (-2640.369) (-2637.367) [-2638.421] * (-2638.847) [-2638.090] (-2638.958) (-2639.119) -- 0:02:16
      223000 -- (-2639.931) [-2637.514] (-2640.866) (-2633.122) * (-2636.537) (-2639.448) (-2631.629) [-2635.949] -- 0:02:19
      223500 -- [-2636.462] (-2647.714) (-2634.068) (-2635.814) * (-2640.491) (-2635.917) [-2637.078] (-2632.653) -- 0:02:18
      224000 -- (-2635.554) (-2638.744) (-2638.209) [-2633.123] * (-2636.091) (-2635.155) [-2639.189] (-2642.485) -- 0:02:18
      224500 -- (-2634.656) (-2634.293) (-2637.927) [-2633.296] * [-2634.898] (-2637.934) (-2640.315) (-2632.818) -- 0:02:18
      225000 -- [-2634.346] (-2634.993) (-2633.956) (-2632.995) * [-2631.510] (-2629.313) (-2633.257) (-2636.996) -- 0:02:17

      Average standard deviation of split frequencies: 0.000000

      225500 -- [-2633.866] (-2635.730) (-2637.501) (-2640.031) * (-2639.173) (-2632.005) [-2634.159] (-2643.854) -- 0:02:17
      226000 -- (-2641.986) (-2641.339) (-2636.558) [-2635.670] * (-2632.435) (-2632.583) (-2634.540) [-2632.471] -- 0:02:16
      226500 -- [-2632.084] (-2631.394) (-2634.584) (-2638.530) * [-2636.208] (-2634.050) (-2637.472) (-2635.636) -- 0:02:16
      227000 -- (-2637.873) [-2633.004] (-2640.351) (-2636.168) * (-2637.361) [-2632.627] (-2633.404) (-2635.937) -- 0:02:16
      227500 -- (-2634.007) (-2639.472) (-2646.633) [-2637.075] * (-2634.711) (-2633.245) (-2635.756) [-2638.484] -- 0:02:15
      228000 -- (-2634.475) [-2644.304] (-2637.651) (-2636.187) * (-2634.050) (-2634.272) [-2637.781] (-2636.379) -- 0:02:15
      228500 -- [-2633.000] (-2636.760) (-2640.984) (-2635.205) * [-2631.695] (-2632.389) (-2634.967) (-2633.645) -- 0:02:18
      229000 -- (-2630.452) (-2634.976) [-2638.046] (-2635.065) * (-2633.025) (-2636.994) (-2636.831) [-2635.107] -- 0:02:18
      229500 -- (-2632.620) (-2638.957) [-2632.280] (-2633.094) * (-2634.938) (-2632.171) [-2640.893] (-2647.830) -- 0:02:17
      230000 -- (-2638.158) (-2638.305) (-2639.750) [-2633.960] * (-2638.791) [-2640.664] (-2631.723) (-2641.557) -- 0:02:17

      Average standard deviation of split frequencies: 0.000000

      230500 -- [-2632.290] (-2642.573) (-2648.919) (-2636.611) * (-2639.385) (-2636.353) [-2634.663] (-2636.651) -- 0:02:16
      231000 -- (-2640.298) [-2635.552] (-2635.907) (-2642.890) * (-2641.206) [-2637.064] (-2636.344) (-2636.858) -- 0:02:16
      231500 -- (-2638.365) (-2639.944) (-2637.147) [-2633.463] * (-2636.608) [-2637.882] (-2636.360) (-2636.120) -- 0:02:16
      232000 -- (-2637.819) [-2634.829] (-2635.429) (-2636.456) * (-2633.781) [-2632.813] (-2633.037) (-2643.704) -- 0:02:15
      232500 -- (-2638.920) (-2636.949) (-2630.969) [-2632.736] * (-2641.966) [-2638.074] (-2635.330) (-2636.887) -- 0:02:15
      233000 -- (-2641.860) [-2631.858] (-2632.346) (-2637.096) * (-2633.648) [-2637.273] (-2631.368) (-2638.592) -- 0:02:14
      233500 -- (-2644.775) (-2637.077) (-2636.828) [-2633.582] * (-2637.738) [-2639.368] (-2640.510) (-2638.223) -- 0:02:14
      234000 -- [-2637.480] (-2639.807) (-2641.702) (-2633.693) * (-2638.688) [-2637.078] (-2636.744) (-2642.725) -- 0:02:17
      234500 -- (-2633.029) [-2638.937] (-2641.785) (-2643.693) * (-2638.528) (-2636.570) [-2636.415] (-2636.009) -- 0:02:17
      235000 -- (-2634.531) (-2636.041) (-2646.165) [-2636.389] * (-2633.721) (-2635.937) [-2632.451] (-2633.492) -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-2634.945) (-2642.438) (-2640.553) [-2639.714] * [-2634.684] (-2634.250) (-2642.936) (-2640.195) -- 0:02:16
      236000 -- (-2637.814) (-2632.430) (-2638.785) [-2638.118] * (-2635.662) (-2637.396) (-2635.716) [-2638.015] -- 0:02:15
      236500 -- (-2636.041) [-2634.385] (-2644.622) (-2638.704) * (-2633.486) [-2635.204] (-2643.111) (-2640.193) -- 0:02:15
      237000 -- [-2634.691] (-2632.374) (-2634.119) (-2634.380) * [-2634.928] (-2638.372) (-2649.372) (-2631.136) -- 0:02:15
      237500 -- (-2638.632) (-2642.699) (-2638.720) [-2633.916] * (-2636.126) [-2631.613] (-2642.688) (-2636.754) -- 0:02:14
      238000 -- (-2638.168) (-2635.291) (-2635.344) [-2636.165] * [-2632.110] (-2635.576) (-2636.248) (-2640.226) -- 0:02:14
      238500 -- (-2635.956) (-2634.842) [-2636.958] (-2637.328) * (-2638.115) [-2637.096] (-2640.040) (-2632.827) -- 0:02:14
      239000 -- (-2632.452) (-2632.299) [-2630.884] (-2631.706) * (-2638.769) [-2637.166] (-2638.854) (-2632.294) -- 0:02:13
      239500 -- (-2633.877) (-2641.040) (-2640.214) [-2636.151] * (-2633.142) [-2637.317] (-2639.787) (-2639.940) -- 0:02:13
      240000 -- (-2634.055) [-2635.920] (-2635.104) (-2638.839) * (-2632.472) (-2637.386) (-2634.661) [-2633.542] -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      240500 -- [-2636.439] (-2632.552) (-2636.725) (-2641.409) * (-2634.115) [-2636.430] (-2634.944) (-2635.507) -- 0:02:15
      241000 -- (-2635.241) (-2633.035) (-2638.152) [-2632.852] * (-2634.428) (-2633.382) (-2634.327) [-2635.772] -- 0:02:15
      241500 -- (-2635.049) [-2629.794] (-2632.060) (-2636.329) * (-2633.814) [-2636.325] (-2635.558) (-2637.468) -- 0:02:15
      242000 -- (-2634.888) (-2640.694) [-2640.927] (-2637.405) * (-2632.288) (-2634.431) [-2635.751] (-2641.793) -- 0:02:14
      242500 -- (-2637.414) [-2638.070] (-2634.330) (-2635.348) * (-2632.329) (-2631.902) (-2636.375) [-2638.649] -- 0:02:14
      243000 -- [-2638.955] (-2641.566) (-2638.000) (-2634.889) * (-2634.816) [-2634.445] (-2642.475) (-2632.156) -- 0:02:13
      243500 -- (-2636.071) (-2636.307) (-2634.701) [-2639.188] * (-2644.821) [-2632.385] (-2640.029) (-2631.935) -- 0:02:13
      244000 -- (-2635.717) [-2634.236] (-2634.004) (-2641.523) * (-2638.899) (-2633.022) (-2637.199) [-2633.819] -- 0:02:13
      244500 -- (-2635.800) (-2636.590) (-2636.017) [-2635.787] * (-2633.945) (-2636.615) [-2631.540] (-2644.616) -- 0:02:12
      245000 -- [-2635.079] (-2633.842) (-2631.575) (-2637.322) * (-2637.443) [-2633.658] (-2643.149) (-2640.938) -- 0:02:12

      Average standard deviation of split frequencies: 0.000000

      245500 -- [-2634.268] (-2633.493) (-2635.194) (-2637.836) * (-2635.116) [-2632.845] (-2631.676) (-2635.433) -- 0:02:15
      246000 -- [-2632.435] (-2634.669) (-2639.318) (-2634.507) * [-2635.807] (-2636.090) (-2632.270) (-2644.756) -- 0:02:14
      246500 -- (-2635.188) (-2638.122) (-2635.303) [-2635.862] * [-2633.405] (-2633.237) (-2633.410) (-2645.454) -- 0:02:14
      247000 -- (-2636.174) (-2637.506) (-2635.501) [-2634.020] * [-2635.431] (-2639.249) (-2640.242) (-2651.575) -- 0:02:14
      247500 -- (-2638.874) (-2637.032) (-2641.255) [-2636.837] * [-2636.058] (-2635.598) (-2635.015) (-2638.757) -- 0:02:13
      248000 -- (-2634.487) [-2637.064] (-2643.122) (-2637.954) * (-2636.932) [-2631.620] (-2633.871) (-2632.782) -- 0:02:13
      248500 -- (-2633.375) (-2637.594) (-2643.204) [-2635.934] * [-2641.787] (-2635.321) (-2636.224) (-2646.164) -- 0:02:13
      249000 -- (-2636.513) (-2635.247) (-2635.398) [-2639.045] * (-2634.885) (-2639.041) (-2634.953) [-2647.159] -- 0:02:12
      249500 -- (-2633.185) [-2639.110] (-2638.662) (-2636.070) * (-2635.750) (-2633.455) [-2634.418] (-2638.321) -- 0:02:12
      250000 -- (-2632.759) [-2640.994] (-2636.349) (-2637.106) * (-2636.453) (-2631.752) [-2631.818] (-2637.824) -- 0:02:12

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-2638.596) (-2642.634) [-2638.500] (-2636.614) * (-2632.735) [-2631.264] (-2631.129) (-2632.152) -- 0:02:11
      251000 -- (-2638.320) [-2638.227] (-2636.860) (-2637.669) * (-2640.315) (-2636.141) (-2631.256) [-2638.958] -- 0:02:14
      251500 -- (-2638.496) (-2636.364) [-2640.074] (-2639.111) * [-2641.134] (-2635.295) (-2630.985) (-2638.643) -- 0:02:13
      252000 -- (-2637.858) (-2636.971) (-2632.525) [-2636.287] * [-2634.168] (-2645.534) (-2634.131) (-2635.896) -- 0:02:13
      252500 -- (-2642.437) (-2632.838) (-2633.995) [-2637.513] * (-2633.801) (-2642.863) (-2635.098) [-2632.588] -- 0:02:13
      253000 -- [-2640.982] (-2632.701) (-2633.846) (-2638.939) * (-2634.932) (-2639.720) (-2634.384) [-2634.781] -- 0:02:12
      253500 -- (-2639.760) [-2642.463] (-2634.690) (-2642.342) * (-2635.993) (-2634.171) (-2633.083) [-2641.259] -- 0:02:12
      254000 -- (-2641.864) [-2632.806] (-2636.323) (-2634.394) * [-2634.437] (-2634.822) (-2639.360) (-2638.062) -- 0:02:12
      254500 -- [-2640.144] (-2637.839) (-2639.416) (-2634.946) * [-2639.083] (-2637.366) (-2640.323) (-2644.624) -- 0:02:11
      255000 -- (-2635.826) (-2633.857) (-2635.831) [-2631.748] * (-2638.140) [-2635.906] (-2639.151) (-2634.355) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-2637.451) [-2632.925] (-2639.578) (-2637.947) * (-2637.936) (-2633.541) (-2632.701) [-2634.173] -- 0:02:11
      256000 -- (-2635.323) [-2633.236] (-2635.995) (-2634.684) * [-2636.372] (-2638.355) (-2634.001) (-2637.824) -- 0:02:10
      256500 -- (-2640.212) (-2633.828) (-2639.071) [-2638.590] * (-2642.012) (-2643.238) [-2629.823] (-2634.070) -- 0:02:13
      257000 -- (-2635.410) (-2640.929) (-2633.371) [-2637.380] * (-2636.075) (-2635.857) [-2632.986] (-2643.420) -- 0:02:12
      257500 -- (-2641.041) (-2641.461) [-2632.070] (-2634.308) * (-2636.291) (-2632.995) [-2632.942] (-2636.172) -- 0:02:12
      258000 -- (-2635.225) [-2635.454] (-2633.619) (-2646.598) * (-2636.463) (-2641.131) (-2634.712) [-2632.462] -- 0:02:12
      258500 -- (-2633.944) [-2632.959] (-2636.828) (-2643.605) * [-2639.165] (-2635.702) (-2638.604) (-2629.278) -- 0:02:11
      259000 -- [-2635.746] (-2634.864) (-2643.797) (-2640.329) * [-2631.343] (-2636.489) (-2638.217) (-2637.291) -- 0:02:11
      259500 -- (-2633.206) (-2635.408) [-2634.813] (-2641.073) * [-2631.248] (-2642.796) (-2633.689) (-2634.589) -- 0:02:11
      260000 -- (-2635.121) (-2641.742) (-2639.539) [-2636.536] * (-2640.097) (-2635.791) [-2634.184] (-2634.655) -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-2635.193) (-2638.612) [-2633.761] (-2636.574) * (-2643.409) (-2636.249) (-2631.055) [-2633.195] -- 0:02:10
      261000 -- (-2641.801) (-2635.533) (-2637.270) [-2643.839] * (-2630.579) (-2633.838) [-2635.915] (-2637.310) -- 0:02:10
      261500 -- (-2633.877) (-2636.090) (-2639.373) [-2632.026] * [-2632.556] (-2640.868) (-2640.181) (-2636.710) -- 0:02:09
      262000 -- [-2639.409] (-2638.044) (-2634.999) (-2634.111) * (-2633.647) (-2633.040) (-2640.892) [-2636.541] -- 0:02:12
      262500 -- (-2634.897) (-2634.788) (-2637.444) [-2632.009] * (-2637.096) [-2631.836] (-2638.952) (-2635.888) -- 0:02:12
      263000 -- (-2634.488) (-2633.157) (-2636.527) [-2632.043] * (-2631.513) (-2636.352) (-2635.726) [-2635.878] -- 0:02:11
      263500 -- [-2632.267] (-2629.990) (-2632.316) (-2636.035) * (-2633.447) (-2636.085) [-2632.099] (-2633.451) -- 0:02:11
      264000 -- [-2633.785] (-2637.816) (-2633.255) (-2637.104) * (-2633.319) [-2635.882] (-2635.047) (-2641.928) -- 0:02:11
      264500 -- (-2634.403) (-2632.780) (-2634.968) [-2633.612] * [-2638.582] (-2638.438) (-2639.879) (-2637.603) -- 0:02:10
      265000 -- (-2634.402) [-2634.091] (-2636.192) (-2638.476) * (-2636.417) (-2636.481) (-2637.517) [-2633.279] -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      265500 -- [-2632.285] (-2636.835) (-2634.860) (-2636.854) * [-2633.110] (-2635.788) (-2630.628) (-2634.219) -- 0:02:10
      266000 -- (-2635.209) [-2635.637] (-2636.441) (-2646.353) * (-2637.631) (-2630.612) (-2637.696) [-2632.201] -- 0:02:09
      266500 -- [-2636.664] (-2639.616) (-2638.385) (-2645.452) * [-2642.385] (-2642.578) (-2637.898) (-2639.667) -- 0:02:09
      267000 -- (-2638.634) (-2640.970) (-2635.116) [-2637.637] * (-2638.987) [-2634.705] (-2640.840) (-2634.267) -- 0:02:09
      267500 -- [-2630.900] (-2640.814) (-2635.413) (-2635.474) * (-2637.698) (-2632.157) [-2634.324] (-2632.582) -- 0:02:08
      268000 -- (-2636.580) (-2635.423) (-2636.286) [-2633.351] * [-2642.342] (-2633.939) (-2634.054) (-2634.873) -- 0:02:11
      268500 -- (-2644.604) [-2633.199] (-2640.507) (-2642.004) * (-2640.232) (-2637.299) (-2635.219) [-2635.100] -- 0:02:10
      269000 -- (-2647.668) [-2636.608] (-2638.086) (-2636.779) * [-2637.737] (-2634.738) (-2635.719) (-2629.006) -- 0:02:10
      269500 -- (-2643.159) [-2632.910] (-2641.679) (-2633.061) * (-2644.316) (-2632.012) [-2637.939] (-2633.841) -- 0:02:10
      270000 -- (-2637.622) (-2634.663) [-2633.861] (-2640.281) * (-2641.673) (-2634.744) (-2635.593) [-2635.569] -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-2640.716) [-2637.550] (-2634.606) (-2639.235) * (-2645.209) (-2634.574) [-2637.756] (-2633.991) -- 0:02:09
      271000 -- (-2635.223) [-2636.640] (-2631.136) (-2633.132) * [-2636.408] (-2647.098) (-2634.818) (-2633.781) -- 0:02:09
      271500 -- (-2634.027) (-2634.324) (-2634.593) [-2635.488] * [-2636.002] (-2639.977) (-2632.930) (-2634.937) -- 0:02:08
      272000 -- (-2634.618) (-2639.409) (-2629.363) [-2636.957] * (-2633.538) (-2633.233) [-2631.762] (-2637.365) -- 0:02:08
      272500 -- (-2636.742) [-2639.114] (-2634.570) (-2643.543) * [-2632.530] (-2635.975) (-2634.803) (-2634.311) -- 0:02:08
      273000 -- (-2639.259) (-2635.615) [-2633.454] (-2632.767) * (-2632.881) (-2634.711) [-2635.055] (-2637.610) -- 0:02:07
      273500 -- (-2637.560) [-2640.221] (-2635.132) (-2636.387) * (-2633.469) (-2632.828) [-2632.839] (-2633.966) -- 0:02:10
      274000 -- (-2632.506) (-2633.618) [-2635.934] (-2635.365) * (-2634.875) [-2634.000] (-2638.558) (-2640.246) -- 0:02:09
      274500 -- (-2633.508) [-2633.814] (-2632.212) (-2634.751) * (-2640.433) (-2632.679) (-2645.383) [-2635.113] -- 0:02:09
      275000 -- (-2632.045) (-2634.705) [-2636.665] (-2633.133) * (-2635.313) (-2631.645) [-2637.748] (-2639.927) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      275500 -- (-2635.035) (-2637.983) [-2632.146] (-2633.743) * (-2632.238) (-2631.965) (-2640.716) [-2632.466] -- 0:02:08
      276000 -- (-2635.868) (-2640.285) (-2632.184) [-2636.722] * (-2635.836) [-2634.399] (-2637.482) (-2633.422) -- 0:02:08
      276500 -- (-2631.950) (-2634.160) [-2632.052] (-2639.795) * (-2634.885) [-2643.570] (-2638.770) (-2633.481) -- 0:02:08
      277000 -- (-2639.138) [-2631.146] (-2632.029) (-2629.752) * (-2638.108) [-2632.578] (-2635.080) (-2633.690) -- 0:02:07
      277500 -- [-2632.795] (-2635.777) (-2634.558) (-2639.065) * (-2644.444) [-2633.841] (-2635.919) (-2635.033) -- 0:02:07
      278000 -- (-2634.094) (-2635.070) (-2638.134) [-2633.966] * (-2640.226) [-2632.842] (-2636.548) (-2639.191) -- 0:02:07
      278500 -- [-2636.767] (-2633.636) (-2642.179) (-2642.292) * (-2639.061) (-2631.523) (-2640.989) [-2638.985] -- 0:02:06
      279000 -- (-2637.131) (-2635.203) [-2638.620] (-2633.308) * (-2632.484) (-2633.363) [-2634.362] (-2636.219) -- 0:02:09
      279500 -- (-2637.619) (-2637.489) (-2639.610) [-2636.490] * (-2629.792) (-2633.987) (-2634.740) [-2633.602] -- 0:02:08
      280000 -- [-2632.061] (-2633.856) (-2640.068) (-2639.910) * (-2633.493) [-2636.463] (-2639.099) (-2634.981) -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      280500 -- [-2636.019] (-2632.595) (-2646.450) (-2636.380) * (-2632.378) [-2632.564] (-2633.701) (-2634.909) -- 0:02:08
      281000 -- (-2635.617) [-2635.530] (-2641.853) (-2635.019) * (-2635.711) (-2635.403) (-2632.310) [-2630.790] -- 0:02:07
      281500 -- (-2636.518) (-2631.034) [-2632.012] (-2633.709) * [-2635.158] (-2638.258) (-2631.812) (-2633.204) -- 0:02:07
      282000 -- [-2632.983] (-2633.190) (-2641.633) (-2634.474) * (-2631.270) [-2634.893] (-2640.975) (-2639.746) -- 0:02:07
      282500 -- [-2636.653] (-2638.598) (-2636.199) (-2633.730) * (-2636.657) (-2632.445) [-2633.812] (-2634.056) -- 0:02:06
      283000 -- (-2644.673) (-2633.182) [-2638.347] (-2633.762) * (-2637.981) (-2641.896) [-2635.726] (-2634.936) -- 0:02:06
      283500 -- [-2632.637] (-2637.035) (-2639.993) (-2636.121) * (-2636.142) [-2633.149] (-2632.430) (-2636.828) -- 0:02:06
      284000 -- [-2633.767] (-2634.079) (-2643.158) (-2644.001) * (-2639.574) (-2635.970) [-2637.385] (-2639.379) -- 0:02:06
      284500 -- (-2635.094) [-2635.558] (-2637.219) (-2635.224) * (-2631.757) (-2638.153) (-2634.151) [-2632.044] -- 0:02:08
      285000 -- (-2633.671) (-2632.640) (-2643.348) [-2634.408] * [-2634.382] (-2638.634) (-2634.120) (-2634.723) -- 0:02:07

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-2633.673) [-2634.227] (-2636.584) (-2635.315) * (-2639.966) (-2638.394) [-2634.426] (-2635.797) -- 0:02:07
      286000 -- (-2633.271) (-2633.594) [-2633.996] (-2636.851) * (-2637.550) [-2633.374] (-2635.181) (-2638.659) -- 0:02:07
      286500 -- [-2635.432] (-2638.647) (-2641.923) (-2639.446) * (-2633.880) (-2634.188) (-2638.456) [-2638.124] -- 0:02:07
      287000 -- (-2628.471) [-2635.611] (-2641.325) (-2640.359) * (-2631.102) [-2631.565] (-2634.370) (-2640.582) -- 0:02:06
      287500 -- (-2635.531) (-2638.827) [-2639.419] (-2641.232) * (-2634.861) (-2633.041) [-2636.286] (-2637.966) -- 0:02:06
      288000 -- (-2631.890) [-2635.200] (-2630.683) (-2636.804) * (-2631.215) (-2632.901) [-2639.244] (-2635.718) -- 0:02:06
      288500 -- [-2632.455] (-2638.298) (-2636.553) (-2636.982) * (-2635.565) (-2635.425) [-2634.447] (-2634.709) -- 0:02:05
      289000 -- (-2635.129) (-2636.039) [-2636.748] (-2639.789) * [-2635.152] (-2633.516) (-2634.971) (-2633.901) -- 0:02:05
      289500 -- (-2635.077) (-2637.236) [-2642.126] (-2644.237) * (-2637.795) (-2631.732) [-2633.095] (-2636.837) -- 0:02:05
      290000 -- (-2634.572) (-2631.637) (-2642.680) [-2638.392] * [-2642.495] (-2634.243) (-2641.351) (-2638.814) -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-2632.161) (-2632.616) [-2639.478] (-2631.857) * (-2637.044) (-2634.386) [-2640.102] (-2635.331) -- 0:02:07
      291000 -- (-2638.169) [-2634.172] (-2634.855) (-2638.742) * (-2637.176) [-2631.710] (-2641.710) (-2638.791) -- 0:02:06
      291500 -- (-2635.322) (-2633.733) [-2633.287] (-2636.081) * [-2632.377] (-2635.951) (-2642.070) (-2636.355) -- 0:02:06
      292000 -- (-2635.071) [-2634.516] (-2636.126) (-2635.052) * [-2632.022] (-2636.838) (-2638.958) (-2633.594) -- 0:02:06
      292500 -- [-2633.447] (-2638.950) (-2633.367) (-2635.189) * (-2634.415) (-2633.977) [-2636.239] (-2632.378) -- 0:02:05
      293000 -- (-2632.323) (-2634.041) (-2638.004) [-2632.361] * [-2634.189] (-2630.504) (-2637.166) (-2635.862) -- 0:02:05
      293500 -- (-2635.775) (-2635.620) [-2636.020] (-2634.313) * [-2633.065] (-2636.216) (-2642.372) (-2637.135) -- 0:02:05
      294000 -- (-2637.086) (-2637.725) (-2634.018) [-2637.884] * (-2637.044) [-2636.671] (-2636.628) (-2642.135) -- 0:02:04
      294500 -- [-2633.054] (-2637.117) (-2632.635) (-2638.610) * (-2633.718) (-2632.685) [-2638.977] (-2640.605) -- 0:02:04
      295000 -- (-2635.619) [-2635.742] (-2635.561) (-2641.807) * (-2631.751) [-2635.002] (-2638.355) (-2637.102) -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-2644.197) (-2635.880) (-2636.068) [-2633.187] * [-2633.834] (-2633.503) (-2637.382) (-2634.567) -- 0:02:03
      296000 -- (-2635.958) (-2637.724) (-2637.767) [-2634.160] * (-2637.170) (-2632.469) (-2639.643) [-2634.125] -- 0:02:06
      296500 -- (-2635.178) [-2634.398] (-2635.322) (-2635.840) * (-2636.361) (-2634.983) [-2635.385] (-2633.201) -- 0:02:05
      297000 -- (-2636.085) (-2637.332) [-2633.153] (-2640.005) * (-2643.854) [-2631.933] (-2634.852) (-2634.942) -- 0:02:05
      297500 -- (-2637.535) (-2637.006) (-2634.101) [-2638.487] * [-2633.116] (-2635.447) (-2638.654) (-2632.702) -- 0:02:05
      298000 -- (-2631.185) (-2635.460) (-2632.725) [-2636.720] * (-2640.511) (-2636.544) [-2631.476] (-2636.544) -- 0:02:04
      298500 -- (-2631.030) (-2632.500) [-2639.758] (-2638.816) * (-2640.732) [-2639.952] (-2631.167) (-2637.848) -- 0:02:04
      299000 -- (-2641.179) (-2637.365) [-2639.362] (-2637.673) * (-2636.130) [-2634.894] (-2632.384) (-2632.690) -- 0:02:04
      299500 -- (-2633.415) (-2633.546) (-2637.615) [-2645.237] * (-2633.328) (-2637.442) (-2632.748) [-2631.285] -- 0:02:03
      300000 -- (-2636.267) (-2634.448) (-2637.200) [-2639.317] * (-2639.146) [-2635.126] (-2640.165) (-2637.097) -- 0:02:03

      Average standard deviation of split frequencies: 0.000000

      300500 -- [-2629.741] (-2631.437) (-2639.548) (-2637.244) * (-2636.753) [-2629.626] (-2638.123) (-2635.199) -- 0:02:03
      301000 -- [-2631.502] (-2634.399) (-2635.302) (-2635.019) * (-2636.600) (-2633.655) (-2641.987) [-2634.518] -- 0:02:03
      301500 -- (-2631.865) (-2640.719) (-2632.305) [-2636.618] * [-2633.569] (-2641.264) (-2647.882) (-2636.590) -- 0:02:05
      302000 -- (-2639.838) [-2637.865] (-2635.232) (-2637.578) * (-2641.413) [-2634.991] (-2641.864) (-2633.631) -- 0:02:04
      302500 -- [-2638.933] (-2641.426) (-2635.064) (-2636.500) * (-2634.375) [-2638.681] (-2643.232) (-2631.279) -- 0:02:04
      303000 -- (-2640.572) [-2639.809] (-2636.404) (-2636.002) * [-2637.075] (-2637.710) (-2637.467) (-2632.308) -- 0:02:04
      303500 -- (-2639.800) [-2634.848] (-2633.135) (-2643.961) * (-2641.433) [-2634.381] (-2638.202) (-2639.667) -- 0:02:03
      304000 -- (-2635.087) [-2641.003] (-2633.755) (-2636.904) * (-2632.399) (-2641.384) [-2635.500] (-2632.770) -- 0:02:03
      304500 -- (-2631.362) [-2635.706] (-2640.711) (-2645.114) * (-2636.905) (-2640.289) (-2636.083) [-2635.642] -- 0:02:03
      305000 -- (-2637.368) [-2635.810] (-2642.096) (-2638.258) * (-2636.893) (-2644.154) (-2634.109) [-2633.381] -- 0:02:03

      Average standard deviation of split frequencies: 0.000000

      305500 -- [-2639.348] (-2634.454) (-2634.002) (-2631.849) * (-2634.683) (-2635.061) [-2635.925] (-2646.083) -- 0:02:02
      306000 -- [-2635.783] (-2633.597) (-2637.578) (-2632.664) * (-2630.830) [-2633.016] (-2637.356) (-2634.544) -- 0:02:02
      306500 -- (-2633.075) (-2634.916) [-2636.606] (-2635.925) * (-2632.945) [-2638.164] (-2638.279) (-2636.067) -- 0:02:02
      307000 -- [-2638.750] (-2639.123) (-2640.416) (-2635.340) * (-2633.257) (-2636.136) (-2638.073) [-2634.907] -- 0:02:04
      307500 -- (-2639.705) (-2634.930) [-2637.083] (-2639.771) * (-2636.035) [-2629.275] (-2641.037) (-2633.346) -- 0:02:03
      308000 -- (-2636.468) [-2639.064] (-2637.937) (-2633.705) * [-2634.516] (-2634.253) (-2646.349) (-2632.642) -- 0:02:03
      308500 -- (-2635.845) [-2638.790] (-2634.450) (-2637.990) * [-2632.104] (-2635.851) (-2634.021) (-2640.066) -- 0:02:03
      309000 -- (-2638.712) (-2637.093) (-2638.074) [-2637.989] * (-2633.237) (-2633.349) [-2634.527] (-2632.270) -- 0:02:02
      309500 -- [-2631.936] (-2638.384) (-2640.935) (-2638.891) * [-2636.991] (-2634.648) (-2638.543) (-2633.662) -- 0:02:02
      310000 -- [-2638.243] (-2635.915) (-2633.462) (-2642.209) * (-2633.716) (-2636.438) (-2633.511) [-2636.781] -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      310500 -- [-2634.414] (-2637.723) (-2639.721) (-2635.961) * (-2640.534) (-2637.169) [-2634.712] (-2638.182) -- 0:02:02
      311000 -- (-2636.025) (-2640.443) (-2646.230) [-2632.909] * [-2632.028] (-2636.585) (-2638.880) (-2636.190) -- 0:02:01
      311500 -- [-2637.170] (-2641.785) (-2638.482) (-2634.549) * (-2633.876) (-2639.148) [-2635.892] (-2635.250) -- 0:02:01
      312000 -- (-2642.167) [-2630.533] (-2638.492) (-2642.309) * (-2632.838) [-2640.522] (-2632.004) (-2635.214) -- 0:02:01
      312500 -- (-2634.780) (-2638.474) [-2635.201] (-2632.523) * (-2635.578) (-2639.148) (-2637.496) [-2635.767] -- 0:02:01
      313000 -- (-2634.775) (-2635.796) (-2641.653) [-2636.146] * (-2634.584) (-2636.852) [-2635.947] (-2632.545) -- 0:02:02
      313500 -- (-2632.858) (-2632.624) (-2645.718) [-2631.073] * (-2636.701) (-2638.554) (-2633.003) [-2632.414] -- 0:02:02
      314000 -- (-2642.008) [-2634.819] (-2646.734) (-2636.003) * (-2633.634) (-2638.007) (-2636.124) [-2633.015] -- 0:02:02
      314500 -- [-2632.645] (-2636.604) (-2645.224) (-2640.450) * [-2638.026] (-2631.658) (-2634.628) (-2633.952) -- 0:02:02
      315000 -- (-2634.740) [-2636.910] (-2633.516) (-2638.266) * (-2635.457) (-2629.522) (-2632.061) [-2634.473] -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-2633.905) (-2637.444) (-2632.185) [-2635.243] * [-2638.132] (-2635.889) (-2638.984) (-2639.014) -- 0:02:01
      316000 -- (-2634.250) [-2639.697] (-2635.462) (-2635.096) * [-2638.771] (-2634.999) (-2634.357) (-2634.741) -- 0:02:01
      316500 -- (-2637.230) (-2636.036) (-2635.765) [-2633.943] * (-2635.454) (-2631.871) (-2639.476) [-2635.378] -- 0:02:00
      317000 -- (-2637.955) [-2639.216] (-2633.199) (-2636.779) * (-2637.737) [-2635.122] (-2644.790) (-2639.344) -- 0:02:00
      317500 -- [-2643.929] (-2637.154) (-2638.013) (-2634.925) * (-2636.389) [-2634.763] (-2632.182) (-2638.964) -- 0:02:00
      318000 -- (-2635.106) (-2634.846) (-2641.493) [-2637.270] * [-2639.458] (-2636.798) (-2631.680) (-2633.320) -- 0:02:00
      318500 -- (-2636.782) [-2637.883] (-2642.380) (-2635.225) * (-2641.350) (-2642.451) [-2637.600] (-2643.397) -- 0:02:01
      319000 -- (-2631.765) (-2642.391) [-2634.532] (-2637.446) * (-2640.560) [-2637.198] (-2634.879) (-2638.390) -- 0:02:01
      319500 -- (-2639.072) (-2648.469) (-2631.825) [-2633.051] * (-2638.092) [-2637.611] (-2637.126) (-2631.255) -- 0:02:01
      320000 -- [-2631.552] (-2637.336) (-2629.588) (-2638.736) * [-2636.562] (-2640.630) (-2635.237) (-2633.716) -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-2632.980) (-2640.063) (-2634.139) [-2633.142] * (-2637.345) (-2632.842) (-2637.099) [-2638.051] -- 0:02:00
      321000 -- (-2633.531) (-2650.163) (-2632.647) [-2632.439] * (-2639.834) (-2634.641) (-2635.312) [-2636.333] -- 0:02:00
      321500 -- [-2634.645] (-2633.500) (-2645.852) (-2636.284) * [-2641.700] (-2640.534) (-2632.914) (-2634.690) -- 0:02:00
      322000 -- [-2634.710] (-2634.700) (-2635.922) (-2637.025) * (-2638.323) (-2637.111) [-2631.675] (-2632.806) -- 0:02:00
      322500 -- (-2634.989) (-2633.686) [-2635.702] (-2638.136) * (-2637.556) (-2634.980) (-2633.808) [-2634.686] -- 0:01:59
      323000 -- (-2636.466) (-2632.138) [-2638.431] (-2642.358) * [-2635.068] (-2640.497) (-2639.060) (-2633.474) -- 0:01:59
      323500 -- (-2631.600) [-2632.159] (-2636.180) (-2638.193) * [-2636.133] (-2637.305) (-2636.600) (-2639.535) -- 0:01:59
      324000 -- (-2637.079) (-2633.181) [-2633.228] (-2641.766) * (-2642.060) (-2637.345) [-2632.776] (-2637.244) -- 0:02:01
      324500 -- (-2634.606) (-2639.539) [-2632.411] (-2645.599) * (-2638.570) (-2632.253) [-2631.959] (-2638.997) -- 0:02:00
      325000 -- [-2635.026] (-2632.862) (-2638.744) (-2643.046) * [-2630.580] (-2642.233) (-2634.420) (-2639.532) -- 0:02:00

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-2635.747) [-2631.656] (-2631.350) (-2637.875) * [-2633.222] (-2633.239) (-2634.731) (-2637.718) -- 0:02:00
      326000 -- [-2632.054] (-2637.887) (-2637.648) (-2638.192) * (-2637.489) [-2632.178] (-2631.788) (-2636.556) -- 0:01:59
      326500 -- [-2631.900] (-2635.333) (-2638.821) (-2640.078) * (-2631.781) (-2633.754) [-2635.217] (-2635.410) -- 0:01:59
      327000 -- [-2635.986] (-2633.091) (-2637.283) (-2639.364) * [-2632.135] (-2633.975) (-2641.452) (-2636.135) -- 0:01:59
      327500 -- (-2642.603) [-2632.323] (-2635.576) (-2640.152) * [-2633.670] (-2638.667) (-2632.866) (-2639.030) -- 0:01:59
      328000 -- (-2642.712) (-2635.028) (-2642.233) [-2638.332] * [-2634.851] (-2634.588) (-2640.498) (-2632.860) -- 0:01:58
      328500 -- [-2639.615] (-2637.206) (-2640.283) (-2637.308) * [-2635.944] (-2632.825) (-2633.235) (-2631.973) -- 0:01:58
      329000 -- (-2645.261) [-2635.675] (-2635.193) (-2641.315) * (-2631.258) (-2633.825) [-2635.099] (-2635.968) -- 0:01:58
      329500 -- (-2641.040) [-2634.103] (-2633.894) (-2634.363) * [-2634.399] (-2631.521) (-2634.234) (-2636.004) -- 0:02:00
      330000 -- (-2634.963) (-2639.026) (-2635.231) [-2632.292] * (-2638.045) [-2629.736] (-2640.331) (-2633.896) -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-2637.624) (-2633.310) (-2633.747) [-2638.370] * (-2636.433) (-2640.036) [-2638.680] (-2638.505) -- 0:01:59
      331000 -- (-2634.538) (-2636.220) (-2642.987) [-2634.541] * (-2636.541) (-2643.721) (-2643.270) [-2634.481] -- 0:01:59
      331500 -- [-2638.355] (-2637.522) (-2637.566) (-2633.259) * [-2632.901] (-2638.765) (-2635.253) (-2638.091) -- 0:01:58
      332000 -- (-2642.204) [-2633.171] (-2640.606) (-2638.576) * (-2638.346) [-2636.146] (-2638.839) (-2634.267) -- 0:01:58
      332500 -- (-2635.677) (-2633.356) (-2634.455) [-2631.912] * (-2633.375) (-2633.326) (-2636.787) [-2631.821] -- 0:01:58
      333000 -- (-2633.836) [-2644.150] (-2631.990) (-2635.047) * (-2641.393) (-2645.975) (-2639.722) [-2636.784] -- 0:01:58
      333500 -- (-2634.051) [-2637.181] (-2640.492) (-2635.622) * [-2630.833] (-2631.703) (-2638.659) (-2638.260) -- 0:01:57
      334000 -- [-2634.922] (-2643.208) (-2633.617) (-2637.698) * (-2636.103) [-2631.775] (-2637.881) (-2640.014) -- 0:01:57
      334500 -- (-2638.048) (-2641.547) (-2640.532) [-2632.378] * [-2637.412] (-2640.581) (-2632.569) (-2639.008) -- 0:01:57
      335000 -- [-2636.251] (-2639.238) (-2635.257) (-2634.808) * [-2637.898] (-2635.855) (-2634.558) (-2638.717) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-2640.265) (-2637.812) (-2638.614) [-2637.799] * (-2631.475) (-2635.223) [-2638.862] (-2635.654) -- 0:01:58
      336000 -- (-2635.692) [-2633.199] (-2634.598) (-2639.264) * [-2638.315] (-2640.127) (-2638.232) (-2635.784) -- 0:01:58
      336500 -- (-2636.940) (-2633.549) (-2632.572) [-2636.588] * [-2632.505] (-2637.047) (-2635.110) (-2640.310) -- 0:01:58
      337000 -- (-2636.542) (-2635.162) [-2632.663] (-2641.328) * [-2638.079] (-2634.566) (-2636.816) (-2638.598) -- 0:01:58
      337500 -- (-2637.481) (-2632.034) [-2633.180] (-2632.932) * (-2637.504) (-2633.783) (-2638.769) [-2636.617] -- 0:01:57
      338000 -- (-2633.612) (-2633.402) [-2642.612] (-2634.343) * (-2636.031) (-2633.944) [-2632.729] (-2631.360) -- 0:01:57
      338500 -- (-2640.298) [-2638.062] (-2638.343) (-2644.340) * (-2637.088) (-2632.762) [-2636.636] (-2634.987) -- 0:01:57
      339000 -- (-2637.603) (-2637.261) (-2636.113) [-2635.135] * (-2637.305) (-2633.856) (-2633.514) [-2633.967] -- 0:01:56
      339500 -- [-2634.207] (-2635.982) (-2636.560) (-2634.995) * (-2635.819) (-2635.290) (-2637.335) [-2638.662] -- 0:01:56
      340000 -- [-2640.808] (-2644.744) (-2635.239) (-2644.211) * [-2634.303] (-2637.589) (-2645.149) (-2641.441) -- 0:01:56

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-2631.853] (-2636.088) (-2636.931) (-2640.524) * (-2637.369) (-2637.239) [-2636.713] (-2634.817) -- 0:01:56
      341000 -- (-2633.580) (-2633.677) (-2633.754) [-2633.179] * (-2638.719) [-2633.251] (-2639.374) (-2638.048) -- 0:01:57
      341500 -- [-2641.156] (-2631.925) (-2633.993) (-2642.475) * (-2636.846) [-2632.735] (-2640.533) (-2639.003) -- 0:01:57
      342000 -- (-2643.366) (-2637.162) [-2631.936] (-2644.381) * (-2634.505) [-2632.367] (-2644.313) (-2632.031) -- 0:01:57
      342500 -- (-2633.835) (-2636.119) (-2630.789) [-2636.928] * (-2635.726) (-2638.699) (-2644.090) [-2635.895] -- 0:01:57
      343000 -- (-2633.898) (-2639.182) [-2636.324] (-2638.446) * [-2639.419] (-2633.709) (-2640.293) (-2630.950) -- 0:01:56
      343500 -- [-2635.320] (-2639.629) (-2635.616) (-2641.197) * (-2635.632) [-2636.231] (-2640.550) (-2635.589) -- 0:01:56
      344000 -- (-2633.623) [-2638.743] (-2634.677) (-2637.907) * [-2631.830] (-2635.888) (-2640.141) (-2639.375) -- 0:01:56
      344500 -- [-2637.143] (-2639.433) (-2646.172) (-2633.271) * [-2632.736] (-2636.856) (-2637.418) (-2644.088) -- 0:01:56
      345000 -- [-2634.809] (-2642.128) (-2636.586) (-2633.109) * (-2638.402) [-2636.090] (-2643.839) (-2633.398) -- 0:01:55

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-2636.303) [-2634.720] (-2635.695) (-2633.061) * (-2636.245) (-2636.099) [-2645.919] (-2633.745) -- 0:01:55
      346000 -- (-2635.500) (-2637.946) [-2636.413] (-2637.285) * (-2635.463) [-2633.807] (-2643.681) (-2636.476) -- 0:01:55
      346500 -- (-2633.892) [-2633.557] (-2633.343) (-2639.204) * (-2631.291) (-2635.558) [-2633.653] (-2640.230) -- 0:01:56
      347000 -- (-2636.748) (-2640.078) (-2638.611) [-2633.171] * (-2639.934) (-2629.629) [-2633.882] (-2636.150) -- 0:01:56
      347500 -- [-2633.723] (-2637.644) (-2631.907) (-2635.845) * (-2630.565) [-2641.839] (-2630.702) (-2635.133) -- 0:01:56
      348000 -- (-2630.477) (-2635.277) [-2635.424] (-2634.501) * (-2634.870) (-2639.610) (-2641.409) [-2634.805] -- 0:01:56
      348500 -- (-2636.733) [-2635.180] (-2638.240) (-2635.328) * (-2635.532) (-2634.864) (-2635.825) [-2637.292] -- 0:01:55
      349000 -- (-2639.480) (-2635.709) (-2639.354) [-2637.237] * (-2636.194) (-2634.023) [-2637.368] (-2637.921) -- 0:01:55
      349500 -- (-2637.090) (-2633.344) [-2635.915] (-2637.720) * (-2635.848) (-2638.701) [-2631.640] (-2634.533) -- 0:01:55
      350000 -- (-2643.766) (-2639.047) [-2638.189] (-2640.148) * (-2634.371) [-2634.699] (-2634.708) (-2638.185) -- 0:01:55

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-2639.881) (-2635.379) (-2637.556) [-2640.902] * (-2639.414) [-2635.957] (-2633.936) (-2643.826) -- 0:01:54
      351000 -- (-2643.581) (-2636.963) [-2636.921] (-2633.700) * [-2634.591] (-2636.334) (-2643.622) (-2636.929) -- 0:01:54
      351500 -- (-2641.991) (-2642.964) [-2631.878] (-2637.078) * (-2638.200) [-2634.955] (-2643.773) (-2633.505) -- 0:01:54
      352000 -- (-2636.174) (-2640.612) [-2639.170] (-2640.581) * [-2630.945] (-2639.709) (-2634.376) (-2639.749) -- 0:01:55
      352500 -- (-2631.491) [-2636.865] (-2636.487) (-2637.277) * (-2634.542) (-2633.170) [-2638.848] (-2636.874) -- 0:01:55
      353000 -- (-2636.228) (-2651.706) [-2636.396] (-2638.937) * (-2631.867) (-2629.791) (-2639.423) [-2633.206] -- 0:01:55
      353500 -- (-2641.145) (-2637.636) [-2633.570] (-2638.030) * (-2630.256) [-2637.682] (-2636.617) (-2637.905) -- 0:01:55
      354000 -- (-2638.277) (-2636.350) (-2638.142) [-2633.883] * [-2636.628] (-2638.204) (-2633.052) (-2632.540) -- 0:01:54
      354500 -- (-2638.547) (-2640.038) [-2641.189] (-2636.081) * (-2636.039) [-2639.374] (-2636.424) (-2637.608) -- 0:01:54
      355000 -- (-2635.036) (-2637.494) (-2637.040) [-2633.785] * (-2638.492) [-2634.323] (-2637.554) (-2639.470) -- 0:01:54

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-2644.589) [-2636.704] (-2635.173) (-2635.656) * (-2638.379) (-2639.584) [-2636.199] (-2635.835) -- 0:01:54
      356000 -- (-2634.198) [-2632.223] (-2632.186) (-2633.080) * [-2639.155] (-2635.501) (-2636.118) (-2634.347) -- 0:01:53
      356500 -- [-2641.476] (-2639.524) (-2645.361) (-2635.525) * [-2632.984] (-2636.517) (-2640.379) (-2633.427) -- 0:01:53
      357000 -- (-2644.134) [-2638.323] (-2636.115) (-2635.451) * (-2637.238) (-2637.278) [-2638.571] (-2641.285) -- 0:01:53
      357500 -- (-2637.932) [-2633.056] (-2631.699) (-2630.858) * (-2635.134) (-2631.940) (-2643.092) [-2636.749] -- 0:01:55
      358000 -- [-2636.162] (-2632.624) (-2640.042) (-2630.187) * (-2634.509) (-2639.248) [-2634.627] (-2630.567) -- 0:01:54
      358500 -- (-2645.470) [-2638.679] (-2634.338) (-2630.111) * [-2633.698] (-2642.452) (-2639.698) (-2637.062) -- 0:01:54
      359000 -- [-2638.103] (-2640.810) (-2642.320) (-2634.394) * (-2631.615) (-2635.050) [-2630.816] (-2634.420) -- 0:01:54
      359500 -- [-2638.517] (-2633.708) (-2640.796) (-2648.630) * (-2633.916) (-2635.870) (-2634.558) [-2634.025] -- 0:01:54
      360000 -- (-2641.579) [-2635.590] (-2635.583) (-2639.034) * (-2645.473) [-2639.544] (-2637.669) (-2637.436) -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-2638.424) (-2633.345) (-2636.295) [-2639.774] * (-2639.784) (-2639.688) (-2636.134) [-2632.548] -- 0:01:53
      361000 -- (-2640.535) (-2640.844) (-2632.802) [-2636.851] * (-2631.108) (-2637.616) [-2634.560] (-2637.110) -- 0:01:53
      361500 -- (-2638.795) [-2633.283] (-2635.306) (-2633.487) * (-2634.090) (-2631.106) (-2634.351) [-2639.209] -- 0:01:53
      362000 -- [-2637.889] (-2639.610) (-2634.037) (-2636.500) * (-2634.569) (-2634.460) (-2631.780) [-2635.497] -- 0:01:52
      362500 -- [-2635.144] (-2632.746) (-2640.719) (-2632.610) * [-2634.450] (-2634.502) (-2635.352) (-2631.727) -- 0:01:52
      363000 -- (-2635.185) (-2633.942) (-2638.270) [-2639.104] * (-2634.003) (-2635.262) (-2633.835) [-2636.348] -- 0:01:52
      363500 -- (-2644.057) (-2638.319) (-2639.520) [-2636.273] * (-2636.203) [-2634.946] (-2635.096) (-2633.292) -- 0:01:53
      364000 -- [-2637.068] (-2638.051) (-2637.188) (-2634.911) * (-2629.945) [-2632.539] (-2642.943) (-2633.403) -- 0:01:53
      364500 -- (-2637.944) (-2636.404) [-2630.957] (-2634.669) * (-2632.802) (-2637.992) (-2640.564) [-2638.828] -- 0:01:53
      365000 -- (-2635.306) (-2640.976) [-2633.322] (-2632.833) * (-2636.860) (-2640.431) [-2639.079] (-2635.811) -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      365500 -- [-2630.012] (-2636.120) (-2634.990) (-2638.515) * (-2632.508) (-2641.176) (-2634.525) [-2633.448] -- 0:01:52
      366000 -- (-2630.440) (-2632.901) (-2638.120) [-2639.599] * (-2636.640) [-2635.658] (-2634.639) (-2638.828) -- 0:01:52
      366500 -- (-2632.214) (-2635.244) [-2634.559] (-2631.712) * (-2634.784) [-2639.678] (-2634.725) (-2643.928) -- 0:01:52
      367000 -- (-2634.251) (-2639.083) (-2638.678) [-2634.464] * [-2636.775] (-2637.155) (-2637.699) (-2631.262) -- 0:01:52
      367500 -- [-2635.728] (-2643.610) (-2636.866) (-2638.942) * [-2633.071] (-2643.768) (-2635.610) (-2630.732) -- 0:01:51
      368000 -- (-2641.865) (-2632.555) [-2636.070] (-2638.662) * (-2634.004) (-2635.259) (-2637.123) [-2636.966] -- 0:01:51
      368500 -- (-2636.205) (-2634.872) [-2637.947] (-2645.915) * (-2633.743) (-2637.537) [-2634.449] (-2636.347) -- 0:01:51
      369000 -- (-2638.217) (-2634.577) [-2631.485] (-2636.882) * (-2637.919) (-2635.670) (-2631.444) [-2636.145] -- 0:01:52
      369500 -- (-2634.959) (-2635.664) (-2636.098) [-2631.805] * (-2633.361) (-2636.277) [-2635.721] (-2633.576) -- 0:01:52
      370000 -- (-2633.989) [-2636.984] (-2637.445) (-2633.939) * [-2638.823] (-2638.300) (-2632.731) (-2635.218) -- 0:01:52

      Average standard deviation of split frequencies: 0.000000

      370500 -- [-2633.995] (-2629.495) (-2634.649) (-2637.383) * (-2635.749) [-2630.716] (-2632.959) (-2633.330) -- 0:01:52
      371000 -- [-2637.108] (-2638.897) (-2636.069) (-2634.440) * (-2646.462) (-2635.953) (-2640.431) [-2634.482] -- 0:01:51
      371500 -- (-2636.728) [-2637.727] (-2636.346) (-2642.072) * [-2635.123] (-2641.011) (-2634.365) (-2639.818) -- 0:01:51
      372000 -- [-2636.996] (-2639.150) (-2633.804) (-2640.204) * (-2636.268) [-2633.778] (-2641.288) (-2640.567) -- 0:01:51
      372500 -- (-2634.286) (-2637.768) [-2636.367] (-2636.719) * [-2639.437] (-2635.908) (-2638.826) (-2641.751) -- 0:01:51
      373000 -- (-2638.971) (-2634.958) (-2640.286) [-2634.786] * (-2635.230) (-2636.188) [-2632.780] (-2632.347) -- 0:01:50
      373500 -- [-2633.027] (-2638.418) (-2638.363) (-2635.654) * (-2636.397) (-2633.435) [-2639.839] (-2639.041) -- 0:01:50
      374000 -- (-2633.370) (-2634.036) [-2635.596] (-2632.882) * (-2639.866) (-2639.360) (-2637.528) [-2642.942] -- 0:01:50
      374500 -- [-2634.820] (-2640.021) (-2635.992) (-2653.841) * (-2638.493) (-2639.926) [-2634.595] (-2636.669) -- 0:01:51
      375000 -- [-2634.323] (-2633.991) (-2637.764) (-2632.946) * (-2638.839) (-2634.728) [-2636.159] (-2632.459) -- 0:01:51

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-2630.973) (-2635.613) [-2633.302] (-2637.971) * [-2632.931] (-2634.500) (-2636.930) (-2642.012) -- 0:01:51
      376000 -- (-2640.586) (-2635.120) [-2636.546] (-2640.784) * (-2639.616) [-2637.768] (-2632.086) (-2640.922) -- 0:01:51
      376500 -- (-2639.796) (-2635.291) (-2636.527) [-2635.146] * [-2636.056] (-2636.426) (-2635.882) (-2634.007) -- 0:01:50
      377000 -- (-2643.543) (-2640.443) [-2632.732] (-2632.030) * (-2638.448) (-2640.317) [-2634.504] (-2645.502) -- 0:01:50
      377500 -- (-2636.401) [-2639.774] (-2636.492) (-2635.290) * (-2636.660) (-2635.579) (-2634.676) [-2633.833] -- 0:01:50
      378000 -- (-2637.643) (-2645.445) (-2637.228) [-2637.994] * (-2639.091) [-2636.315] (-2635.016) (-2635.830) -- 0:01:50
      378500 -- (-2635.761) [-2639.354] (-2640.706) (-2640.432) * (-2634.000) (-2631.085) [-2634.005] (-2643.998) -- 0:01:50
      379000 -- (-2636.290) [-2631.293] (-2638.540) (-2642.644) * (-2642.904) (-2639.169) [-2634.660] (-2634.764) -- 0:01:49
      379500 -- [-2637.943] (-2640.665) (-2633.471) (-2638.509) * (-2634.120) [-2635.272] (-2637.706) (-2636.458) -- 0:01:49
      380000 -- (-2643.292) [-2634.813] (-2639.946) (-2636.148) * [-2639.805] (-2636.612) (-2640.662) (-2640.070) -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      380500 -- [-2633.906] (-2639.309) (-2637.521) (-2639.747) * (-2635.950) (-2635.719) [-2632.365] (-2640.838) -- 0:01:50
      381000 -- (-2633.747) (-2642.300) [-2634.946] (-2638.793) * (-2640.203) (-2635.284) (-2635.405) [-2636.991] -- 0:01:50
      381500 -- (-2637.529) (-2632.900) [-2638.333] (-2634.574) * [-2632.169] (-2635.740) (-2632.159) (-2633.643) -- 0:01:50
      382000 -- (-2632.130) (-2633.475) [-2637.266] (-2634.789) * (-2633.351) [-2642.141] (-2639.328) (-2632.711) -- 0:01:50
      382500 -- [-2633.950] (-2636.471) (-2644.132) (-2635.436) * (-2629.543) (-2634.825) [-2641.591] (-2631.793) -- 0:01:49
      383000 -- (-2633.508) (-2636.841) (-2644.768) [-2632.291] * [-2633.599] (-2638.509) (-2637.355) (-2639.996) -- 0:01:49
      383500 -- [-2634.682] (-2637.119) (-2636.273) (-2634.497) * [-2640.033] (-2639.375) (-2634.840) (-2630.017) -- 0:01:49
      384000 -- (-2636.063) [-2634.313] (-2637.783) (-2644.736) * (-2639.662) (-2641.679) (-2636.754) [-2638.105] -- 0:01:49
      384500 -- (-2635.094) [-2636.842] (-2645.972) (-2640.130) * (-2634.050) (-2641.164) [-2635.785] (-2635.296) -- 0:01:48
      385000 -- [-2640.316] (-2635.073) (-2634.691) (-2637.200) * (-2636.005) (-2632.868) (-2639.151) [-2636.855] -- 0:01:48

      Average standard deviation of split frequencies: 0.000000

      385500 -- (-2641.525) (-2638.389) [-2634.031] (-2645.182) * (-2633.161) [-2637.941] (-2640.809) (-2640.912) -- 0:01:48
      386000 -- (-2637.620) (-2634.437) [-2634.128] (-2635.960) * [-2639.055] (-2633.712) (-2635.271) (-2633.346) -- 0:01:49
      386500 -- (-2639.779) [-2631.952] (-2632.670) (-2632.338) * (-2645.048) (-2631.322) (-2641.064) [-2633.556] -- 0:01:49
      387000 -- [-2631.238] (-2632.154) (-2638.623) (-2634.919) * (-2638.035) [-2632.939] (-2637.146) (-2639.468) -- 0:01:49
      387500 -- (-2635.093) (-2632.953) (-2634.085) [-2633.723] * [-2630.383] (-2632.726) (-2634.177) (-2635.890) -- 0:01:49
      388000 -- (-2636.806) (-2634.984) (-2632.346) [-2632.436] * (-2630.781) [-2634.482] (-2638.062) (-2642.307) -- 0:01:48
      388500 -- (-2634.727) (-2650.176) [-2636.451] (-2635.917) * [-2632.683] (-2631.722) (-2638.620) (-2645.222) -- 0:01:48
      389000 -- (-2634.830) [-2634.512] (-2635.354) (-2643.289) * [-2633.504] (-2641.462) (-2638.615) (-2638.129) -- 0:01:48
      389500 -- (-2643.072) (-2636.591) (-2639.703) [-2632.759] * [-2633.473] (-2632.290) (-2633.499) (-2641.290) -- 0:01:48
      390000 -- (-2638.788) (-2637.091) [-2635.690] (-2636.130) * [-2634.714] (-2634.981) (-2634.986) (-2636.114) -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      390500 -- [-2640.257] (-2642.238) (-2635.660) (-2645.176) * [-2636.771] (-2638.386) (-2632.964) (-2633.708) -- 0:01:47
      391000 -- (-2638.168) (-2642.305) [-2640.695] (-2639.064) * (-2632.917) (-2634.998) (-2642.057) [-2633.929] -- 0:01:47
      391500 -- (-2636.976) (-2642.993) (-2635.603) [-2633.818] * (-2636.346) [-2635.228] (-2646.093) (-2632.987) -- 0:01:48
      392000 -- (-2635.954) (-2634.558) (-2639.126) [-2634.013] * (-2638.029) [-2635.594] (-2642.233) (-2631.801) -- 0:01:48
      392500 -- (-2641.492) (-2635.304) (-2635.764) [-2638.357] * [-2636.111] (-2632.892) (-2635.281) (-2634.190) -- 0:01:48
      393000 -- (-2633.003) (-2634.573) (-2638.219) [-2636.147] * (-2640.229) (-2631.300) [-2637.439] (-2638.699) -- 0:01:48
      393500 -- (-2638.849) (-2634.051) (-2641.089) [-2635.956] * (-2637.226) (-2637.465) [-2637.592] (-2638.208) -- 0:01:47
      394000 -- (-2636.999) (-2633.467) (-2637.840) [-2635.697] * (-2635.792) [-2632.019] (-2636.322) (-2632.706) -- 0:01:47
      394500 -- (-2633.425) (-2634.703) [-2632.390] (-2636.630) * (-2633.417) (-2637.382) [-2634.991] (-2638.311) -- 0:01:47
      395000 -- (-2637.560) [-2634.806] (-2635.612) (-2634.843) * (-2641.893) (-2638.028) [-2638.063] (-2637.438) -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-2632.112) (-2634.696) (-2639.654) [-2634.673] * (-2641.317) (-2634.546) (-2636.560) [-2636.631] -- 0:01:46
      396000 -- (-2636.466) [-2634.068] (-2630.410) (-2633.800) * [-2636.750] (-2634.514) (-2631.325) (-2636.716) -- 0:01:46
      396500 -- (-2630.220) [-2637.021] (-2635.550) (-2634.903) * [-2632.580] (-2630.826) (-2641.938) (-2637.221) -- 0:01:46
      397000 -- [-2639.838] (-2634.650) (-2630.652) (-2635.766) * (-2636.910) [-2635.244] (-2641.485) (-2635.734) -- 0:01:47
      397500 -- (-2634.631) [-2634.571] (-2636.118) (-2634.677) * (-2640.205) [-2637.476] (-2640.864) (-2631.151) -- 0:01:47
      398000 -- (-2631.974) (-2636.386) [-2632.989] (-2642.402) * [-2638.362] (-2631.383) (-2635.145) (-2638.266) -- 0:01:47
      398500 -- (-2637.364) [-2637.572] (-2635.889) (-2633.326) * [-2633.400] (-2632.005) (-2638.780) (-2640.534) -- 0:01:47
      399000 -- (-2644.206) [-2637.219] (-2637.651) (-2633.341) * (-2635.567) (-2633.088) (-2636.441) [-2646.821] -- 0:01:46
      399500 -- (-2633.885) (-2644.988) (-2632.865) [-2634.060] * (-2638.883) [-2637.275] (-2631.966) (-2641.696) -- 0:01:46
      400000 -- (-2637.795) (-2634.026) [-2632.873] (-2635.854) * (-2635.216) [-2637.253] (-2639.618) (-2635.430) -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      400500 -- [-2635.906] (-2638.467) (-2633.449) (-2639.264) * (-2641.307) (-2638.953) (-2635.163) [-2632.391] -- 0:01:46
      401000 -- [-2634.535] (-2635.611) (-2635.104) (-2636.234) * (-2645.523) [-2638.701] (-2635.171) (-2640.302) -- 0:01:46
      401500 -- (-2634.705) [-2633.189] (-2641.927) (-2630.317) * [-2632.830] (-2634.745) (-2636.334) (-2641.218) -- 0:01:45
      402000 -- (-2638.785) [-2635.499] (-2637.493) (-2632.042) * (-2639.033) [-2633.227] (-2632.083) (-2647.901) -- 0:01:45
      402500 -- (-2638.465) (-2644.608) (-2632.088) [-2632.691] * [-2639.019] (-2634.243) (-2634.017) (-2644.117) -- 0:01:46
      403000 -- (-2643.412) (-2634.888) (-2635.981) [-2633.362] * (-2633.071) [-2634.086] (-2640.736) (-2640.276) -- 0:01:46
      403500 -- (-2638.206) (-2634.827) [-2632.068] (-2633.073) * (-2634.909) [-2636.193] (-2636.889) (-2639.527) -- 0:01:46
      404000 -- (-2636.477) [-2632.357] (-2633.195) (-2634.607) * [-2630.889] (-2631.752) (-2632.804) (-2638.573) -- 0:01:46
      404500 -- (-2638.331) (-2632.049) (-2640.460) [-2636.322] * [-2630.691] (-2631.973) (-2637.683) (-2638.814) -- 0:01:45
      405000 -- (-2637.934) [-2637.472] (-2640.269) (-2632.467) * (-2640.789) [-2634.068] (-2636.495) (-2646.004) -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-2636.988) [-2635.527] (-2635.833) (-2638.862) * [-2636.494] (-2639.357) (-2634.455) (-2636.479) -- 0:01:45
      406000 -- (-2632.408) [-2631.972] (-2645.941) (-2635.690) * [-2637.569] (-2639.096) (-2637.616) (-2634.544) -- 0:01:45
      406500 -- (-2639.709) [-2635.817] (-2633.946) (-2635.759) * (-2635.694) (-2654.466) (-2632.485) [-2636.666] -- 0:01:45
      407000 -- (-2637.393) [-2636.131] (-2633.933) (-2642.919) * (-2638.004) [-2642.278] (-2641.005) (-2636.767) -- 0:01:44
      407500 -- (-2642.826) (-2642.879) [-2634.864] (-2636.897) * [-2634.998] (-2641.028) (-2640.380) (-2635.628) -- 0:01:44
      408000 -- (-2638.338) [-2635.622] (-2634.397) (-2634.428) * [-2634.628] (-2637.349) (-2636.132) (-2642.332) -- 0:01:44
      408500 -- [-2636.163] (-2638.357) (-2636.492) (-2633.979) * (-2638.501) [-2637.948] (-2641.330) (-2633.354) -- 0:01:45
      409000 -- (-2631.614) (-2642.692) (-2635.086) [-2631.646] * (-2633.171) (-2634.069) (-2642.360) [-2636.199] -- 0:01:45
      409500 -- (-2636.573) (-2642.719) (-2633.191) [-2631.385] * (-2639.248) (-2636.238) [-2632.048] (-2638.234) -- 0:01:45
      410000 -- [-2639.072] (-2643.999) (-2636.892) (-2633.517) * (-2632.569) [-2633.317] (-2634.807) (-2640.745) -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-2637.111) (-2633.981) [-2635.073] (-2632.853) * (-2631.289) (-2635.462) [-2634.600] (-2637.793) -- 0:01:44
      411000 -- (-2638.524) [-2634.254] (-2637.235) (-2635.454) * (-2632.155) [-2638.571] (-2632.828) (-2643.113) -- 0:01:44
      411500 -- (-2633.001) [-2634.061] (-2630.202) (-2634.566) * (-2635.864) (-2635.581) (-2633.134) [-2634.077] -- 0:01:44
      412000 -- [-2634.109] (-2634.399) (-2634.029) (-2639.325) * [-2632.522] (-2639.803) (-2635.133) (-2638.650) -- 0:01:44
      412500 -- (-2634.704) (-2634.803) [-2632.564] (-2642.199) * (-2636.136) [-2633.496] (-2638.259) (-2633.582) -- 0:01:43
      413000 -- (-2643.110) [-2630.478] (-2634.316) (-2638.164) * (-2632.118) [-2633.713] (-2635.921) (-2633.478) -- 0:01:43
      413500 -- (-2638.524) [-2634.376] (-2639.160) (-2637.209) * (-2635.120) (-2637.826) [-2633.370] (-2643.180) -- 0:01:43
      414000 -- (-2631.884) (-2633.877) [-2634.747] (-2639.770) * (-2635.347) (-2640.414) (-2638.170) [-2636.569] -- 0:01:44
      414500 -- (-2634.884) (-2636.725) (-2634.500) [-2632.502] * (-2641.728) [-2636.515] (-2635.420) (-2633.190) -- 0:01:44
      415000 -- (-2637.067) (-2634.078) [-2630.497] (-2630.091) * (-2639.627) (-2637.637) (-2638.312) [-2633.053] -- 0:01:44

      Average standard deviation of split frequencies: 0.000000

      415500 -- [-2635.115] (-2639.530) (-2638.119) (-2633.348) * (-2632.667) [-2631.181] (-2640.883) (-2638.944) -- 0:01:44
      416000 -- (-2637.392) (-2634.672) [-2634.162] (-2630.588) * (-2637.730) (-2631.050) (-2631.898) [-2638.273] -- 0:01:43
      416500 -- (-2634.664) (-2640.768) [-2634.210] (-2636.089) * (-2634.984) [-2631.369] (-2638.752) (-2630.288) -- 0:01:43
      417000 -- (-2638.096) (-2647.035) [-2639.148] (-2638.561) * [-2631.897] (-2638.723) (-2636.477) (-2640.049) -- 0:01:43
      417500 -- (-2634.063) (-2638.829) (-2643.224) [-2637.974] * (-2636.740) [-2632.197] (-2639.716) (-2633.405) -- 0:01:43
      418000 -- [-2631.911] (-2635.716) (-2634.884) (-2634.750) * (-2637.062) (-2632.502) (-2635.233) [-2635.696] -- 0:01:43
      418500 -- (-2637.849) (-2635.468) (-2641.249) [-2636.149] * (-2636.481) [-2633.061] (-2635.674) (-2640.027) -- 0:01:42
      419000 -- (-2632.068) (-2636.309) [-2637.952] (-2638.624) * (-2631.024) [-2632.648] (-2636.981) (-2633.709) -- 0:01:42
      419500 -- (-2639.372) (-2639.966) [-2633.456] (-2638.769) * [-2634.375] (-2631.609) (-2634.591) (-2635.630) -- 0:01:43
      420000 -- (-2637.805) (-2642.637) (-2639.154) [-2634.857] * [-2640.492] (-2634.680) (-2636.666) (-2642.402) -- 0:01:43

      Average standard deviation of split frequencies: 0.000000

      420500 -- [-2636.559] (-2637.818) (-2638.488) (-2639.216) * (-2636.315) (-2638.397) (-2641.759) [-2647.703] -- 0:01:43
      421000 -- (-2637.091) [-2631.771] (-2639.794) (-2633.542) * (-2632.981) [-2638.077] (-2634.085) (-2637.330) -- 0:01:43
      421500 -- [-2632.474] (-2638.203) (-2633.240) (-2643.290) * (-2632.879) (-2637.360) (-2631.144) [-2632.594] -- 0:01:42
      422000 -- (-2634.470) (-2630.933) [-2639.045] (-2633.473) * (-2633.496) [-2638.474] (-2633.832) (-2636.433) -- 0:01:42
      422500 -- (-2636.210) [-2633.062] (-2636.298) (-2633.339) * (-2630.707) (-2644.680) (-2632.625) [-2640.665] -- 0:01:42
      423000 -- (-2636.543) (-2632.392) (-2646.495) [-2637.695] * (-2634.826) [-2636.445] (-2637.979) (-2636.284) -- 0:01:42
      423500 -- (-2632.846) (-2633.238) (-2637.139) [-2635.428] * (-2634.144) (-2634.034) [-2638.273] (-2636.718) -- 0:01:42
      424000 -- (-2639.628) [-2631.938] (-2639.245) (-2641.825) * (-2632.904) (-2638.029) (-2631.741) [-2632.269] -- 0:01:41
      424500 -- [-2636.820] (-2632.054) (-2634.052) (-2638.656) * (-2637.367) (-2636.138) (-2634.051) [-2635.628] -- 0:01:41
      425000 -- (-2637.708) [-2635.111] (-2632.680) (-2644.736) * (-2643.430) [-2632.330] (-2635.138) (-2638.689) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      425500 -- [-2635.673] (-2636.571) (-2638.273) (-2637.508) * (-2638.318) [-2634.488] (-2633.603) (-2634.815) -- 0:01:42
      426000 -- (-2635.657) (-2637.999) (-2635.287) [-2633.975] * (-2640.441) (-2636.925) [-2632.759] (-2642.876) -- 0:01:42
      426500 -- (-2634.107) (-2635.540) [-2634.170] (-2640.406) * [-2637.677] (-2632.643) (-2641.183) (-2643.241) -- 0:01:42
      427000 -- [-2632.712] (-2642.922) (-2639.168) (-2634.910) * [-2634.003] (-2632.074) (-2634.623) (-2640.241) -- 0:01:41
      427500 -- (-2637.595) (-2636.865) [-2631.753] (-2634.400) * (-2639.930) (-2633.891) [-2630.878] (-2636.827) -- 0:01:41
      428000 -- (-2632.939) (-2634.016) [-2634.683] (-2641.964) * (-2638.122) (-2638.198) [-2634.127] (-2638.448) -- 0:01:41
      428500 -- (-2637.189) [-2634.435] (-2635.385) (-2636.179) * [-2631.789] (-2638.783) (-2632.990) (-2638.429) -- 0:01:41
      429000 -- (-2634.135) [-2637.863] (-2637.427) (-2639.344) * (-2637.694) (-2637.749) (-2636.879) [-2630.814] -- 0:01:41
      429500 -- (-2634.239) [-2632.372] (-2636.050) (-2635.307) * (-2635.927) (-2637.201) (-2634.781) [-2633.652] -- 0:01:40
      430000 -- (-2635.375) (-2634.386) (-2631.771) [-2633.060] * [-2636.121] (-2637.232) (-2640.669) (-2636.944) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      430500 -- [-2634.012] (-2636.726) (-2637.762) (-2632.653) * [-2632.949] (-2639.207) (-2635.241) (-2636.851) -- 0:01:40
      431000 -- (-2634.467) [-2635.978] (-2633.952) (-2637.775) * [-2632.806] (-2636.519) (-2636.132) (-2640.542) -- 0:01:41
      431500 -- (-2634.869) [-2635.103] (-2638.983) (-2634.514) * (-2635.600) (-2638.475) [-2632.612] (-2636.000) -- 0:01:41
      432000 -- (-2638.825) [-2632.699] (-2635.656) (-2630.764) * [-2636.325] (-2637.495) (-2639.046) (-2640.864) -- 0:01:41
      432500 -- (-2637.810) (-2637.753) [-2639.077] (-2637.889) * (-2637.443) (-2634.113) [-2643.208] (-2642.919) -- 0:01:41
      433000 -- (-2635.662) (-2634.844) (-2635.371) [-2635.427] * (-2635.318) [-2639.061] (-2633.684) (-2639.720) -- 0:01:40
      433500 -- (-2638.065) (-2631.560) (-2630.887) [-2634.346] * (-2634.511) (-2640.977) (-2633.635) [-2636.170] -- 0:01:40
      434000 -- (-2635.541) (-2637.792) (-2635.426) [-2633.888] * (-2634.409) (-2640.563) (-2635.003) [-2633.667] -- 0:01:40
      434500 -- (-2646.420) (-2638.728) (-2632.472) [-2630.764] * (-2642.276) [-2643.264] (-2635.514) (-2634.072) -- 0:01:40
      435000 -- (-2631.217) (-2632.297) (-2633.478) [-2633.473] * (-2639.813) (-2639.105) (-2640.915) [-2635.617] -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-2640.170) [-2629.914] (-2631.535) (-2643.296) * [-2638.652] (-2653.014) (-2639.233) (-2634.284) -- 0:01:39
      436000 -- [-2634.556] (-2629.636) (-2646.959) (-2634.289) * (-2641.082) [-2636.244] (-2638.397) (-2641.085) -- 0:01:39
      436500 -- (-2636.964) [-2634.543] (-2639.287) (-2640.667) * (-2637.095) (-2642.092) [-2636.515] (-2634.669) -- 0:01:40
      437000 -- (-2633.834) [-2635.209] (-2637.081) (-2638.298) * [-2631.159] (-2652.649) (-2639.104) (-2634.473) -- 0:01:40
      437500 -- (-2634.797) (-2630.682) [-2639.008] (-2632.326) * (-2635.531) (-2647.650) [-2635.061] (-2643.331) -- 0:01:40
      438000 -- (-2632.389) [-2635.891] (-2633.696) (-2636.227) * (-2632.500) (-2639.006) (-2634.308) [-2633.422] -- 0:01:40
      438500 -- [-2632.334] (-2634.130) (-2647.014) (-2642.800) * (-2636.833) (-2635.995) [-2634.225] (-2632.764) -- 0:01:39
      439000 -- [-2629.381] (-2638.033) (-2638.993) (-2636.356) * (-2641.804) (-2635.342) (-2636.568) [-2633.786] -- 0:01:39
      439500 -- (-2634.756) (-2641.990) (-2636.658) [-2641.513] * (-2633.426) (-2643.967) (-2633.089) [-2634.559] -- 0:01:39
      440000 -- (-2632.563) [-2635.415] (-2634.779) (-2638.899) * (-2632.109) (-2637.431) (-2634.207) [-2632.524] -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      440500 -- [-2633.149] (-2639.612) (-2635.954) (-2641.116) * (-2634.615) (-2638.236) [-2638.229] (-2636.868) -- 0:01:39
      441000 -- (-2639.448) [-2634.180] (-2633.463) (-2639.198) * (-2639.745) [-2635.580] (-2635.728) (-2642.164) -- 0:01:38
      441500 -- (-2636.781) (-2636.111) [-2634.682] (-2638.372) * (-2634.081) (-2635.687) [-2640.275] (-2636.745) -- 0:01:38
      442000 -- (-2634.540) (-2640.134) [-2636.145] (-2639.495) * [-2633.213] (-2635.559) (-2638.120) (-2638.660) -- 0:01:39
      442500 -- (-2639.393) (-2637.467) [-2631.342] (-2638.491) * (-2642.432) (-2635.172) [-2633.399] (-2636.694) -- 0:01:39
      443000 -- [-2634.722] (-2637.603) (-2636.873) (-2642.183) * (-2636.632) [-2634.443] (-2636.547) (-2634.700) -- 0:01:39
      443500 -- (-2636.212) [-2633.069] (-2634.981) (-2637.282) * (-2645.405) [-2633.031] (-2642.430) (-2648.016) -- 0:01:39
      444000 -- (-2639.426) (-2631.839) [-2637.315] (-2639.079) * (-2641.404) (-2632.661) [-2631.967] (-2641.362) -- 0:01:38
      444500 -- (-2638.327) (-2636.247) [-2636.311] (-2632.958) * (-2637.338) (-2640.214) [-2637.211] (-2635.151) -- 0:01:38
      445000 -- (-2633.457) (-2640.137) [-2636.189] (-2638.268) * (-2639.318) (-2634.972) (-2638.737) [-2634.536] -- 0:01:38

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-2637.944) [-2637.326] (-2642.019) (-2639.705) * (-2640.488) [-2640.274] (-2635.056) (-2636.440) -- 0:01:38
      446000 -- (-2631.273) (-2639.523) (-2637.064) [-2636.678] * (-2639.974) (-2634.138) (-2633.052) [-2634.313] -- 0:01:38
      446500 -- [-2637.174] (-2640.184) (-2631.738) (-2637.891) * (-2641.297) [-2638.395] (-2633.021) (-2634.012) -- 0:01:37
      447000 -- (-2648.713) (-2636.547) [-2636.597] (-2637.886) * (-2637.440) (-2644.856) [-2635.914] (-2636.196) -- 0:01:37
      447500 -- (-2635.410) (-2633.285) [-2635.001] (-2640.341) * (-2639.721) (-2633.728) [-2634.407] (-2632.269) -- 0:01:37
      448000 -- (-2642.088) [-2634.487] (-2636.529) (-2631.748) * [-2637.806] (-2633.076) (-2645.996) (-2637.037) -- 0:01:38
      448500 -- [-2637.263] (-2642.292) (-2635.452) (-2634.706) * (-2637.189) [-2639.053] (-2640.038) (-2645.364) -- 0:01:38
      449000 -- (-2638.629) [-2631.053] (-2640.201) (-2640.388) * [-2634.516] (-2637.568) (-2643.969) (-2636.964) -- 0:01:38
      449500 -- (-2637.549) (-2632.043) [-2636.377] (-2638.907) * (-2639.240) (-2632.715) (-2640.355) [-2636.069] -- 0:01:37
      450000 -- [-2640.077] (-2634.486) (-2641.872) (-2637.357) * (-2636.003) (-2637.043) (-2641.225) [-2636.106] -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-2634.079) (-2634.794) (-2641.695) [-2634.686] * [-2635.046] (-2629.304) (-2636.599) (-2637.162) -- 0:01:37
      451000 -- (-2635.915) (-2638.043) (-2641.993) [-2629.750] * (-2635.624) (-2637.749) [-2637.049] (-2632.967) -- 0:01:37
      451500 -- [-2636.015] (-2637.204) (-2634.898) (-2640.529) * [-2637.925] (-2633.344) (-2637.421) (-2635.205) -- 0:01:37
      452000 -- [-2642.959] (-2637.337) (-2639.248) (-2636.472) * (-2641.042) [-2637.791] (-2633.611) (-2635.919) -- 0:01:36
      452500 -- [-2631.085] (-2634.838) (-2633.106) (-2633.419) * (-2636.496) (-2641.018) [-2633.782] (-2641.630) -- 0:01:36
      453000 -- (-2640.471) (-2636.307) (-2637.534) [-2634.917] * (-2631.961) (-2636.590) (-2635.910) [-2632.512] -- 0:01:36
      453500 -- (-2635.437) (-2635.498) (-2639.066) [-2642.514] * (-2633.180) (-2636.120) [-2632.159] (-2632.886) -- 0:01:37
      454000 -- (-2635.155) [-2642.744] (-2633.994) (-2635.334) * (-2635.312) (-2637.899) (-2636.244) [-2635.657] -- 0:01:37
      454500 -- [-2635.058] (-2636.626) (-2638.777) (-2638.696) * [-2636.092] (-2637.962) (-2638.129) (-2632.759) -- 0:01:37
      455000 -- (-2634.469) (-2638.354) (-2636.590) [-2633.908] * [-2634.846] (-2646.168) (-2637.911) (-2638.469) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      455500 -- [-2636.697] (-2631.102) (-2637.274) (-2634.948) * [-2633.668] (-2642.425) (-2637.488) (-2636.121) -- 0:01:36
      456000 -- [-2649.020] (-2633.368) (-2638.645) (-2640.540) * (-2636.858) (-2638.597) [-2636.447] (-2636.891) -- 0:01:36
      456500 -- (-2635.126) (-2634.241) [-2637.210] (-2634.324) * (-2633.116) (-2639.569) (-2637.010) [-2635.809] -- 0:01:36
      457000 -- [-2636.775] (-2634.355) (-2638.874) (-2637.352) * [-2632.690] (-2641.472) (-2631.550) (-2631.307) -- 0:01:36
      457500 -- (-2639.555) (-2636.667) (-2631.838) [-2631.145] * [-2636.381] (-2635.195) (-2641.339) (-2634.918) -- 0:01:36
      458000 -- (-2634.896) (-2640.091) (-2633.494) [-2634.535] * (-2634.509) [-2643.930] (-2641.348) (-2641.999) -- 0:01:35
      458500 -- [-2634.280] (-2633.269) (-2636.683) (-2645.155) * (-2638.277) (-2642.269) (-2631.725) [-2633.979] -- 0:01:35
      459000 -- (-2631.523) [-2638.010] (-2636.037) (-2634.578) * (-2638.050) [-2633.507] (-2643.229) (-2638.132) -- 0:01:36
      459500 -- (-2635.659) [-2634.777] (-2637.469) (-2639.522) * (-2632.799) [-2634.601] (-2640.587) (-2633.626) -- 0:01:36
      460000 -- (-2644.753) (-2647.674) (-2633.157) [-2638.332] * (-2637.152) (-2633.928) (-2636.483) [-2632.049] -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      460500 -- (-2639.446) [-2638.134] (-2630.904) (-2634.634) * [-2638.890] (-2633.517) (-2633.114) (-2636.341) -- 0:01:36
      461000 -- [-2640.127] (-2632.469) (-2634.955) (-2638.138) * (-2635.809) (-2638.714) (-2638.935) [-2635.262] -- 0:01:35
      461500 -- (-2635.234) [-2633.051] (-2634.037) (-2638.348) * (-2633.638) (-2636.072) [-2636.119] (-2641.663) -- 0:01:35
      462000 -- (-2635.925) [-2633.229] (-2634.219) (-2632.100) * (-2645.576) [-2634.362] (-2635.229) (-2635.746) -- 0:01:35
      462500 -- [-2638.464] (-2632.344) (-2638.794) (-2635.917) * (-2638.965) [-2638.339] (-2635.997) (-2642.275) -- 0:01:35
      463000 -- [-2632.969] (-2630.646) (-2640.676) (-2629.032) * (-2634.823) (-2635.220) [-2634.544] (-2633.048) -- 0:01:35
      463500 -- (-2633.869) [-2630.424] (-2639.014) (-2638.520) * [-2639.213] (-2632.651) (-2631.533) (-2644.442) -- 0:01:34
      464000 -- (-2641.269) [-2635.390] (-2643.483) (-2638.199) * (-2635.955) (-2633.796) (-2630.498) [-2637.007] -- 0:01:34
      464500 -- (-2633.984) (-2635.539) (-2634.324) [-2637.433] * [-2632.514] (-2633.765) (-2639.782) (-2636.528) -- 0:01:35
      465000 -- (-2631.364) (-2631.628) (-2634.663) [-2639.534] * (-2638.107) (-2636.417) [-2637.910] (-2633.975) -- 0:01:35

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-2635.582) (-2640.520) (-2635.949) [-2634.500] * (-2636.506) [-2631.231] (-2638.333) (-2637.633) -- 0:01:35
      466000 -- (-2637.219) (-2636.243) (-2637.200) [-2638.309] * (-2638.824) (-2632.948) [-2632.289] (-2636.247) -- 0:01:35
      466500 -- (-2636.395) [-2631.843] (-2636.703) (-2639.730) * (-2635.739) [-2631.953] (-2637.781) (-2633.858) -- 0:01:34
      467000 -- (-2636.144) (-2633.503) (-2637.081) [-2635.654] * (-2633.219) [-2633.512] (-2637.188) (-2638.739) -- 0:01:34
      467500 -- (-2636.436) (-2636.809) (-2637.318) [-2636.552] * (-2635.110) [-2632.591] (-2637.419) (-2635.133) -- 0:01:34
      468000 -- [-2643.752] (-2639.385) (-2639.603) (-2636.147) * (-2638.594) (-2640.064) [-2634.328] (-2636.301) -- 0:01:34
      468500 -- (-2646.084) [-2636.389] (-2640.325) (-2635.157) * (-2635.755) [-2633.546] (-2640.595) (-2636.049) -- 0:01:34
      469000 -- (-2638.944) [-2637.845] (-2640.083) (-2633.297) * (-2632.505) (-2634.266) (-2636.729) [-2636.759] -- 0:01:33
      469500 -- (-2637.960) (-2636.181) (-2637.401) [-2635.078] * (-2638.270) (-2633.974) [-2634.434] (-2635.000) -- 0:01:33
      470000 -- (-2633.132) (-2640.235) (-2633.421) [-2636.276] * (-2634.544) (-2637.119) (-2635.406) [-2632.941] -- 0:01:34

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-2637.759) [-2636.509] (-2633.434) (-2638.970) * (-2635.165) (-2637.190) [-2633.401] (-2639.244) -- 0:01:34
      471000 -- (-2634.508) [-2635.956] (-2632.745) (-2637.146) * [-2635.721] (-2632.239) (-2636.579) (-2632.010) -- 0:01:34
      471500 -- (-2634.221) (-2634.444) [-2630.334] (-2633.832) * (-2639.707) [-2644.283] (-2638.663) (-2643.247) -- 0:01:34
      472000 -- [-2637.456] (-2635.169) (-2634.043) (-2636.443) * [-2642.914] (-2636.656) (-2632.039) (-2636.278) -- 0:01:33
      472500 -- [-2636.135] (-2640.968) (-2633.001) (-2635.012) * (-2637.504) (-2638.088) [-2632.578] (-2636.383) -- 0:01:33
      473000 -- (-2633.321) [-2632.140] (-2635.170) (-2635.242) * [-2631.726] (-2636.428) (-2631.008) (-2639.465) -- 0:01:33
      473500 -- (-2634.405) [-2635.161] (-2633.575) (-2633.674) * (-2635.073) (-2638.811) [-2631.340] (-2632.658) -- 0:01:33
      474000 -- (-2637.630) [-2634.482] (-2637.365) (-2637.036) * (-2634.097) (-2634.052) (-2636.566) [-2634.355] -- 0:01:33
      474500 -- (-2639.476) (-2635.329) (-2633.232) [-2634.703] * (-2635.845) [-2638.036] (-2638.124) (-2641.592) -- 0:01:33
      475000 -- [-2635.258] (-2636.565) (-2635.918) (-2639.229) * (-2639.222) (-2631.823) [-2633.935] (-2635.043) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-2641.262) (-2635.883) [-2635.439] (-2637.376) * (-2632.600) (-2638.616) [-2637.732] (-2636.637) -- 0:01:33
      476000 -- (-2645.031) [-2634.872] (-2637.145) (-2637.543) * [-2635.071] (-2634.007) (-2635.852) (-2634.098) -- 0:01:33
      476500 -- (-2636.111) (-2640.834) (-2640.522) [-2641.630] * (-2638.740) (-2636.715) (-2646.831) [-2635.877] -- 0:01:33
      477000 -- (-2636.646) [-2633.296] (-2634.604) (-2642.308) * (-2635.724) (-2637.616) [-2634.757] (-2635.921) -- 0:01:33
      477500 -- (-2636.576) (-2633.628) (-2635.565) [-2639.880] * (-2643.286) (-2635.202) (-2635.384) [-2638.684] -- 0:01:33
      478000 -- [-2635.974] (-2640.531) (-2638.370) (-2637.011) * (-2633.146) (-2633.770) [-2634.358] (-2635.909) -- 0:01:32
      478500 -- [-2634.839] (-2641.388) (-2636.872) (-2633.905) * [-2633.646] (-2637.305) (-2641.922) (-2640.530) -- 0:01:32
      479000 -- [-2630.848] (-2634.621) (-2634.632) (-2633.563) * (-2630.032) (-2637.745) (-2633.914) [-2636.503] -- 0:01:32
      479500 -- (-2631.846) [-2636.147] (-2633.762) (-2638.404) * (-2639.040) (-2634.480) [-2639.725] (-2639.672) -- 0:01:32
      480000 -- (-2636.644) (-2637.910) (-2640.923) [-2632.410] * (-2635.181) (-2635.994) (-2635.816) [-2631.716] -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      480500 -- [-2636.151] (-2637.611) (-2640.228) (-2632.045) * (-2635.335) (-2634.235) (-2632.917) [-2634.734] -- 0:01:31
      481000 -- (-2639.985) (-2640.444) (-2643.388) [-2633.429] * (-2634.311) (-2632.105) (-2631.724) [-2634.571] -- 0:01:31
      481500 -- (-2649.384) [-2641.999] (-2636.201) (-2636.810) * (-2632.672) (-2635.933) [-2634.584] (-2632.057) -- 0:01:32
      482000 -- (-2635.156) (-2638.468) (-2633.660) [-2632.370] * (-2638.060) (-2634.274) [-2634.424] (-2633.951) -- 0:01:32
      482500 -- (-2637.183) (-2637.238) (-2636.708) [-2633.258] * (-2635.710) [-2639.495] (-2638.104) (-2636.106) -- 0:01:32
      483000 -- (-2641.260) (-2634.487) (-2640.579) [-2631.716] * (-2642.273) (-2634.791) [-2643.237] (-2632.803) -- 0:01:32
      483500 -- (-2635.336) (-2631.516) (-2633.128) [-2632.679] * [-2640.545] (-2631.793) (-2636.611) (-2640.298) -- 0:01:31
      484000 -- [-2635.562] (-2635.747) (-2634.865) (-2634.190) * (-2641.038) (-2637.207) [-2640.295] (-2632.928) -- 0:01:31
      484500 -- (-2636.463) [-2630.728] (-2636.226) (-2632.796) * (-2635.971) (-2631.999) [-2642.433] (-2638.735) -- 0:01:31
      485000 -- (-2637.623) [-2636.722] (-2634.928) (-2639.477) * (-2639.535) [-2631.124] (-2637.122) (-2630.745) -- 0:01:31

      Average standard deviation of split frequencies: 0.000000

      485500 -- [-2633.164] (-2634.485) (-2634.756) (-2635.113) * (-2635.874) [-2634.969] (-2640.540) (-2638.713) -- 0:01:31
      486000 -- [-2632.369] (-2633.290) (-2635.295) (-2647.777) * (-2636.670) (-2636.072) [-2634.272] (-2635.648) -- 0:01:30
      486500 -- (-2636.514) [-2637.249] (-2639.992) (-2633.926) * (-2638.806) [-2637.804] (-2637.593) (-2635.515) -- 0:01:30
      487000 -- (-2633.083) (-2637.881) [-2633.701] (-2631.914) * (-2635.005) (-2635.903) [-2634.095] (-2637.629) -- 0:01:31
      487500 -- (-2632.969) (-2639.683) (-2637.669) [-2632.162] * (-2639.590) (-2635.947) (-2644.641) [-2635.674] -- 0:01:31
      488000 -- (-2636.271) (-2639.691) (-2633.698) [-2636.597] * (-2632.794) (-2640.252) [-2638.804] (-2635.804) -- 0:01:31
      488500 -- [-2635.130] (-2639.719) (-2634.022) (-2636.668) * (-2641.150) (-2635.650) (-2638.031) [-2635.543] -- 0:01:31
      489000 -- [-2629.304] (-2639.247) (-2632.673) (-2636.787) * (-2633.599) [-2633.517] (-2637.147) (-2633.111) -- 0:01:30
      489500 -- (-2635.438) [-2636.529] (-2635.512) (-2633.919) * [-2635.262] (-2637.589) (-2636.898) (-2641.552) -- 0:01:30
      490000 -- (-2639.052) (-2635.549) (-2632.472) [-2638.173] * (-2634.151) (-2634.744) (-2635.112) [-2634.501] -- 0:01:30

      Average standard deviation of split frequencies: 0.000000

      490500 -- (-2636.034) (-2632.947) (-2635.783) [-2633.977] * (-2639.176) [-2634.332] (-2641.310) (-2633.918) -- 0:01:30
      491000 -- (-2635.418) (-2632.228) (-2634.754) [-2634.231] * [-2642.047] (-2636.118) (-2641.434) (-2638.070) -- 0:01:30
      491500 -- (-2638.064) (-2635.197) [-2642.157] (-2638.212) * [-2635.160] (-2634.859) (-2637.277) (-2639.042) -- 0:01:30
      492000 -- (-2635.885) (-2632.735) (-2636.056) [-2639.621] * [-2637.281] (-2632.165) (-2636.651) (-2637.921) -- 0:01:29
      492500 -- (-2637.015) [-2635.832] (-2635.097) (-2635.774) * (-2638.906) (-2636.036) (-2635.965) [-2637.704] -- 0:01:30
      493000 -- [-2636.763] (-2636.113) (-2636.262) (-2642.593) * [-2634.047] (-2639.244) (-2641.484) (-2631.905) -- 0:01:30
      493500 -- (-2634.914) (-2635.977) [-2635.558] (-2635.140) * [-2635.644] (-2639.272) (-2634.370) (-2634.401) -- 0:01:30
      494000 -- (-2635.321) (-2647.756) [-2637.611] (-2634.244) * (-2640.632) (-2636.882) [-2634.190] (-2633.656) -- 0:01:30
      494500 -- (-2636.274) (-2637.019) (-2635.134) [-2631.158] * (-2634.638) [-2636.529] (-2633.756) (-2633.293) -- 0:01:29
      495000 -- (-2638.429) (-2635.907) (-2637.243) [-2634.856] * (-2638.869) (-2634.219) (-2642.273) [-2636.372] -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-2635.554) (-2640.075) (-2634.106) [-2632.419] * (-2631.697) [-2635.300] (-2634.678) (-2636.328) -- 0:01:29
      496000 -- (-2632.964) (-2630.243) (-2640.629) [-2629.944] * (-2633.196) [-2634.687] (-2632.712) (-2632.096) -- 0:01:29
      496500 -- [-2637.886] (-2637.405) (-2640.013) (-2637.658) * (-2636.221) (-2640.681) (-2635.602) [-2631.556] -- 0:01:29
      497000 -- (-2639.385) (-2635.949) (-2636.450) [-2637.784] * [-2637.421] (-2638.643) (-2643.054) (-2636.396) -- 0:01:29
      497500 -- (-2633.722) (-2632.421) [-2637.647] (-2634.257) * (-2631.813) (-2642.793) (-2633.240) [-2634.525] -- 0:01:28
      498000 -- (-2635.724) (-2632.747) [-2630.886] (-2633.708) * (-2637.220) (-2637.197) (-2636.397) [-2631.479] -- 0:01:29
      498500 -- [-2631.340] (-2637.118) (-2637.035) (-2641.300) * (-2636.318) [-2633.435] (-2636.517) (-2630.459) -- 0:01:29
      499000 -- (-2635.457) (-2637.821) [-2629.717] (-2639.089) * [-2633.575] (-2633.839) (-2635.950) (-2634.710) -- 0:01:29
      499500 -- [-2638.302] (-2635.651) (-2632.969) (-2637.267) * (-2636.780) (-2635.572) [-2635.220] (-2633.956) -- 0:01:29
      500000 -- (-2636.069) (-2635.679) (-2635.321) [-2629.867] * (-2637.092) (-2636.362) [-2633.078] (-2634.550) -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      500500 -- (-2636.270) (-2636.325) (-2638.672) [-2628.976] * (-2635.503) [-2632.612] (-2639.157) (-2639.144) -- 0:01:28
      501000 -- (-2639.252) (-2634.840) (-2636.075) [-2637.029] * (-2638.768) (-2634.287) [-2630.762] (-2636.539) -- 0:01:28
      501500 -- (-2641.679) [-2633.841] (-2633.202) (-2643.535) * (-2640.595) [-2633.491] (-2633.285) (-2637.541) -- 0:01:28
      502000 -- (-2645.286) (-2639.868) (-2639.945) [-2634.356] * [-2640.081] (-2637.111) (-2637.008) (-2636.263) -- 0:01:28
      502500 -- (-2641.615) (-2635.228) (-2637.650) [-2639.071] * [-2630.956] (-2632.715) (-2635.104) (-2636.756) -- 0:01:28
      503000 -- [-2636.227] (-2640.046) (-2636.781) (-2634.940) * [-2641.920] (-2636.009) (-2636.431) (-2644.585) -- 0:01:27
      503500 -- (-2634.815) (-2641.567) [-2636.654] (-2642.288) * (-2634.764) [-2640.436] (-2632.024) (-2646.916) -- 0:01:27
      504000 -- [-2632.978] (-2642.285) (-2637.568) (-2634.026) * (-2636.836) (-2637.822) (-2641.065) [-2636.101] -- 0:01:28
      504500 -- (-2634.879) [-2634.555] (-2630.918) (-2631.181) * (-2633.247) (-2637.243) [-2634.906] (-2634.512) -- 0:01:28
      505000 -- [-2638.420] (-2633.872) (-2634.008) (-2635.095) * (-2635.579) (-2634.550) (-2635.685) [-2637.043] -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      505500 -- (-2639.096) [-2637.966] (-2642.154) (-2637.435) * [-2631.312] (-2635.308) (-2645.092) (-2636.040) -- 0:01:28
      506000 -- [-2639.226] (-2635.262) (-2636.460) (-2635.920) * (-2635.051) (-2635.167) [-2634.242] (-2636.262) -- 0:01:27
      506500 -- (-2640.461) (-2632.143) [-2636.324] (-2633.174) * (-2637.474) (-2641.150) [-2631.051] (-2634.002) -- 0:01:27
      507000 -- (-2635.448) [-2636.248] (-2636.432) (-2635.480) * (-2631.237) (-2633.535) [-2633.124] (-2632.642) -- 0:01:27
      507500 -- [-2634.816] (-2634.481) (-2635.423) (-2640.819) * (-2636.941) (-2637.688) [-2636.204] (-2636.943) -- 0:01:27
      508000 -- [-2638.564] (-2632.435) (-2640.517) (-2646.243) * (-2639.410) (-2630.624) (-2635.197) [-2632.998] -- 0:01:27
      508500 -- [-2636.299] (-2641.280) (-2636.692) (-2640.922) * [-2636.320] (-2636.823) (-2640.392) (-2639.328) -- 0:01:26
      509000 -- [-2634.499] (-2641.581) (-2635.335) (-2636.997) * [-2631.085] (-2634.192) (-2637.199) (-2639.991) -- 0:01:26
      509500 -- [-2635.616] (-2639.254) (-2634.986) (-2634.558) * (-2637.485) [-2639.851] (-2638.977) (-2642.931) -- 0:01:27
      510000 -- (-2641.678) (-2638.881) [-2633.520] (-2635.905) * (-2636.563) (-2637.851) (-2636.972) [-2635.323] -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      510500 -- (-2643.917) [-2635.340] (-2635.124) (-2634.154) * (-2637.517) (-2638.972) (-2637.361) [-2637.562] -- 0:01:27
      511000 -- (-2633.521) [-2637.287] (-2634.037) (-2636.827) * (-2632.662) [-2640.218] (-2635.765) (-2632.561) -- 0:01:27
      511500 -- (-2636.597) [-2633.869] (-2635.272) (-2637.379) * (-2635.346) [-2635.483] (-2641.438) (-2639.126) -- 0:01:26
      512000 -- (-2635.459) [-2633.435] (-2635.316) (-2638.996) * (-2634.727) (-2638.956) [-2634.147] (-2639.016) -- 0:01:26
      512500 -- [-2638.557] (-2639.252) (-2633.284) (-2636.870) * [-2632.940] (-2639.419) (-2636.014) (-2630.657) -- 0:01:26
      513000 -- [-2637.421] (-2638.976) (-2634.736) (-2638.688) * (-2634.525) (-2634.783) [-2631.962] (-2639.961) -- 0:01:26
      513500 -- (-2637.175) [-2635.710] (-2637.025) (-2636.358) * [-2631.558] (-2634.190) (-2633.804) (-2633.293) -- 0:01:26
      514000 -- (-2640.540) [-2629.989] (-2639.396) (-2640.194) * (-2631.190) [-2633.629] (-2635.870) (-2635.012) -- 0:01:26
      514500 -- [-2636.138] (-2632.545) (-2636.075) (-2639.045) * (-2637.729) (-2635.191) [-2634.931] (-2632.824) -- 0:01:25
      515000 -- [-2636.163] (-2632.598) (-2644.703) (-2632.755) * (-2645.908) (-2637.717) [-2636.409] (-2635.973) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-2631.627) [-2637.383] (-2635.881) (-2638.220) * (-2635.770) (-2636.483) [-2630.810] (-2634.903) -- 0:01:26
      516000 -- [-2632.657] (-2636.343) (-2636.014) (-2636.642) * [-2638.894] (-2633.016) (-2637.033) (-2637.845) -- 0:01:26
      516500 -- (-2634.271) (-2631.601) [-2638.632] (-2637.066) * (-2640.424) (-2633.502) [-2636.397] (-2635.771) -- 0:01:26
      517000 -- (-2633.366) (-2633.012) [-2641.439] (-2634.889) * (-2640.490) [-2633.191] (-2639.877) (-2637.875) -- 0:01:25
      517500 -- (-2636.319) [-2632.424] (-2642.386) (-2638.201) * (-2635.802) (-2636.250) [-2631.798] (-2642.992) -- 0:01:25
      518000 -- (-2637.079) [-2638.585] (-2639.673) (-2649.449) * (-2642.400) (-2637.903) [-2634.399] (-2637.542) -- 0:01:25
      518500 -- (-2633.401) (-2632.838) [-2634.743] (-2639.895) * [-2636.770] (-2633.273) (-2635.027) (-2638.237) -- 0:01:25
      519000 -- [-2638.700] (-2642.091) (-2635.525) (-2632.411) * (-2637.037) (-2633.453) [-2632.877] (-2644.936) -- 0:01:25
      519500 -- (-2635.581) [-2635.299] (-2635.066) (-2640.801) * (-2634.048) (-2636.048) [-2632.127] (-2639.540) -- 0:01:25
      520000 -- (-2640.637) (-2641.167) (-2640.596) [-2635.946] * (-2631.142) (-2635.672) (-2634.226) [-2640.673] -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      520500 -- [-2635.644] (-2636.974) (-2646.828) (-2634.540) * (-2639.679) [-2637.237] (-2633.116) (-2632.757) -- 0:01:25
      521000 -- (-2639.418) (-2635.224) (-2638.511) [-2638.661] * (-2632.306) (-2639.532) (-2634.369) [-2634.134] -- 0:01:25
      521500 -- (-2637.633) (-2634.631) (-2641.355) [-2633.746] * (-2633.602) (-2635.065) [-2637.925] (-2634.735) -- 0:01:25
      522000 -- (-2636.467) (-2639.389) [-2633.566] (-2633.893) * (-2648.762) [-2634.388] (-2635.762) (-2631.138) -- 0:01:25
      522500 -- (-2637.039) [-2633.034] (-2636.999) (-2638.379) * (-2634.257) [-2636.614] (-2634.576) (-2634.292) -- 0:01:24
      523000 -- (-2643.478) (-2638.992) [-2635.895] (-2633.251) * (-2641.317) (-2638.731) (-2635.054) [-2636.119] -- 0:01:24
      523500 -- (-2640.148) [-2634.163] (-2639.143) (-2632.719) * [-2638.657] (-2632.124) (-2634.841) (-2632.252) -- 0:01:24
      524000 -- (-2641.492) (-2633.209) [-2630.095] (-2633.996) * (-2641.180) [-2640.802] (-2636.053) (-2638.116) -- 0:01:24
      524500 -- (-2643.532) (-2640.296) [-2631.756] (-2634.047) * (-2635.487) (-2636.380) [-2637.479] (-2636.232) -- 0:01:24
      525000 -- (-2643.537) (-2644.870) (-2635.181) [-2643.087] * (-2638.185) (-2637.632) (-2640.174) [-2634.374] -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-2636.540) (-2638.711) [-2635.343] (-2639.552) * (-2633.427) (-2636.649) (-2634.528) [-2636.338] -- 0:01:24
      526000 -- [-2634.946] (-2635.507) (-2636.925) (-2640.047) * (-2636.442) [-2639.100] (-2635.080) (-2634.488) -- 0:01:24
      526500 -- (-2636.021) (-2634.480) (-2636.813) [-2633.131] * (-2638.066) [-2638.534] (-2635.287) (-2635.253) -- 0:01:24
      527000 -- (-2637.048) [-2631.710] (-2638.023) (-2635.681) * (-2636.725) (-2639.070) (-2639.480) [-2635.623] -- 0:01:24
      527500 -- (-2633.931) (-2637.247) (-2634.221) [-2636.518] * [-2634.639] (-2644.336) (-2633.101) (-2632.550) -- 0:01:24
      528000 -- (-2639.891) (-2633.471) [-2636.297] (-2640.019) * (-2636.397) [-2636.885] (-2637.219) (-2634.268) -- 0:01:24
      528500 -- [-2634.188] (-2635.187) (-2640.078) (-2636.325) * (-2645.661) (-2634.353) [-2633.483] (-2640.755) -- 0:01:23
      529000 -- (-2640.262) [-2640.000] (-2639.919) (-2633.681) * (-2640.395) [-2640.235] (-2635.683) (-2639.147) -- 0:01:23
      529500 -- [-2633.600] (-2637.989) (-2638.401) (-2640.945) * (-2639.386) (-2636.593) (-2635.796) [-2632.185] -- 0:01:23
      530000 -- [-2635.117] (-2638.557) (-2634.963) (-2638.630) * (-2636.029) (-2632.194) [-2635.255] (-2635.491) -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-2638.602) [-2638.164] (-2637.221) (-2645.365) * (-2642.479) [-2634.034] (-2632.984) (-2637.146) -- 0:01:23
      531000 -- [-2632.883] (-2640.534) (-2635.159) (-2636.751) * [-2635.803] (-2635.932) (-2637.969) (-2641.161) -- 0:01:23
      531500 -- (-2638.363) (-2638.775) (-2637.024) [-2635.533] * [-2636.171] (-2639.198) (-2638.704) (-2637.225) -- 0:01:23
      532000 -- (-2632.184) [-2638.609] (-2640.146) (-2640.895) * [-2632.985] (-2642.491) (-2641.307) (-2632.508) -- 0:01:23
      532500 -- [-2636.463] (-2641.103) (-2634.412) (-2634.789) * [-2631.286] (-2638.545) (-2635.131) (-2639.546) -- 0:01:23
      533000 -- (-2639.763) (-2640.520) [-2632.860] (-2644.789) * (-2637.061) (-2632.351) (-2648.865) [-2637.649] -- 0:01:23
      533500 -- (-2636.360) (-2634.428) [-2636.230] (-2644.523) * [-2632.979] (-2638.174) (-2637.091) (-2639.120) -- 0:01:23
      534000 -- (-2632.563) (-2633.710) [-2634.241] (-2638.398) * [-2640.976] (-2640.834) (-2641.490) (-2638.750) -- 0:01:22
      534500 -- (-2630.221) (-2635.591) (-2634.119) [-2637.729] * (-2639.260) (-2643.456) [-2634.365] (-2635.740) -- 0:01:22
      535000 -- (-2638.203) (-2639.915) (-2643.683) [-2635.450] * [-2635.248] (-2643.034) (-2638.965) (-2631.092) -- 0:01:22

      Average standard deviation of split frequencies: 0.000000

      535500 -- (-2635.648) (-2641.085) (-2632.245) [-2638.340] * [-2636.026] (-2631.727) (-2637.287) (-2634.066) -- 0:01:22
      536000 -- [-2638.138] (-2636.527) (-2634.592) (-2636.325) * [-2633.572] (-2637.267) (-2636.796) (-2639.689) -- 0:01:22
      536500 -- (-2637.417) (-2638.047) (-2636.075) [-2636.798] * (-2634.131) [-2631.326] (-2641.769) (-2635.301) -- 0:01:22
      537000 -- [-2633.379] (-2635.031) (-2638.466) (-2634.068) * (-2639.459) [-2635.546] (-2638.861) (-2637.354) -- 0:01:22
      537500 -- (-2632.880) [-2634.102] (-2632.876) (-2639.554) * (-2637.568) (-2632.473) [-2634.151] (-2636.923) -- 0:01:22
      538000 -- (-2637.124) (-2637.315) (-2639.171) [-2635.879] * (-2640.236) [-2638.724] (-2634.194) (-2635.444) -- 0:01:22
      538500 -- (-2639.508) [-2634.188] (-2637.959) (-2637.771) * (-2637.010) (-2639.883) [-2636.169] (-2639.299) -- 0:01:22
      539000 -- [-2632.887] (-2640.458) (-2635.471) (-2635.316) * [-2631.012] (-2638.944) (-2634.583) (-2636.836) -- 0:01:22
      539500 -- (-2639.126) [-2641.684] (-2639.293) (-2635.850) * (-2648.360) (-2639.610) (-2633.128) [-2633.185] -- 0:01:21
      540000 -- [-2632.311] (-2632.381) (-2641.312) (-2637.089) * (-2633.202) [-2633.916] (-2639.419) (-2638.092) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      540500 -- (-2635.493) [-2639.474] (-2639.250) (-2634.865) * (-2632.671) [-2632.949] (-2633.150) (-2637.760) -- 0:01:21
      541000 -- (-2636.611) (-2640.984) [-2632.451] (-2639.617) * (-2634.799) (-2637.039) [-2634.331] (-2642.319) -- 0:01:21
      541500 -- (-2633.464) [-2635.741] (-2634.172) (-2631.517) * (-2639.697) [-2639.519] (-2636.256) (-2642.014) -- 0:01:21
      542000 -- [-2634.063] (-2638.162) (-2636.178) (-2637.152) * [-2633.635] (-2635.249) (-2639.762) (-2631.301) -- 0:01:21
      542500 -- (-2633.917) (-2633.577) (-2634.723) [-2640.203] * (-2642.976) (-2638.397) (-2631.341) [-2639.507] -- 0:01:21
      543000 -- (-2633.242) (-2633.344) [-2637.787] (-2631.814) * (-2637.212) [-2641.306] (-2633.071) (-2629.915) -- 0:01:21
      543500 -- (-2636.486) [-2630.486] (-2633.722) (-2631.941) * [-2634.119] (-2635.336) (-2632.078) (-2636.638) -- 0:01:21
      544000 -- [-2638.033] (-2638.950) (-2638.645) (-2633.968) * (-2637.521) (-2635.909) (-2633.995) [-2635.921] -- 0:01:21
      544500 -- (-2632.525) (-2641.903) (-2646.745) [-2638.037] * (-2645.820) (-2638.058) [-2638.424] (-2636.780) -- 0:01:21
      545000 -- (-2636.452) (-2635.962) [-2634.065] (-2635.028) * (-2636.194) [-2632.454] (-2631.978) (-2647.275) -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      545500 -- [-2633.537] (-2638.621) (-2636.728) (-2634.545) * (-2637.801) (-2642.152) (-2633.120) [-2635.468] -- 0:01:20
      546000 -- (-2634.674) [-2633.224] (-2633.089) (-2638.096) * (-2632.428) (-2636.554) [-2635.161] (-2633.506) -- 0:01:20
      546500 -- (-2638.184) (-2634.722) [-2635.959] (-2632.734) * (-2633.972) (-2638.719) [-2634.213] (-2633.798) -- 0:01:20
      547000 -- [-2638.072] (-2634.819) (-2629.169) (-2634.908) * (-2637.885) (-2634.474) (-2631.589) [-2631.300] -- 0:01:20
      547500 -- [-2639.054] (-2639.113) (-2640.174) (-2634.310) * [-2632.752] (-2634.938) (-2633.281) (-2629.953) -- 0:01:20
      548000 -- (-2643.826) (-2640.479) (-2635.186) [-2636.945] * (-2632.444) [-2640.346] (-2639.125) (-2639.100) -- 0:01:20
      548500 -- (-2635.648) (-2633.330) [-2635.677] (-2641.299) * (-2633.731) [-2634.164] (-2632.635) (-2631.630) -- 0:01:20
      549000 -- [-2631.283] (-2642.137) (-2638.759) (-2635.302) * [-2635.233] (-2641.424) (-2640.711) (-2634.800) -- 0:01:20
      549500 -- (-2634.276) [-2635.947] (-2642.513) (-2633.034) * [-2639.289] (-2634.671) (-2636.563) (-2635.904) -- 0:01:20
      550000 -- (-2636.488) (-2636.730) [-2643.384] (-2640.530) * (-2631.118) (-2632.237) [-2636.968] (-2636.303) -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      550500 -- (-2636.923) [-2639.312] (-2635.405) (-2638.155) * (-2634.791) (-2636.034) [-2636.599] (-2633.671) -- 0:01:20
      551000 -- (-2629.966) (-2639.786) (-2634.449) [-2632.635] * (-2642.718) [-2637.220] (-2646.916) (-2631.503) -- 0:01:19
      551500 -- (-2636.401) (-2644.103) (-2642.993) [-2634.086] * (-2631.876) (-2635.448) (-2641.628) [-2636.201] -- 0:01:19
      552000 -- (-2640.238) [-2635.869] (-2630.308) (-2642.891) * (-2635.822) [-2634.107] (-2636.117) (-2635.907) -- 0:01:19
      552500 -- (-2638.807) [-2638.582] (-2635.013) (-2632.389) * (-2642.372) (-2635.085) (-2633.298) [-2633.650] -- 0:01:19
      553000 -- (-2631.089) [-2633.714] (-2630.131) (-2629.750) * (-2635.215) [-2633.488] (-2636.884) (-2635.776) -- 0:01:19
      553500 -- (-2631.936) (-2638.356) (-2634.971) [-2630.910] * [-2635.621] (-2636.667) (-2636.971) (-2631.569) -- 0:01:19
      554000 -- [-2630.168] (-2641.336) (-2639.306) (-2634.887) * (-2629.802) (-2630.884) [-2631.646] (-2640.081) -- 0:01:19
      554500 -- (-2630.808) (-2634.565) (-2645.814) [-2635.287] * (-2635.901) [-2635.218] (-2638.663) (-2634.531) -- 0:01:19
      555000 -- (-2630.610) (-2643.246) [-2637.338] (-2631.840) * [-2636.277] (-2638.783) (-2637.195) (-2634.314) -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      555500 -- (-2629.254) [-2632.892] (-2639.018) (-2634.395) * (-2635.563) (-2631.163) [-2632.979] (-2636.396) -- 0:01:19
      556000 -- (-2630.405) (-2637.358) [-2638.187] (-2651.966) * [-2631.933] (-2638.079) (-2632.839) (-2633.294) -- 0:01:19
      556500 -- (-2636.200) [-2635.589] (-2633.366) (-2635.154) * [-2631.369] (-2630.715) (-2637.121) (-2642.403) -- 0:01:18
      557000 -- (-2640.038) [-2632.671] (-2643.451) (-2641.899) * [-2634.058] (-2636.926) (-2636.503) (-2637.134) -- 0:01:18
      557500 -- (-2636.235) (-2634.987) [-2632.756] (-2637.201) * (-2632.305) (-2632.531) [-2639.775] (-2640.073) -- 0:01:18
      558000 -- (-2637.032) [-2632.528] (-2635.699) (-2636.737) * (-2633.827) [-2633.439] (-2632.663) (-2631.171) -- 0:01:18
      558500 -- (-2632.775) (-2638.144) (-2633.706) [-2635.221] * (-2640.415) [-2630.718] (-2641.619) (-2636.407) -- 0:01:18
      559000 -- (-2636.568) (-2635.202) [-2638.588] (-2645.493) * (-2635.787) [-2640.544] (-2633.802) (-2633.146) -- 0:01:18
      559500 -- (-2633.394) (-2633.789) [-2634.496] (-2641.194) * (-2634.983) (-2634.882) (-2640.588) [-2633.110] -- 0:01:17
      560000 -- (-2645.319) (-2637.366) (-2633.477) [-2639.802] * (-2636.558) [-2636.396] (-2637.735) (-2633.339) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      560500 -- (-2636.792) (-2634.729) [-2639.216] (-2638.149) * [-2634.037] (-2632.820) (-2641.331) (-2635.279) -- 0:01:18
      561000 -- (-2636.237) (-2643.882) [-2639.344] (-2636.980) * (-2633.228) (-2640.526) (-2637.240) [-2633.124] -- 0:01:18
      561500 -- (-2638.596) (-2634.989) [-2640.108] (-2643.438) * (-2630.229) (-2634.885) (-2641.293) [-2637.355] -- 0:01:18
      562000 -- (-2643.748) (-2635.959) [-2636.214] (-2638.410) * (-2639.218) (-2636.060) [-2635.789] (-2635.258) -- 0:01:17
      562500 -- (-2633.493) (-2638.544) (-2643.481) [-2638.254] * [-2632.397] (-2636.579) (-2637.532) (-2635.968) -- 0:01:17
      563000 -- (-2640.836) (-2638.425) [-2638.289] (-2636.604) * (-2642.616) (-2636.747) (-2639.534) [-2633.932] -- 0:01:17
      563500 -- (-2646.387) (-2635.041) [-2635.540] (-2634.309) * [-2632.436] (-2639.792) (-2638.699) (-2636.295) -- 0:01:17
      564000 -- [-2638.024] (-2635.797) (-2637.431) (-2635.761) * (-2635.227) [-2631.201] (-2634.914) (-2638.285) -- 0:01:17
      564500 -- (-2633.826) (-2641.546) [-2638.971] (-2636.150) * (-2639.308) (-2634.243) (-2637.705) [-2637.765] -- 0:01:17
      565000 -- [-2632.648] (-2636.325) (-2634.653) (-2632.107) * (-2639.506) (-2639.728) (-2646.156) [-2638.300] -- 0:01:16

      Average standard deviation of split frequencies: 0.000000

      565500 -- [-2632.163] (-2644.212) (-2640.509) (-2634.878) * (-2632.539) (-2641.273) (-2640.305) [-2639.981] -- 0:01:17
      566000 -- (-2638.909) (-2642.823) (-2642.083) [-2637.940] * (-2645.186) (-2635.184) [-2635.795] (-2639.668) -- 0:01:17
      566500 -- [-2634.576] (-2637.742) (-2643.453) (-2636.889) * (-2638.802) (-2639.305) (-2635.266) [-2640.379] -- 0:01:17
      567000 -- (-2636.181) (-2640.605) (-2641.501) [-2638.316] * (-2639.704) [-2639.044] (-2645.226) (-2641.386) -- 0:01:17
      567500 -- (-2637.410) [-2634.995] (-2636.323) (-2636.459) * [-2636.911] (-2641.228) (-2637.165) (-2636.515) -- 0:01:16
      568000 -- (-2637.513) (-2637.590) (-2644.304) [-2638.456] * [-2632.160] (-2636.724) (-2641.803) (-2639.443) -- 0:01:16
      568500 -- [-2640.442] (-2640.333) (-2640.912) (-2637.544) * [-2634.516] (-2649.408) (-2634.824) (-2633.380) -- 0:01:16
      569000 -- (-2639.607) [-2635.264] (-2639.551) (-2636.507) * [-2643.468] (-2634.316) (-2635.061) (-2633.636) -- 0:01:16
      569500 -- (-2642.135) (-2635.880) (-2628.896) [-2639.488] * (-2641.487) (-2631.160) (-2639.367) [-2639.402] -- 0:01:16
      570000 -- (-2644.392) [-2634.072] (-2633.829) (-2636.272) * (-2637.547) (-2639.094) (-2654.588) [-2638.900] -- 0:01:16

      Average standard deviation of split frequencies: 0.000000

      570500 -- (-2639.914) (-2633.540) (-2633.180) [-2638.439] * (-2633.738) [-2638.368] (-2641.674) (-2633.941) -- 0:01:16
      571000 -- (-2635.454) [-2636.674] (-2634.738) (-2634.002) * (-2629.818) (-2632.836) [-2634.334] (-2633.000) -- 0:01:16
      571500 -- (-2640.205) (-2634.296) [-2638.568] (-2634.045) * (-2639.725) [-2632.136] (-2633.622) (-2636.090) -- 0:01:16
      572000 -- (-2636.843) (-2643.621) [-2631.974] (-2633.781) * (-2636.722) (-2632.656) [-2632.224] (-2641.661) -- 0:01:16
      572500 -- (-2647.210) (-2632.535) (-2636.560) [-2632.156] * (-2635.157) (-2636.121) [-2632.708] (-2641.464) -- 0:01:16
      573000 -- (-2642.945) (-2639.498) [-2633.508] (-2641.375) * (-2638.084) (-2637.783) (-2642.986) [-2637.257] -- 0:01:16
      573500 -- (-2637.670) (-2641.908) (-2636.203) [-2633.535] * (-2634.359) [-2632.516] (-2635.227) (-2639.761) -- 0:01:15
      574000 -- [-2636.045] (-2638.103) (-2634.952) (-2642.770) * (-2641.589) (-2634.273) (-2635.303) [-2630.426] -- 0:01:15
      574500 -- (-2631.178) (-2645.742) (-2632.054) [-2640.016] * (-2633.391) [-2637.144] (-2633.336) (-2632.126) -- 0:01:15
      575000 -- [-2633.023] (-2634.536) (-2648.853) (-2637.771) * (-2649.445) [-2637.114] (-2648.591) (-2633.084) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-2631.636) [-2637.218] (-2639.493) (-2644.276) * (-2638.300) (-2640.137) (-2637.053) [-2634.451] -- 0:01:15
      576000 -- [-2633.191] (-2636.727) (-2635.427) (-2637.937) * [-2637.215] (-2635.854) (-2634.833) (-2632.315) -- 0:01:15
      576500 -- (-2637.363) (-2634.132) [-2636.656] (-2631.579) * (-2641.214) (-2634.335) (-2638.125) [-2633.684] -- 0:01:15
      577000 -- [-2632.325] (-2638.260) (-2633.272) (-2635.492) * (-2641.732) (-2631.003) (-2639.327) [-2636.157] -- 0:01:15
      577500 -- (-2635.760) [-2633.568] (-2634.469) (-2638.496) * (-2637.057) (-2640.584) [-2635.011] (-2637.961) -- 0:01:15
      578000 -- (-2634.379) (-2631.946) (-2633.241) [-2632.256] * [-2635.004] (-2637.032) (-2635.275) (-2633.151) -- 0:01:15
      578500 -- (-2647.344) (-2638.601) [-2630.958] (-2637.421) * (-2632.712) (-2632.220) (-2637.681) [-2634.861] -- 0:01:15
      579000 -- (-2637.125) (-2643.133) (-2636.080) [-2644.255] * (-2634.214) (-2644.562) [-2634.063] (-2635.182) -- 0:01:14
      579500 -- [-2635.891] (-2639.110) (-2636.964) (-2638.465) * (-2634.713) (-2646.922) (-2639.519) [-2634.519] -- 0:01:14
      580000 -- (-2632.626) (-2632.829) [-2633.111] (-2632.864) * (-2643.379) (-2640.933) (-2636.361) [-2638.024] -- 0:01:14

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-2630.538) [-2631.606] (-2635.217) (-2632.548) * (-2639.212) [-2635.819] (-2635.646) (-2633.195) -- 0:01:14
      581000 -- (-2635.135) (-2639.389) (-2637.498) [-2634.432] * (-2637.910) (-2636.080) (-2636.587) [-2633.706] -- 0:01:14
      581500 -- (-2635.714) (-2632.580) [-2633.836] (-2633.982) * [-2631.856] (-2639.224) (-2634.608) (-2637.120) -- 0:01:14
      582000 -- (-2643.269) (-2634.440) (-2639.277) [-2635.746] * [-2631.128] (-2639.860) (-2631.706) (-2637.849) -- 0:01:13
      582500 -- [-2635.495] (-2634.474) (-2632.130) (-2635.077) * (-2637.218) (-2643.115) [-2635.924] (-2632.845) -- 0:01:14
      583000 -- (-2638.453) (-2637.328) [-2633.881] (-2632.309) * (-2642.736) (-2638.411) (-2636.662) [-2634.392] -- 0:01:14
      583500 -- (-2646.026) [-2631.855] (-2637.648) (-2636.135) * (-2641.779) (-2633.734) (-2636.449) [-2634.537] -- 0:01:14
      584000 -- (-2635.701) [-2636.990] (-2640.170) (-2647.005) * (-2635.878) (-2644.654) (-2636.717) [-2637.741] -- 0:01:14
      584500 -- (-2640.686) (-2634.399) (-2635.941) [-2636.101] * (-2643.579) (-2638.760) [-2635.365] (-2634.870) -- 0:01:13
      585000 -- (-2641.163) (-2634.995) [-2633.822] (-2646.881) * [-2637.009] (-2642.392) (-2651.001) (-2635.803) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      585500 -- [-2632.694] (-2642.369) (-2629.407) (-2633.887) * [-2638.045] (-2640.834) (-2638.418) (-2636.996) -- 0:01:13
      586000 -- (-2636.138) [-2635.427] (-2634.452) (-2635.712) * (-2640.195) (-2639.676) [-2636.068] (-2637.817) -- 0:01:13
      586500 -- (-2636.852) (-2638.297) [-2638.496] (-2643.068) * [-2634.727] (-2638.551) (-2635.067) (-2631.080) -- 0:01:13
      587000 -- (-2638.636) (-2630.596) [-2641.598] (-2642.845) * (-2645.455) (-2631.974) [-2631.973] (-2636.171) -- 0:01:13
      587500 -- [-2639.572] (-2631.700) (-2638.206) (-2645.412) * (-2637.617) (-2643.365) [-2636.015] (-2642.074) -- 0:01:13
      588000 -- (-2638.631) [-2631.644] (-2634.788) (-2637.531) * (-2634.822) [-2642.012] (-2638.155) (-2632.459) -- 0:01:13
      588500 -- [-2631.618] (-2636.157) (-2643.322) (-2633.088) * [-2640.909] (-2639.303) (-2633.704) (-2633.700) -- 0:01:13
      589000 -- [-2631.964] (-2631.825) (-2638.443) (-2635.605) * (-2636.341) [-2633.779] (-2629.067) (-2641.508) -- 0:01:13
      589500 -- (-2639.612) [-2634.398] (-2634.327) (-2639.770) * (-2640.371) (-2636.594) (-2635.156) [-2633.952] -- 0:01:13
      590000 -- (-2638.527) [-2634.026] (-2635.743) (-2642.287) * (-2632.807) (-2634.861) (-2635.529) [-2636.566] -- 0:01:12

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-2634.309) (-2635.111) [-2632.869] (-2640.495) * (-2640.183) (-2636.694) [-2636.045] (-2636.937) -- 0:01:12
      591000 -- (-2636.495) (-2645.341) (-2628.408) [-2639.688] * (-2638.436) (-2640.925) (-2637.991) [-2634.113] -- 0:01:12
      591500 -- (-2634.224) [-2642.740] (-2641.750) (-2641.205) * (-2641.255) (-2636.481) (-2633.605) [-2635.234] -- 0:01:12
      592000 -- (-2631.632) [-2641.371] (-2640.173) (-2634.883) * (-2641.285) (-2635.366) [-2638.094] (-2632.765) -- 0:01:12
      592500 -- [-2636.982] (-2640.446) (-2639.172) (-2633.728) * [-2636.131] (-2637.847) (-2632.317) (-2637.023) -- 0:01:12
      593000 -- (-2632.032) [-2632.451] (-2634.489) (-2642.925) * [-2637.325] (-2639.774) (-2638.808) (-2637.488) -- 0:01:12
      593500 -- (-2639.015) (-2631.821) (-2636.760) [-2638.995] * (-2635.382) [-2631.503] (-2628.711) (-2641.622) -- 0:01:12
      594000 -- [-2641.056] (-2639.660) (-2631.820) (-2634.664) * (-2642.596) (-2640.563) [-2629.256] (-2637.278) -- 0:01:12
      594500 -- (-2639.172) (-2633.807) [-2631.471] (-2639.127) * (-2646.569) (-2635.142) [-2633.073] (-2636.997) -- 0:01:12
      595000 -- [-2632.660] (-2636.417) (-2637.124) (-2633.930) * (-2639.914) (-2642.582) (-2632.675) [-2639.968] -- 0:01:12

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-2641.815) [-2639.908] (-2633.782) (-2634.501) * [-2640.780] (-2636.970) (-2635.744) (-2639.931) -- 0:01:12
      596000 -- (-2632.970) [-2635.109] (-2642.099) (-2645.571) * (-2636.382) [-2638.013] (-2636.434) (-2643.084) -- 0:01:11
      596500 -- (-2644.400) (-2639.226) (-2638.126) [-2640.112] * (-2629.871) [-2633.838] (-2634.705) (-2636.425) -- 0:01:11
      597000 -- (-2639.968) [-2630.679] (-2633.957) (-2635.481) * (-2630.910) [-2635.892] (-2638.293) (-2642.278) -- 0:01:11
      597500 -- [-2632.334] (-2635.706) (-2637.301) (-2634.388) * (-2634.480) [-2637.307] (-2633.620) (-2642.341) -- 0:01:11
      598000 -- (-2636.484) [-2634.727] (-2633.230) (-2642.024) * [-2630.485] (-2636.751) (-2633.468) (-2633.649) -- 0:01:11
      598500 -- (-2639.965) [-2636.530] (-2636.827) (-2632.795) * [-2633.173] (-2639.325) (-2637.005) (-2636.874) -- 0:01:11
      599000 -- (-2636.495) (-2632.751) (-2638.350) [-2638.527] * [-2632.554] (-2638.880) (-2636.371) (-2634.140) -- 0:01:10
      599500 -- (-2628.602) [-2633.610] (-2633.626) (-2640.548) * (-2636.323) (-2643.994) (-2637.744) [-2633.811] -- 0:01:11
      600000 -- [-2636.117] (-2640.705) (-2631.623) (-2638.648) * [-2635.019] (-2637.411) (-2634.528) (-2635.206) -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      600500 -- (-2638.695) (-2630.152) (-2633.483) [-2635.481] * (-2637.518) [-2636.243] (-2642.132) (-2646.933) -- 0:01:11
      601000 -- (-2632.406) (-2633.637) [-2634.517] (-2642.279) * (-2637.055) (-2643.869) [-2636.194] (-2640.793) -- 0:01:11
      601500 -- (-2632.125) (-2633.063) (-2641.022) [-2632.539] * (-2633.636) (-2631.669) [-2632.832] (-2643.502) -- 0:01:10
      602000 -- (-2637.330) (-2637.291) [-2633.721] (-2637.230) * [-2636.309] (-2639.545) (-2635.727) (-2641.484) -- 0:01:10
      602500 -- (-2631.494) (-2637.548) (-2633.511) [-2634.568] * (-2633.237) (-2638.185) [-2636.749] (-2637.432) -- 0:01:10
      603000 -- (-2637.014) (-2641.934) [-2631.649] (-2635.234) * [-2632.458] (-2637.926) (-2636.359) (-2639.677) -- 0:01:10
      603500 -- (-2638.989) (-2636.624) (-2636.619) [-2636.048] * (-2632.039) (-2635.637) [-2637.277] (-2652.538) -- 0:01:10
      604000 -- (-2637.544) (-2636.239) [-2635.092] (-2633.584) * (-2639.129) [-2636.868] (-2633.857) (-2638.108) -- 0:01:10
      604500 -- (-2631.615) (-2635.336) (-2637.600) [-2637.073] * (-2636.535) (-2636.667) [-2645.177] (-2632.736) -- 0:01:10
      605000 -- (-2636.407) (-2642.291) [-2632.940] (-2643.784) * (-2640.532) [-2639.152] (-2633.423) (-2635.047) -- 0:01:10

      Average standard deviation of split frequencies: 0.000000

      605500 -- [-2633.513] (-2647.086) (-2635.124) (-2642.749) * (-2633.525) (-2634.868) (-2638.587) [-2631.685] -- 0:01:10
      606000 -- (-2634.101) (-2641.212) (-2637.788) [-2639.887] * [-2630.908] (-2641.819) (-2637.328) (-2636.662) -- 0:01:10
      606500 -- (-2633.632) (-2634.702) (-2632.384) [-2635.972] * (-2640.835) [-2637.181] (-2637.772) (-2637.962) -- 0:01:10
      607000 -- (-2635.121) [-2641.357] (-2636.506) (-2636.242) * (-2634.585) (-2637.100) [-2632.461] (-2635.100) -- 0:01:09
      607500 -- (-2634.057) [-2637.619] (-2644.254) (-2631.279) * [-2632.709] (-2637.171) (-2633.095) (-2635.767) -- 0:01:09
      608000 -- (-2633.208) (-2635.416) (-2644.413) [-2634.889] * (-2638.206) (-2641.668) (-2633.262) [-2635.052] -- 0:01:09
      608500 -- (-2637.162) (-2635.151) [-2641.724] (-2634.066) * [-2635.711] (-2637.371) (-2635.778) (-2635.347) -- 0:01:09
      609000 -- (-2638.270) (-2633.426) (-2636.745) [-2637.310] * (-2641.949) [-2639.144] (-2640.124) (-2635.711) -- 0:01:09
      609500 -- (-2633.444) (-2634.806) [-2635.614] (-2634.223) * (-2637.030) (-2631.673) [-2636.352] (-2634.715) -- 0:01:09
      610000 -- [-2634.708] (-2638.085) (-2635.904) (-2637.308) * (-2640.448) [-2630.660] (-2645.677) (-2637.503) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      610500 -- (-2638.522) (-2635.199) (-2641.754) [-2639.805] * (-2637.986) [-2629.840] (-2644.708) (-2637.297) -- 0:01:09
      611000 -- [-2635.423] (-2634.973) (-2640.588) (-2636.140) * (-2644.357) (-2634.529) (-2642.124) [-2635.041] -- 0:01:09
      611500 -- [-2632.165] (-2637.061) (-2632.298) (-2636.976) * (-2638.718) [-2637.006] (-2637.807) (-2636.314) -- 0:01:09
      612000 -- (-2637.201) (-2635.352) [-2633.313] (-2637.527) * (-2640.674) [-2635.663] (-2633.738) (-2639.424) -- 0:01:09
      612500 -- (-2632.257) (-2636.281) [-2634.794] (-2636.576) * [-2634.582] (-2635.072) (-2632.772) (-2642.956) -- 0:01:08
      613000 -- (-2635.234) (-2638.071) [-2629.328] (-2638.335) * (-2634.980) [-2636.172] (-2633.577) (-2640.715) -- 0:01:08
      613500 -- (-2634.114) (-2634.314) (-2631.195) [-2636.262] * (-2635.763) (-2632.878) [-2631.917] (-2638.117) -- 0:01:08
      614000 -- (-2635.738) (-2639.020) [-2631.961] (-2632.439) * (-2634.833) (-2638.710) (-2636.613) [-2632.593] -- 0:01:08
      614500 -- (-2632.919) (-2633.267) [-2633.939] (-2635.794) * (-2640.081) [-2629.476] (-2634.721) (-2638.797) -- 0:01:08
      615000 -- (-2639.252) (-2637.002) [-2634.510] (-2638.896) * (-2644.683) [-2636.399] (-2638.057) (-2631.953) -- 0:01:08

      Average standard deviation of split frequencies: 0.000000

      615500 -- (-2635.419) (-2636.709) [-2635.823] (-2636.195) * (-2636.244) (-2632.128) (-2642.744) [-2636.617] -- 0:01:08
      616000 -- (-2634.890) [-2632.632] (-2638.705) (-2638.484) * (-2641.338) (-2648.032) (-2639.224) [-2638.360] -- 0:01:07
      616500 -- (-2635.604) (-2636.198) (-2646.826) [-2633.804] * (-2634.452) (-2637.163) [-2640.316] (-2635.239) -- 0:01:08
      617000 -- (-2633.615) (-2636.054) (-2635.139) [-2633.272] * [-2640.402] (-2631.895) (-2637.113) (-2635.190) -- 0:01:08
      617500 -- (-2640.107) [-2639.876] (-2642.393) (-2638.075) * (-2635.827) (-2633.644) [-2634.954] (-2640.218) -- 0:01:08
      618000 -- [-2634.236] (-2639.308) (-2638.426) (-2633.954) * (-2641.413) [-2633.942] (-2632.142) (-2636.851) -- 0:01:07
      618500 -- [-2638.778] (-2637.556) (-2633.177) (-2641.791) * (-2636.405) (-2634.961) [-2631.378] (-2636.515) -- 0:01:07
      619000 -- (-2637.167) (-2637.867) [-2633.492] (-2635.028) * [-2629.986] (-2642.517) (-2631.953) (-2630.587) -- 0:01:07
      619500 -- (-2635.868) (-2640.136) [-2631.552] (-2634.505) * (-2635.985) [-2636.939] (-2639.026) (-2632.943) -- 0:01:07
      620000 -- [-2633.147] (-2643.454) (-2636.058) (-2641.547) * [-2638.829] (-2633.880) (-2638.208) (-2643.171) -- 0:01:07

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-2635.841) (-2641.713) [-2632.134] (-2639.868) * (-2633.745) [-2634.739] (-2630.832) (-2638.936) -- 0:01:07
      621000 -- [-2632.448] (-2634.230) (-2637.887) (-2633.008) * (-2630.186) (-2633.193) (-2635.485) [-2642.834] -- 0:01:07
      621500 -- (-2636.191) (-2636.436) [-2639.985] (-2635.246) * (-2632.653) (-2634.158) [-2637.988] (-2632.288) -- 0:01:06
      622000 -- (-2634.377) [-2631.699] (-2633.997) (-2634.830) * (-2640.572) [-2636.928] (-2633.011) (-2633.447) -- 0:01:07
      622500 -- [-2633.886] (-2633.482) (-2633.240) (-2632.043) * (-2632.003) (-2637.746) [-2639.731] (-2636.457) -- 0:01:07
      623000 -- [-2636.755] (-2639.742) (-2632.130) (-2633.896) * (-2634.108) (-2633.259) [-2635.148] (-2635.807) -- 0:01:07
      623500 -- (-2632.537) (-2631.444) (-2631.755) [-2639.411] * (-2635.011) [-2635.117] (-2634.818) (-2644.426) -- 0:01:07
      624000 -- (-2639.257) (-2636.838) [-2637.400] (-2639.663) * (-2636.787) (-2635.815) (-2635.519) [-2638.118] -- 0:01:06
      624500 -- [-2637.772] (-2635.798) (-2647.243) (-2634.660) * (-2633.021) [-2636.810] (-2634.095) (-2634.504) -- 0:01:06
      625000 -- [-2643.738] (-2630.663) (-2641.304) (-2637.101) * [-2630.564] (-2633.760) (-2635.806) (-2643.891) -- 0:01:06

      Average standard deviation of split frequencies: 0.000000

      625500 -- (-2639.546) [-2641.900] (-2641.086) (-2632.562) * (-2631.865) [-2638.361] (-2635.583) (-2638.436) -- 0:01:06
      626000 -- (-2638.625) [-2640.239] (-2640.504) (-2632.221) * (-2633.358) (-2637.142) [-2633.258] (-2631.829) -- 0:01:06
      626500 -- (-2633.491) [-2637.462] (-2637.636) (-2632.861) * (-2633.204) (-2635.358) [-2633.954] (-2641.292) -- 0:01:06
      627000 -- [-2631.330] (-2633.383) (-2644.679) (-2640.779) * (-2634.928) (-2634.005) (-2642.514) [-2635.783] -- 0:01:06
      627500 -- (-2635.900) (-2636.215) [-2642.974] (-2636.849) * [-2634.137] (-2645.122) (-2637.876) (-2631.660) -- 0:01:06
      628000 -- (-2638.018) [-2631.869] (-2648.616) (-2631.945) * (-2637.753) (-2634.188) (-2635.871) [-2636.709] -- 0:01:06
      628500 -- (-2635.890) (-2635.012) (-2638.889) [-2645.671] * [-2634.677] (-2633.224) (-2635.725) (-2639.359) -- 0:01:06
      629000 -- (-2634.544) [-2632.491] (-2640.326) (-2638.861) * [-2637.306] (-2638.443) (-2639.584) (-2635.905) -- 0:01:06
      629500 -- (-2632.889) (-2633.698) [-2633.003] (-2639.533) * (-2635.215) (-2635.410) (-2637.298) [-2638.294] -- 0:01:05
      630000 -- [-2636.724] (-2638.706) (-2639.609) (-2636.768) * (-2637.307) (-2641.499) (-2638.644) [-2639.275] -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      630500 -- [-2638.348] (-2637.285) (-2634.172) (-2641.267) * (-2638.672) (-2642.129) (-2634.426) [-2636.093] -- 0:01:05
      631000 -- [-2631.683] (-2649.113) (-2634.213) (-2645.028) * [-2641.489] (-2639.095) (-2632.657) (-2629.960) -- 0:01:05
      631500 -- (-2633.797) (-2637.298) (-2640.318) [-2635.918] * (-2636.797) (-2634.920) [-2633.694] (-2637.760) -- 0:01:05
      632000 -- [-2635.120] (-2636.286) (-2635.536) (-2643.767) * (-2635.525) [-2632.171] (-2635.329) (-2639.484) -- 0:01:05
      632500 -- (-2636.678) [-2633.906] (-2635.150) (-2632.021) * (-2637.068) [-2637.586] (-2639.284) (-2633.806) -- 0:01:05
      633000 -- (-2638.206) [-2635.585] (-2634.645) (-2639.259) * (-2639.481) [-2635.126] (-2636.007) (-2631.606) -- 0:01:04
      633500 -- (-2634.149) [-2638.136] (-2639.868) (-2636.588) * [-2641.119] (-2636.300) (-2634.141) (-2636.300) -- 0:01:05
      634000 -- (-2635.809) (-2633.212) [-2635.416] (-2634.418) * (-2634.346) [-2636.840] (-2634.567) (-2637.556) -- 0:01:05
      634500 -- [-2638.089] (-2635.461) (-2635.020) (-2636.215) * (-2635.719) (-2635.947) [-2639.145] (-2634.724) -- 0:01:05
      635000 -- (-2639.001) [-2632.548] (-2636.880) (-2634.768) * (-2634.583) [-2636.236] (-2635.338) (-2639.388) -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      635500 -- [-2637.675] (-2633.843) (-2633.287) (-2633.978) * (-2636.978) (-2636.560) [-2632.196] (-2642.327) -- 0:01:04
      636000 -- (-2642.315) (-2633.828) [-2638.159] (-2637.417) * (-2636.465) (-2634.432) [-2633.969] (-2641.634) -- 0:01:04
      636500 -- [-2637.865] (-2633.207) (-2633.631) (-2641.006) * (-2632.854) [-2633.713] (-2637.580) (-2637.023) -- 0:01:04
      637000 -- (-2644.006) [-2639.825] (-2638.296) (-2634.758) * [-2637.524] (-2637.284) (-2633.969) (-2638.817) -- 0:01:04
      637500 -- (-2638.617) [-2633.420] (-2641.999) (-2632.361) * [-2634.754] (-2632.244) (-2637.606) (-2644.007) -- 0:01:04
      638000 -- [-2635.711] (-2637.564) (-2645.070) (-2638.818) * [-2633.625] (-2639.027) (-2633.628) (-2631.883) -- 0:01:04
      638500 -- (-2637.748) (-2637.239) (-2634.368) [-2635.019] * (-2636.093) [-2637.560] (-2638.960) (-2639.792) -- 0:01:03
      639000 -- (-2632.809) (-2640.507) [-2633.720] (-2639.622) * (-2635.151) (-2635.879) [-2635.281] (-2636.742) -- 0:01:04
      639500 -- (-2635.956) (-2633.881) [-2634.739] (-2634.534) * (-2635.966) (-2636.597) [-2635.739] (-2632.150) -- 0:01:04
      640000 -- (-2634.471) (-2640.202) (-2637.668) [-2633.092] * [-2633.410] (-2636.960) (-2644.369) (-2636.047) -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      640500 -- (-2634.876) (-2640.643) (-2635.817) [-2628.826] * [-2634.666] (-2643.530) (-2645.167) (-2641.646) -- 0:01:03
      641000 -- (-2638.263) (-2640.221) (-2634.860) [-2629.671] * (-2635.616) [-2638.540] (-2638.790) (-2635.003) -- 0:01:03
      641500 -- (-2637.804) (-2635.867) [-2641.557] (-2631.313) * [-2640.323] (-2634.459) (-2641.081) (-2636.899) -- 0:01:03
      642000 -- (-2640.591) [-2643.901] (-2632.407) (-2635.334) * [-2632.650] (-2633.078) (-2636.038) (-2633.615) -- 0:01:03
      642500 -- (-2633.682) (-2641.500) (-2638.947) [-2630.486] * (-2633.061) (-2634.017) (-2641.759) [-2632.170] -- 0:01:03
      643000 -- (-2634.853) (-2635.836) (-2636.829) [-2633.087] * (-2633.442) (-2636.857) [-2636.133] (-2640.867) -- 0:01:03
      643500 -- [-2631.756] (-2647.127) (-2632.709) (-2637.443) * [-2635.840] (-2635.150) (-2635.570) (-2643.101) -- 0:01:03
      644000 -- (-2636.286) (-2638.515) [-2630.831] (-2638.473) * [-2633.874] (-2635.564) (-2635.870) (-2637.583) -- 0:01:03
      644500 -- (-2635.045) [-2635.303] (-2635.025) (-2639.506) * (-2636.482) [-2637.434] (-2635.887) (-2638.220) -- 0:01:03
      645000 -- (-2634.558) [-2630.728] (-2633.613) (-2635.362) * [-2636.149] (-2634.729) (-2634.924) (-2644.254) -- 0:01:03

      Average standard deviation of split frequencies: 0.000000

      645500 -- (-2638.745) (-2635.289) (-2636.457) [-2640.669] * (-2637.340) (-2636.459) (-2630.670) [-2637.512] -- 0:01:03
      646000 -- (-2633.369) (-2631.563) (-2629.932) [-2634.167] * [-2639.801] (-2637.605) (-2638.467) (-2635.742) -- 0:01:03
      646500 -- (-2636.426) (-2632.256) (-2639.826) [-2639.729] * (-2638.551) [-2635.467] (-2633.999) (-2635.296) -- 0:01:02
      647000 -- (-2633.444) (-2635.470) (-2636.974) [-2639.858] * (-2636.120) (-2638.251) [-2633.009] (-2635.545) -- 0:01:02
      647500 -- [-2634.900] (-2631.844) (-2640.802) (-2634.287) * (-2634.481) (-2633.967) [-2633.959] (-2635.013) -- 0:01:02
      648000 -- (-2635.584) (-2637.300) [-2638.547] (-2632.082) * (-2634.881) [-2634.677] (-2636.163) (-2637.387) -- 0:01:02
      648500 -- (-2639.779) [-2629.742] (-2632.563) (-2635.890) * (-2632.579) (-2639.528) [-2631.669] (-2632.651) -- 0:01:02
      649000 -- (-2639.296) [-2630.687] (-2638.133) (-2649.603) * (-2632.155) (-2640.798) (-2639.052) [-2632.647] -- 0:01:02
      649500 -- (-2636.159) [-2631.973] (-2630.599) (-2643.391) * (-2635.898) (-2642.335) [-2635.577] (-2633.715) -- 0:01:02
      650000 -- (-2636.058) (-2637.911) (-2638.664) [-2637.792] * (-2634.520) (-2641.853) [-2631.843] (-2635.714) -- 0:01:01

      Average standard deviation of split frequencies: 0.000000

      650500 -- [-2637.884] (-2633.958) (-2632.754) (-2640.774) * (-2638.651) [-2639.014] (-2640.029) (-2636.874) -- 0:01:02
      651000 -- (-2637.606) (-2633.355) [-2635.120] (-2638.177) * (-2634.171) (-2633.390) [-2635.970] (-2638.025) -- 0:01:02
      651500 -- [-2634.471] (-2634.553) (-2636.812) (-2641.068) * [-2632.289] (-2638.120) (-2633.239) (-2641.564) -- 0:01:02
      652000 -- [-2635.520] (-2636.836) (-2632.933) (-2636.626) * [-2635.962] (-2638.486) (-2631.506) (-2642.650) -- 0:01:01
      652500 -- [-2633.690] (-2632.996) (-2630.152) (-2640.380) * (-2635.503) [-2637.326] (-2631.835) (-2647.161) -- 0:01:01
      653000 -- [-2633.084] (-2638.197) (-2637.665) (-2633.211) * [-2633.372] (-2637.651) (-2634.908) (-2638.114) -- 0:01:01
      653500 -- (-2634.995) (-2634.086) (-2635.855) [-2634.476] * [-2634.413] (-2640.449) (-2637.675) (-2635.861) -- 0:01:01
      654000 -- (-2640.565) (-2639.273) [-2633.892] (-2637.654) * (-2638.694) [-2638.347] (-2640.291) (-2648.691) -- 0:01:01
      654500 -- [-2637.547] (-2644.976) (-2633.266) (-2634.250) * (-2642.219) [-2639.452] (-2635.920) (-2635.904) -- 0:01:01
      655000 -- (-2642.301) (-2636.472) (-2630.281) [-2634.664] * [-2634.316] (-2639.717) (-2636.875) (-2637.863) -- 0:01:01

      Average standard deviation of split frequencies: 0.000000

      655500 -- (-2640.151) (-2635.337) [-2632.600] (-2636.591) * (-2636.163) (-2640.120) (-2638.731) [-2636.687] -- 0:01:00
      656000 -- (-2636.308) [-2636.564] (-2635.239) (-2637.428) * [-2640.132] (-2636.296) (-2639.734) (-2641.255) -- 0:01:01
      656500 -- (-2638.373) (-2634.041) [-2630.476] (-2634.161) * (-2636.107) [-2638.965] (-2636.667) (-2636.149) -- 0:01:01
      657000 -- (-2631.957) (-2635.280) (-2636.006) [-2635.254] * [-2640.631] (-2632.321) (-2636.839) (-2633.677) -- 0:01:01
      657500 -- (-2637.859) [-2635.478] (-2637.480) (-2635.029) * (-2631.443) (-2639.580) (-2633.081) [-2640.804] -- 0:01:00
      658000 -- (-2636.008) (-2632.008) [-2632.805] (-2641.682) * (-2640.414) (-2641.940) (-2636.000) [-2634.993] -- 0:01:00
      658500 -- (-2633.781) (-2633.823) (-2633.535) [-2636.269] * (-2633.476) [-2632.448] (-2635.184) (-2632.965) -- 0:01:00
      659000 -- (-2637.133) [-2633.792] (-2635.409) (-2635.263) * [-2639.765] (-2640.220) (-2636.692) (-2632.730) -- 0:01:00
      659500 -- [-2636.311] (-2636.370) (-2638.948) (-2640.815) * (-2634.201) [-2633.703] (-2633.617) (-2635.573) -- 0:01:00
      660000 -- (-2639.033) [-2636.266] (-2633.506) (-2633.651) * (-2638.947) [-2635.948] (-2637.175) (-2636.577) -- 0:01:00

      Average standard deviation of split frequencies: 0.000000

      660500 -- (-2637.056) (-2634.637) [-2633.120] (-2641.630) * (-2632.987) [-2630.683] (-2630.901) (-2636.917) -- 0:01:00
      661000 -- (-2638.668) [-2635.108] (-2634.367) (-2638.320) * (-2634.168) [-2633.727] (-2630.858) (-2642.975) -- 0:01:00
      661500 -- (-2636.250) [-2635.930] (-2639.950) (-2649.897) * [-2635.812] (-2633.400) (-2632.374) (-2638.505) -- 0:01:00
      662000 -- (-2638.682) [-2641.535] (-2637.571) (-2648.028) * [-2636.216] (-2632.714) (-2634.624) (-2634.208) -- 0:01:00
      662500 -- [-2637.422] (-2638.184) (-2635.681) (-2635.862) * (-2634.727) (-2644.048) [-2633.223] (-2632.513) -- 0:01:00
      663000 -- (-2638.706) (-2637.350) (-2643.841) [-2637.015] * (-2635.077) (-2634.930) [-2631.877] (-2638.220) -- 0:00:59
      663500 -- [-2634.396] (-2639.957) (-2638.362) (-2635.917) * (-2632.717) [-2631.492] (-2638.621) (-2637.932) -- 0:00:59
      664000 -- (-2640.271) [-2637.492] (-2636.086) (-2632.352) * (-2636.387) [-2635.022] (-2634.451) (-2636.221) -- 0:00:59
      664500 -- (-2638.785) (-2638.809) [-2638.047] (-2634.065) * [-2637.169] (-2634.715) (-2633.369) (-2648.449) -- 0:00:59
      665000 -- (-2631.986) (-2638.875) [-2637.187] (-2640.719) * [-2638.127] (-2637.325) (-2636.048) (-2638.582) -- 0:00:59

      Average standard deviation of split frequencies: 0.000000

      665500 -- (-2638.329) [-2632.690] (-2635.175) (-2635.406) * [-2632.000] (-2639.755) (-2637.308) (-2638.457) -- 0:00:59
      666000 -- (-2641.762) [-2632.016] (-2636.810) (-2634.954) * [-2635.295] (-2632.464) (-2640.052) (-2635.034) -- 0:00:59
      666500 -- (-2636.500) [-2631.766] (-2635.939) (-2634.337) * (-2635.562) (-2631.823) (-2634.466) [-2637.254] -- 0:00:59
      667000 -- [-2638.901] (-2632.984) (-2637.529) (-2632.125) * [-2635.060] (-2636.430) (-2633.706) (-2634.336) -- 0:00:58
      667500 -- (-2635.001) (-2638.020) [-2633.090] (-2635.323) * (-2636.040) (-2642.616) (-2635.798) [-2638.603] -- 0:00:59
      668000 -- [-2631.021] (-2642.225) (-2634.365) (-2642.199) * (-2633.813) (-2631.601) [-2638.238] (-2639.943) -- 0:00:59
      668500 -- [-2632.883] (-2640.917) (-2634.817) (-2649.779) * (-2630.009) [-2634.769] (-2639.011) (-2641.746) -- 0:00:59
      669000 -- (-2633.443) (-2635.291) (-2635.957) [-2632.997] * (-2640.985) [-2639.192] (-2634.348) (-2638.789) -- 0:00:58
      669500 -- (-2635.295) (-2635.884) (-2636.869) [-2638.164] * (-2636.725) (-2638.433) [-2633.736] (-2642.918) -- 0:00:58
      670000 -- (-2636.398) (-2637.972) [-2633.629] (-2635.320) * (-2649.568) (-2634.845) [-2634.583] (-2635.546) -- 0:00:58

      Average standard deviation of split frequencies: 0.000000

      670500 -- [-2636.047] (-2635.701) (-2638.805) (-2637.774) * [-2639.552] (-2640.177) (-2642.808) (-2633.235) -- 0:00:58
      671000 -- (-2631.814) (-2632.411) [-2638.691] (-2634.171) * (-2634.432) (-2636.475) [-2638.567] (-2638.664) -- 0:00:58
      671500 -- (-2637.072) [-2631.936] (-2638.270) (-2632.951) * (-2635.724) (-2635.895) (-2636.088) [-2640.440] -- 0:00:58
      672000 -- [-2634.970] (-2635.555) (-2640.616) (-2634.106) * (-2631.906) (-2634.062) [-2631.160] (-2634.801) -- 0:00:58
      672500 -- [-2640.332] (-2639.438) (-2645.902) (-2633.535) * [-2630.461] (-2635.920) (-2634.254) (-2644.598) -- 0:00:57
      673000 -- (-2639.212) (-2638.462) (-2638.809) [-2634.903] * [-2634.190] (-2641.321) (-2636.102) (-2645.704) -- 0:00:58
      673500 -- (-2636.665) (-2633.671) (-2632.406) [-2635.661] * (-2636.279) (-2640.772) [-2631.086] (-2641.234) -- 0:00:58
      674000 -- (-2641.356) [-2632.193] (-2633.276) (-2640.780) * (-2637.442) (-2633.861) (-2629.925) [-2630.957] -- 0:00:58
      674500 -- (-2638.434) [-2636.496] (-2632.436) (-2632.240) * (-2637.243) (-2634.691) [-2630.750] (-2638.439) -- 0:00:57
      675000 -- (-2643.683) [-2632.833] (-2636.094) (-2636.538) * (-2640.486) [-2632.399] (-2636.015) (-2636.807) -- 0:00:57

      Average standard deviation of split frequencies: 0.000000

      675500 -- (-2634.471) (-2636.291) [-2636.079] (-2636.702) * [-2631.871] (-2631.733) (-2638.626) (-2637.491) -- 0:00:57
      676000 -- (-2636.325) [-2632.846] (-2636.513) (-2634.459) * (-2634.471) (-2631.867) [-2636.533] (-2648.519) -- 0:00:57
      676500 -- [-2634.512] (-2647.250) (-2636.047) (-2638.096) * (-2633.269) [-2634.668] (-2643.862) (-2637.829) -- 0:00:57
      677000 -- (-2634.716) (-2631.790) (-2634.566) [-2636.885] * (-2634.314) (-2640.328) [-2642.428] (-2632.793) -- 0:00:57
      677500 -- (-2634.287) (-2639.126) [-2633.990] (-2632.365) * (-2636.322) (-2641.372) (-2637.037) [-2633.445] -- 0:00:57
      678000 -- (-2635.700) (-2637.168) [-2639.632] (-2635.817) * (-2633.842) (-2642.483) (-2637.268) [-2636.212] -- 0:00:56
      678500 -- (-2639.756) [-2638.194] (-2637.284) (-2632.513) * [-2634.210] (-2635.843) (-2643.996) (-2634.146) -- 0:00:57
      679000 -- [-2633.184] (-2633.077) (-2634.549) (-2634.195) * (-2633.477) (-2635.722) (-2646.255) [-2636.637] -- 0:00:57
      679500 -- (-2637.226) [-2634.151] (-2637.133) (-2631.807) * (-2639.234) (-2633.299) (-2632.920) [-2639.196] -- 0:00:57
      680000 -- (-2646.870) (-2637.089) (-2635.343) [-2634.343] * [-2638.107] (-2638.348) (-2643.365) (-2635.550) -- 0:00:56

      Average standard deviation of split frequencies: 0.000000

      680500 -- (-2641.164) (-2643.770) (-2635.304) [-2632.021] * (-2633.270) (-2634.388) (-2641.382) [-2633.633] -- 0:00:56
      681000 -- (-2640.245) (-2638.703) (-2631.034) [-2635.666] * (-2632.405) [-2636.099] (-2634.589) (-2641.632) -- 0:00:56
      681500 -- (-2641.032) (-2646.465) [-2635.224] (-2636.559) * (-2633.740) [-2632.524] (-2637.721) (-2638.900) -- 0:00:56
      682000 -- (-2637.681) (-2637.044) (-2636.039) [-2637.758] * [-2634.100] (-2635.570) (-2634.943) (-2646.250) -- 0:00:56
      682500 -- [-2634.953] (-2632.277) (-2637.765) (-2637.395) * (-2637.577) [-2636.258] (-2638.931) (-2636.538) -- 0:00:56
      683000 -- (-2635.519) (-2632.307) [-2635.226] (-2638.987) * (-2637.454) (-2639.266) [-2639.701] (-2633.059) -- 0:00:56
      683500 -- [-2629.564] (-2637.602) (-2634.428) (-2638.536) * (-2634.658) [-2634.906] (-2639.188) (-2636.754) -- 0:00:56
      684000 -- (-2633.876) (-2636.846) (-2639.574) [-2638.749] * [-2637.508] (-2645.263) (-2637.019) (-2633.621) -- 0:00:55
      684500 -- (-2633.474) [-2633.324] (-2639.425) (-2633.291) * (-2639.734) [-2636.250] (-2634.581) (-2637.900) -- 0:00:56
      685000 -- (-2640.295) [-2636.023] (-2645.092) (-2633.951) * (-2633.155) [-2630.585] (-2641.804) (-2639.548) -- 0:00:56

      Average standard deviation of split frequencies: 0.000000

      685500 -- [-2637.766] (-2639.070) (-2632.768) (-2635.036) * [-2636.192] (-2639.561) (-2635.692) (-2631.415) -- 0:00:55
      686000 -- [-2632.011] (-2631.680) (-2635.762) (-2640.256) * [-2639.292] (-2641.156) (-2638.012) (-2631.431) -- 0:00:55
      686500 -- (-2637.070) (-2640.295) [-2634.010] (-2634.331) * (-2637.379) [-2636.847] (-2633.111) (-2635.911) -- 0:00:55
      687000 -- (-2634.652) (-2632.140) [-2637.212] (-2634.029) * (-2636.091) (-2638.099) [-2636.000] (-2636.458) -- 0:00:55
      687500 -- (-2637.042) (-2635.227) (-2632.239) [-2635.626] * (-2632.727) (-2634.853) [-2633.497] (-2639.016) -- 0:00:55
      688000 -- (-2631.881) (-2642.257) [-2632.748] (-2632.053) * [-2633.752] (-2635.089) (-2636.231) (-2636.348) -- 0:00:55
      688500 -- (-2634.089) (-2634.044) (-2633.838) [-2634.599] * (-2637.058) [-2633.350] (-2632.634) (-2642.260) -- 0:00:55
      689000 -- (-2632.426) (-2635.153) (-2633.048) [-2635.149] * (-2636.792) [-2633.492] (-2640.769) (-2638.905) -- 0:00:55
      689500 -- [-2633.628] (-2637.140) (-2635.898) (-2642.248) * (-2637.418) (-2632.987) (-2639.519) [-2636.712] -- 0:00:54
      690000 -- (-2635.552) [-2638.222] (-2645.386) (-2633.105) * [-2640.845] (-2637.819) (-2638.246) (-2635.250) -- 0:00:55

      Average standard deviation of split frequencies: 0.000000

      690500 -- [-2633.585] (-2635.485) (-2633.594) (-2635.316) * (-2636.635) (-2633.715) (-2637.033) [-2631.102] -- 0:00:55
      691000 -- (-2640.458) (-2638.812) (-2635.164) [-2630.778] * (-2634.557) [-2631.998] (-2637.097) (-2635.481) -- 0:00:55
      691500 -- (-2638.838) (-2638.504) (-2632.750) [-2635.395] * (-2639.007) (-2640.516) (-2634.162) [-2637.947] -- 0:00:54
      692000 -- (-2638.588) (-2636.390) [-2633.303] (-2636.010) * (-2634.340) (-2640.815) [-2638.958] (-2642.036) -- 0:00:54
      692500 -- (-2634.216) (-2633.012) (-2639.316) [-2637.612] * (-2633.295) (-2634.693) [-2635.712] (-2639.422) -- 0:00:54
      693000 -- (-2630.185) (-2633.541) [-2635.220] (-2639.356) * (-2640.262) (-2636.561) (-2633.688) [-2634.720] -- 0:00:54
      693500 -- (-2636.658) [-2634.636] (-2642.262) (-2634.814) * (-2639.050) (-2640.310) (-2639.891) [-2636.435] -- 0:00:54
      694000 -- [-2636.109] (-2634.888) (-2638.278) (-2640.107) * (-2640.737) [-2635.491] (-2637.065) (-2634.666) -- 0:00:54
      694500 -- (-2636.938) (-2634.808) [-2639.197] (-2640.216) * (-2639.730) (-2631.701) (-2632.240) [-2633.465] -- 0:00:54
      695000 -- [-2636.332] (-2639.553) (-2639.104) (-2639.467) * (-2632.915) (-2634.019) [-2632.339] (-2639.450) -- 0:00:53

      Average standard deviation of split frequencies: 0.000000

      695500 -- (-2637.736) (-2634.953) [-2636.499] (-2634.306) * (-2638.316) (-2634.800) (-2634.691) [-2635.725] -- 0:00:54
      696000 -- [-2640.994] (-2638.173) (-2637.299) (-2635.828) * [-2643.605] (-2640.764) (-2638.447) (-2638.684) -- 0:00:54
      696500 -- (-2634.941) (-2638.340) (-2637.497) [-2634.737] * (-2642.239) [-2631.831] (-2642.755) (-2639.926) -- 0:00:54
      697000 -- (-2638.775) (-2635.648) [-2634.384] (-2642.519) * [-2639.166] (-2632.639) (-2634.205) (-2633.221) -- 0:00:53
      697500 -- (-2637.253) [-2632.308] (-2634.268) (-2651.957) * [-2641.955] (-2636.872) (-2635.120) (-2636.644) -- 0:00:53
      698000 -- (-2638.723) (-2634.252) (-2632.986) [-2637.567] * (-2643.928) (-2637.050) [-2634.791] (-2638.397) -- 0:00:53
      698500 -- (-2632.409) [-2632.840] (-2637.711) (-2633.052) * [-2635.249] (-2640.174) (-2630.892) (-2635.239) -- 0:00:53
      699000 -- (-2631.162) (-2637.523) [-2638.890] (-2638.042) * [-2639.789] (-2632.428) (-2633.361) (-2634.016) -- 0:00:53
      699500 -- (-2634.581) (-2641.410) [-2630.884] (-2635.794) * (-2640.029) (-2638.133) (-2633.077) [-2636.033] -- 0:00:53
      700000 -- (-2640.491) (-2633.768) (-2631.306) [-2638.473] * [-2636.820] (-2639.313) (-2638.510) (-2634.990) -- 0:00:53

      Average standard deviation of split frequencies: 0.000000

      700500 -- [-2638.847] (-2634.681) (-2635.853) (-2639.184) * (-2634.462) (-2640.308) [-2634.157] (-2638.835) -- 0:00:53
      701000 -- (-2636.440) (-2640.309) [-2639.230] (-2641.847) * (-2635.739) (-2633.687) (-2638.974) [-2633.155] -- 0:00:52
      701500 -- [-2634.530] (-2633.830) (-2647.670) (-2638.469) * [-2631.825] (-2642.933) (-2636.247) (-2632.596) -- 0:00:53
      702000 -- (-2637.439) (-2642.205) [-2636.513] (-2637.476) * (-2646.256) (-2637.352) [-2633.398] (-2632.939) -- 0:00:53
      702500 -- (-2637.701) [-2639.931] (-2631.640) (-2636.195) * (-2638.002) [-2632.783] (-2631.256) (-2639.384) -- 0:00:52
      703000 -- (-2634.563) [-2637.125] (-2644.922) (-2635.394) * (-2634.842) [-2630.590] (-2635.948) (-2636.895) -- 0:00:52
      703500 -- [-2636.385] (-2637.761) (-2633.563) (-2631.844) * (-2642.738) [-2635.922] (-2638.038) (-2633.380) -- 0:00:52
      704000 -- (-2635.732) (-2636.676) [-2632.876] (-2637.871) * [-2641.325] (-2636.873) (-2635.778) (-2630.176) -- 0:00:52
      704500 -- (-2636.522) (-2638.264) [-2632.874] (-2632.111) * (-2640.439) [-2640.398] (-2638.254) (-2632.648) -- 0:00:52
      705000 -- (-2636.524) (-2634.237) [-2632.857] (-2637.641) * (-2636.212) (-2634.612) (-2634.601) [-2632.658] -- 0:00:52

      Average standard deviation of split frequencies: 0.000000

      705500 -- (-2636.860) [-2636.993] (-2633.434) (-2638.817) * (-2632.311) (-2637.491) (-2638.875) [-2636.860] -- 0:00:52
      706000 -- (-2634.446) (-2636.877) (-2634.570) [-2634.363] * (-2633.612) [-2640.798] (-2634.724) (-2632.337) -- 0:00:52
      706500 -- (-2637.208) (-2636.208) (-2640.319) [-2633.033] * (-2637.376) (-2633.576) [-2633.131] (-2634.520) -- 0:00:51
      707000 -- (-2631.907) (-2640.733) (-2635.053) [-2637.582] * [-2636.017] (-2634.855) (-2645.241) (-2633.921) -- 0:00:52
      707500 -- (-2635.890) (-2636.277) [-2642.409] (-2638.833) * (-2637.270) [-2632.132] (-2636.761) (-2636.010) -- 0:00:52
      708000 -- (-2632.894) [-2634.258] (-2641.112) (-2641.750) * (-2636.311) [-2637.833] (-2631.720) (-2635.673) -- 0:00:51
      708500 -- [-2634.919] (-2637.252) (-2637.108) (-2633.517) * (-2637.002) (-2636.222) [-2634.753] (-2638.814) -- 0:00:51
      709000 -- (-2636.056) (-2634.231) (-2637.823) [-2647.615] * (-2641.000) (-2637.718) [-2643.056] (-2635.499) -- 0:00:51
      709500 -- (-2637.802) (-2632.113) (-2639.041) [-2639.697] * (-2644.427) (-2642.271) (-2636.688) [-2635.944] -- 0:00:51
      710000 -- (-2631.453) [-2638.362] (-2635.572) (-2633.040) * (-2644.374) (-2638.786) [-2635.280] (-2639.550) -- 0:00:51

      Average standard deviation of split frequencies: 0.000000

      710500 -- (-2641.799) (-2636.786) [-2632.363] (-2633.592) * (-2639.744) (-2643.115) [-2633.620] (-2633.721) -- 0:00:51
      711000 -- (-2634.422) (-2634.560) (-2638.128) [-2634.394] * (-2637.395) [-2637.859] (-2630.788) (-2639.078) -- 0:00:51
      711500 -- [-2636.795] (-2632.458) (-2634.304) (-2630.336) * (-2635.266) (-2636.910) (-2636.877) [-2639.141] -- 0:00:51
      712000 -- (-2637.061) (-2635.558) [-2633.578] (-2638.321) * [-2632.624] (-2640.467) (-2638.421) (-2634.610) -- 0:00:50
      712500 -- [-2635.937] (-2638.004) (-2642.816) (-2640.929) * [-2637.084] (-2639.733) (-2641.185) (-2640.767) -- 0:00:51
      713000 -- (-2633.107) (-2643.633) (-2639.974) [-2631.297] * (-2630.318) (-2631.876) [-2640.301] (-2638.846) -- 0:00:51
      713500 -- (-2637.157) (-2634.371) (-2640.915) [-2639.200] * (-2631.887) (-2638.661) [-2636.149] (-2634.299) -- 0:00:50
      714000 -- (-2638.431) (-2634.386) (-2639.102) [-2636.209] * [-2641.092] (-2633.454) (-2635.997) (-2631.700) -- 0:00:50
      714500 -- (-2638.101) (-2636.222) (-2633.447) [-2637.385] * (-2633.977) (-2636.530) [-2634.299] (-2635.111) -- 0:00:50
      715000 -- [-2637.382] (-2631.356) (-2644.472) (-2632.318) * (-2642.160) (-2633.059) [-2632.925] (-2643.487) -- 0:00:50

      Average standard deviation of split frequencies: 0.000000

      715500 -- [-2636.309] (-2635.899) (-2637.226) (-2640.011) * (-2639.535) [-2631.523] (-2635.890) (-2640.017) -- 0:00:50
      716000 -- (-2633.762) (-2642.607) (-2634.646) [-2638.264] * (-2633.741) (-2635.774) [-2639.773] (-2641.456) -- 0:00:50
      716500 -- [-2639.079] (-2633.332) (-2636.293) (-2642.207) * (-2639.485) (-2640.586) (-2635.211) [-2635.858] -- 0:00:50
      717000 -- [-2637.022] (-2636.919) (-2637.311) (-2635.040) * [-2632.506] (-2637.055) (-2635.440) (-2630.423) -- 0:00:50
      717500 -- (-2635.458) (-2634.689) (-2632.509) [-2634.849] * (-2632.888) [-2632.517] (-2634.434) (-2636.085) -- 0:00:50
      718000 -- (-2635.032) (-2633.078) (-2636.229) [-2633.036] * (-2636.150) (-2634.880) (-2634.612) [-2640.113] -- 0:00:49
      718500 -- [-2633.464] (-2634.415) (-2638.349) (-2631.466) * (-2633.074) [-2635.632] (-2640.104) (-2636.731) -- 0:00:50
      719000 -- (-2641.698) (-2638.494) (-2633.244) [-2634.870] * (-2635.013) (-2637.339) [-2637.875] (-2637.157) -- 0:00:50
      719500 -- [-2634.106] (-2643.505) (-2636.753) (-2634.467) * [-2635.288] (-2639.776) (-2634.930) (-2637.050) -- 0:00:49
      720000 -- (-2630.819) [-2635.606] (-2636.590) (-2638.975) * (-2637.232) (-2637.715) (-2629.586) [-2636.054] -- 0:00:49

      Average standard deviation of split frequencies: 0.000000

      720500 -- (-2634.085) [-2637.324] (-2634.928) (-2635.015) * [-2635.224] (-2632.714) (-2637.607) (-2635.108) -- 0:00:49
      721000 -- (-2639.796) [-2632.733] (-2633.398) (-2636.171) * (-2637.160) (-2636.612) (-2633.594) [-2636.595] -- 0:00:49
      721500 -- (-2635.216) (-2638.813) (-2633.061) [-2636.755] * (-2642.410) (-2638.120) [-2636.651] (-2638.080) -- 0:00:49
      722000 -- (-2638.063) (-2638.748) [-2631.575] (-2637.642) * (-2636.590) (-2638.995) (-2631.238) [-2632.284] -- 0:00:49
      722500 -- (-2639.334) (-2635.361) [-2631.746] (-2633.101) * (-2640.116) [-2636.643] (-2637.455) (-2635.832) -- 0:00:49
      723000 -- [-2632.365] (-2638.822) (-2636.282) (-2642.435) * (-2640.302) (-2635.297) (-2631.724) [-2636.858] -- 0:00:49
      723500 -- [-2638.941] (-2635.864) (-2633.784) (-2642.930) * (-2637.394) [-2634.860] (-2633.620) (-2639.946) -- 0:00:48
      724000 -- (-2634.540) [-2636.635] (-2634.457) (-2650.393) * (-2640.719) (-2644.684) [-2635.953] (-2643.605) -- 0:00:49
      724500 -- (-2631.680) [-2637.479] (-2636.843) (-2633.222) * (-2641.291) [-2640.745] (-2640.233) (-2637.374) -- 0:00:49
      725000 -- [-2633.262] (-2639.815) (-2634.381) (-2636.537) * (-2634.325) (-2633.779) [-2631.774] (-2638.386) -- 0:00:48

      Average standard deviation of split frequencies: 0.000000

      725500 -- (-2636.266) (-2636.589) (-2630.726) [-2633.590] * [-2635.762] (-2634.012) (-2640.350) (-2631.661) -- 0:00:48
      726000 -- (-2637.298) [-2634.831] (-2634.428) (-2635.046) * [-2633.740] (-2634.914) (-2642.311) (-2633.626) -- 0:00:48
      726500 -- (-2637.102) (-2634.044) (-2639.373) [-2634.449] * (-2637.275) (-2638.173) (-2636.985) [-2637.021] -- 0:00:48
      727000 -- (-2635.594) (-2636.971) [-2637.033] (-2641.253) * [-2635.985] (-2630.736) (-2637.026) (-2637.684) -- 0:00:48
      727500 -- [-2632.817] (-2632.027) (-2633.127) (-2634.858) * [-2641.125] (-2639.345) (-2634.248) (-2631.461) -- 0:00:48
      728000 -- [-2637.748] (-2636.084) (-2635.049) (-2636.874) * (-2637.730) [-2635.863] (-2633.733) (-2631.988) -- 0:00:48
      728500 -- [-2636.732] (-2637.343) (-2634.229) (-2640.284) * (-2634.365) (-2633.305) (-2632.526) [-2633.720] -- 0:00:48
      729000 -- (-2642.507) (-2634.221) [-2630.777] (-2633.995) * (-2636.234) [-2634.037] (-2641.408) (-2637.467) -- 0:00:47
      729500 -- (-2640.823) [-2636.835] (-2635.015) (-2632.375) * (-2635.096) (-2632.834) [-2633.233] (-2634.952) -- 0:00:47
      730000 -- (-2638.526) [-2633.950] (-2638.717) (-2638.068) * [-2635.760] (-2641.822) (-2635.178) (-2634.691) -- 0:00:48

      Average standard deviation of split frequencies: 0.000000

      730500 -- [-2636.166] (-2641.948) (-2637.999) (-2636.863) * (-2639.427) (-2638.234) [-2635.954] (-2635.088) -- 0:00:47
      731000 -- (-2633.541) [-2637.093] (-2636.652) (-2637.959) * (-2633.438) (-2637.144) [-2636.133] (-2634.263) -- 0:00:47
      731500 -- [-2634.807] (-2644.237) (-2637.132) (-2638.761) * [-2635.481] (-2642.871) (-2638.874) (-2633.768) -- 0:00:47
      732000 -- [-2635.802] (-2641.797) (-2632.779) (-2644.357) * (-2637.679) (-2635.514) (-2641.444) [-2633.962] -- 0:00:47
      732500 -- (-2638.031) [-2643.798] (-2634.888) (-2647.622) * [-2635.112] (-2638.649) (-2640.782) (-2640.842) -- 0:00:47
      733000 -- (-2645.840) (-2639.273) [-2637.962] (-2647.890) * (-2633.317) (-2632.949) (-2632.809) [-2635.018] -- 0:00:47
      733500 -- (-2638.367) [-2633.448] (-2638.465) (-2641.678) * [-2633.425] (-2640.531) (-2634.216) (-2633.480) -- 0:00:47
      734000 -- (-2635.010) (-2636.538) [-2633.986] (-2637.989) * (-2633.175) [-2634.174] (-2635.809) (-2635.596) -- 0:00:47
      734500 -- (-2635.641) (-2643.385) [-2634.365] (-2637.710) * (-2634.830) (-2631.334) [-2630.899] (-2637.306) -- 0:00:46
      735000 -- (-2638.930) (-2639.727) [-2630.933] (-2633.392) * (-2636.022) (-2631.950) [-2631.608] (-2636.947) -- 0:00:46

      Average standard deviation of split frequencies: 0.000000

      735500 -- (-2636.113) [-2633.518] (-2633.309) (-2632.278) * (-2639.130) [-2629.973] (-2634.580) (-2636.141) -- 0:00:47
      736000 -- (-2637.821) (-2634.439) (-2632.102) [-2631.370] * [-2638.790] (-2635.031) (-2636.288) (-2639.102) -- 0:00:46
      736500 -- [-2638.982] (-2643.727) (-2638.733) (-2631.045) * (-2639.846) (-2638.416) (-2634.112) [-2638.349] -- 0:00:46
      737000 -- [-2641.994] (-2640.987) (-2644.916) (-2635.192) * (-2638.635) [-2636.879] (-2636.977) (-2637.051) -- 0:00:46
      737500 -- (-2639.652) [-2632.680] (-2637.235) (-2634.596) * (-2629.900) (-2636.336) [-2635.962] (-2638.958) -- 0:00:46
      738000 -- (-2632.453) (-2634.762) (-2637.897) [-2631.624] * (-2641.653) [-2638.775] (-2635.500) (-2635.575) -- 0:00:46
      738500 -- (-2635.652) (-2643.449) (-2640.986) [-2638.451] * (-2640.186) (-2634.003) [-2630.529] (-2639.614) -- 0:00:46
      739000 -- (-2635.183) (-2643.938) (-2640.943) [-2635.980] * [-2634.068] (-2630.475) (-2635.371) (-2645.534) -- 0:00:46
      739500 -- [-2629.331] (-2637.799) (-2636.620) (-2631.480) * (-2636.770) [-2637.439] (-2636.599) (-2641.836) -- 0:00:46
      740000 -- (-2635.395) (-2646.732) [-2636.605] (-2636.447) * [-2635.451] (-2633.459) (-2630.887) (-2640.379) -- 0:00:46

      Average standard deviation of split frequencies: 0.000000

      740500 -- (-2633.875) (-2638.468) (-2637.208) [-2632.675] * (-2635.183) [-2631.597] (-2634.847) (-2640.056) -- 0:00:45
      741000 -- (-2643.445) (-2644.513) (-2643.800) [-2636.097] * (-2638.228) (-2633.811) (-2637.852) [-2642.440] -- 0:00:46
      741500 -- [-2636.604] (-2637.847) (-2637.476) (-2635.633) * (-2646.032) (-2639.965) (-2639.550) [-2633.223] -- 0:00:46
      742000 -- (-2639.403) (-2634.893) [-2633.616] (-2640.161) * (-2634.441) [-2631.590] (-2639.140) (-2638.195) -- 0:00:45
      742500 -- (-2636.755) (-2638.767) [-2635.898] (-2636.400) * (-2633.322) (-2635.261) [-2634.120] (-2639.081) -- 0:00:45
      743000 -- (-2640.007) (-2632.856) (-2639.125) [-2634.790] * (-2639.245) [-2644.502] (-2632.680) (-2632.361) -- 0:00:45
      743500 -- (-2635.302) (-2636.130) (-2639.111) [-2633.268] * (-2635.975) [-2641.652] (-2637.767) (-2634.633) -- 0:00:45
      744000 -- [-2637.856] (-2634.847) (-2636.470) (-2634.927) * [-2642.188] (-2634.837) (-2638.578) (-2636.460) -- 0:00:45
      744500 -- [-2633.574] (-2633.063) (-2639.280) (-2633.046) * (-2638.690) (-2637.883) (-2634.552) [-2632.321] -- 0:00:45
      745000 -- (-2632.132) (-2636.981) [-2630.969] (-2630.772) * (-2637.399) (-2636.128) [-2637.488] (-2634.215) -- 0:00:45

      Average standard deviation of split frequencies: 0.000000

      745500 -- (-2638.429) [-2633.648] (-2641.839) (-2630.690) * (-2637.327) (-2641.870) [-2635.061] (-2631.727) -- 0:00:45
      746000 -- (-2632.067) (-2632.776) (-2636.701) [-2637.666] * (-2639.949) [-2637.786] (-2635.922) (-2636.562) -- 0:00:44
      746500 -- (-2632.833) (-2635.672) [-2634.751] (-2639.977) * (-2631.018) (-2638.251) (-2636.963) [-2636.929] -- 0:00:44
      747000 -- [-2642.294] (-2635.133) (-2634.732) (-2631.057) * (-2635.488) (-2634.959) (-2635.244) [-2638.197] -- 0:00:45
      747500 -- (-2633.762) (-2640.428) (-2637.482) [-2631.656] * (-2638.917) (-2633.188) (-2633.805) [-2635.875] -- 0:00:44
      748000 -- (-2632.252) (-2636.649) (-2642.718) [-2633.290] * (-2635.555) [-2638.583] (-2637.899) (-2635.753) -- 0:00:44
      748500 -- (-2638.358) (-2639.784) [-2631.944] (-2636.131) * (-2635.380) [-2632.433] (-2645.178) (-2635.807) -- 0:00:44
      749000 -- (-2636.527) [-2640.366] (-2635.169) (-2635.568) * (-2641.876) (-2641.427) [-2631.812] (-2638.045) -- 0:00:44
      749500 -- [-2634.918] (-2639.153) (-2638.086) (-2633.314) * (-2633.441) (-2637.043) [-2629.898] (-2639.106) -- 0:00:44
      750000 -- (-2631.899) [-2634.619] (-2635.874) (-2635.961) * (-2634.532) [-2631.071] (-2633.414) (-2638.506) -- 0:00:44

      Average standard deviation of split frequencies: 0.000000

      750500 -- (-2634.975) (-2637.624) [-2629.789] (-2633.420) * [-2632.346] (-2641.775) (-2630.255) (-2637.950) -- 0:00:44
      751000 -- [-2630.425] (-2631.966) (-2643.635) (-2633.612) * (-2636.874) (-2643.369) (-2637.222) [-2636.113] -- 0:00:44
      751500 -- (-2639.998) (-2637.419) [-2634.652] (-2637.565) * [-2634.111] (-2635.772) (-2638.607) (-2635.530) -- 0:00:43
      752000 -- (-2638.575) (-2637.201) (-2633.970) [-2630.743] * (-2633.445) (-2633.645) [-2633.639] (-2640.129) -- 0:00:43
      752500 -- (-2640.144) (-2639.071) [-2634.163] (-2636.464) * [-2633.684] (-2633.348) (-2634.305) (-2636.173) -- 0:00:44
      753000 -- (-2631.509) (-2632.974) [-2635.197] (-2634.893) * (-2641.671) (-2644.443) [-2636.109] (-2636.415) -- 0:00:43
      753500 -- (-2635.190) (-2633.123) (-2639.048) [-2631.629] * (-2637.804) (-2640.856) [-2640.746] (-2637.500) -- 0:00:43
      754000 -- (-2634.468) (-2632.963) (-2635.496) [-2635.144] * (-2635.222) (-2636.869) (-2642.442) [-2632.716] -- 0:00:43
      754500 -- (-2636.540) [-2631.808] (-2635.377) (-2630.514) * (-2632.367) (-2642.067) (-2640.433) [-2633.081] -- 0:00:43
      755000 -- [-2636.115] (-2637.681) (-2636.019) (-2630.405) * (-2633.422) [-2632.915] (-2641.985) (-2638.917) -- 0:00:43

      Average standard deviation of split frequencies: 0.000000

      755500 -- (-2636.161) (-2633.654) (-2642.102) [-2631.487] * (-2638.059) [-2633.726] (-2632.968) (-2641.167) -- 0:00:43
      756000 -- (-2638.085) [-2632.425] (-2632.106) (-2634.377) * (-2647.387) (-2633.834) [-2634.266] (-2643.893) -- 0:00:43
      756500 -- (-2639.935) (-2635.802) [-2632.575] (-2633.359) * [-2635.874] (-2631.326) (-2640.204) (-2636.069) -- 0:00:43
      757000 -- (-2636.021) (-2633.631) (-2634.797) [-2635.277] * [-2632.782] (-2637.329) (-2638.862) (-2636.652) -- 0:00:43
      757500 -- (-2642.772) (-2637.057) [-2639.363] (-2632.493) * (-2632.497) (-2637.595) [-2637.022] (-2632.881) -- 0:00:42
      758000 -- (-2631.240) (-2637.025) [-2634.001] (-2632.261) * (-2634.351) (-2635.096) (-2633.100) [-2633.220] -- 0:00:42
      758500 -- (-2642.017) [-2632.734] (-2636.844) (-2636.438) * [-2635.000] (-2637.240) (-2636.710) (-2638.546) -- 0:00:42
      759000 -- (-2636.571) (-2632.856) [-2638.389] (-2637.628) * (-2639.018) [-2636.855] (-2634.241) (-2634.173) -- 0:00:42
      759500 -- (-2635.563) (-2638.149) (-2641.425) [-2632.608] * (-2635.616) [-2636.549] (-2634.358) (-2636.322) -- 0:00:42
      760000 -- (-2635.547) (-2633.402) (-2635.439) [-2631.725] * [-2630.929] (-2635.409) (-2633.228) (-2637.635) -- 0:00:42

      Average standard deviation of split frequencies: 0.000000

      760500 -- [-2632.290] (-2633.401) (-2636.672) (-2638.220) * (-2635.148) (-2640.058) [-2635.764] (-2634.247) -- 0:00:42
      761000 -- (-2635.135) [-2636.532] (-2637.846) (-2635.161) * [-2633.027] (-2631.358) (-2636.545) (-2635.853) -- 0:00:42
      761500 -- (-2632.577) (-2633.474) [-2639.137] (-2642.181) * (-2637.675) (-2636.521) [-2634.477] (-2637.977) -- 0:00:42
      762000 -- (-2633.848) [-2637.057] (-2645.334) (-2634.800) * (-2636.620) (-2633.515) [-2636.639] (-2641.094) -- 0:00:42
      762500 -- (-2639.519) [-2636.706] (-2642.365) (-2632.020) * [-2632.412] (-2636.159) (-2643.808) (-2635.795) -- 0:00:42
      763000 -- (-2634.293) (-2645.603) [-2638.276] (-2634.503) * (-2644.293) (-2637.268) [-2633.552] (-2634.339) -- 0:00:41
      763500 -- (-2633.470) (-2637.410) [-2638.993] (-2632.726) * (-2635.940) (-2641.652) [-2632.266] (-2635.181) -- 0:00:41
      764000 -- (-2636.620) (-2641.186) [-2632.880] (-2637.051) * (-2633.154) (-2637.434) (-2634.077) [-2633.859] -- 0:00:42
      764500 -- (-2636.280) [-2635.560] (-2632.221) (-2638.037) * (-2633.179) [-2639.713] (-2638.602) (-2634.155) -- 0:00:41
      765000 -- (-2639.093) (-2640.034) [-2634.996] (-2635.432) * (-2633.684) [-2635.548] (-2645.340) (-2639.692) -- 0:00:41

      Average standard deviation of split frequencies: 0.000000

      765500 -- (-2641.388) [-2637.674] (-2640.225) (-2632.291) * [-2633.093] (-2636.571) (-2643.311) (-2637.172) -- 0:00:41
      766000 -- (-2647.462) [-2631.969] (-2634.221) (-2639.992) * (-2636.818) (-2630.186) (-2636.652) [-2638.849] -- 0:00:41
      766500 -- [-2638.022] (-2636.705) (-2634.905) (-2634.705) * (-2642.322) (-2634.082) [-2637.493] (-2640.833) -- 0:00:41
      767000 -- (-2636.074) (-2642.007) (-2638.827) [-2637.304] * (-2644.227) (-2637.696) [-2638.907] (-2640.420) -- 0:00:41
      767500 -- [-2634.232] (-2638.458) (-2634.773) (-2632.983) * (-2635.717) (-2636.776) [-2635.176] (-2647.709) -- 0:00:41
      768000 -- (-2638.539) [-2634.110] (-2634.478) (-2639.588) * (-2635.349) [-2631.711] (-2632.717) (-2642.857) -- 0:00:41
      768500 -- (-2638.622) [-2631.928] (-2637.437) (-2637.384) * (-2640.138) [-2638.448] (-2637.406) (-2646.543) -- 0:00:40
      769000 -- (-2635.150) [-2633.613] (-2637.590) (-2639.358) * [-2637.949] (-2635.612) (-2633.172) (-2638.819) -- 0:00:40
      769500 -- (-2635.642) (-2637.995) (-2638.237) [-2631.265] * (-2632.937) (-2635.910) [-2635.697] (-2638.732) -- 0:00:41
      770000 -- [-2635.385] (-2639.136) (-2638.041) (-2638.927) * (-2635.222) [-2634.517] (-2638.266) (-2631.439) -- 0:00:40

      Average standard deviation of split frequencies: 0.000000

      770500 -- (-2640.170) (-2631.940) [-2633.572] (-2638.394) * [-2631.108] (-2637.921) (-2634.743) (-2642.289) -- 0:00:40
      771000 -- (-2639.535) (-2634.161) [-2635.814] (-2641.043) * [-2637.864] (-2640.730) (-2634.878) (-2633.814) -- 0:00:40
      771500 -- (-2636.556) (-2641.060) [-2633.211] (-2641.319) * (-2637.234) (-2639.210) (-2636.893) [-2636.477] -- 0:00:40
      772000 -- (-2636.242) (-2641.971) (-2637.949) [-2633.441] * [-2629.943] (-2637.138) (-2638.869) (-2634.113) -- 0:00:40
      772500 -- (-2640.691) [-2638.076] (-2630.837) (-2640.702) * [-2634.080] (-2632.025) (-2641.367) (-2637.049) -- 0:00:40
      773000 -- [-2634.010] (-2636.406) (-2635.834) (-2635.796) * (-2636.332) [-2642.330] (-2632.018) (-2634.190) -- 0:00:40
      773500 -- [-2633.853] (-2637.999) (-2636.935) (-2637.911) * (-2638.687) (-2634.561) [-2633.624] (-2633.061) -- 0:00:40
      774000 -- [-2638.220] (-2639.423) (-2636.114) (-2635.099) * (-2635.585) [-2635.754] (-2637.169) (-2638.202) -- 0:00:40
      774500 -- (-2630.805) [-2631.709] (-2637.212) (-2636.422) * [-2633.113] (-2633.514) (-2644.764) (-2636.754) -- 0:00:39
      775000 -- [-2632.100] (-2631.346) (-2636.672) (-2639.248) * (-2634.085) [-2633.949] (-2636.754) (-2639.029) -- 0:00:39

      Average standard deviation of split frequencies: 0.000000

      775500 -- (-2634.836) (-2634.624) [-2634.596] (-2639.680) * [-2634.824] (-2642.038) (-2635.952) (-2638.769) -- 0:00:39
      776000 -- (-2645.659) (-2635.255) [-2632.071] (-2636.465) * [-2633.504] (-2633.081) (-2633.114) (-2636.821) -- 0:00:39
      776500 -- [-2637.166] (-2639.340) (-2640.129) (-2641.325) * [-2634.337] (-2634.342) (-2637.602) (-2643.907) -- 0:00:39
      777000 -- [-2634.153] (-2633.860) (-2635.453) (-2637.505) * (-2641.751) [-2636.571] (-2638.199) (-2638.029) -- 0:00:39
      777500 -- [-2638.550] (-2636.510) (-2637.541) (-2635.028) * (-2636.443) [-2636.100] (-2631.802) (-2635.849) -- 0:00:39
      778000 -- (-2636.856) (-2634.751) [-2636.743] (-2636.410) * (-2635.115) [-2638.771] (-2636.121) (-2641.188) -- 0:00:39
      778500 -- (-2644.677) (-2634.668) [-2634.479] (-2640.517) * (-2638.581) (-2637.777) (-2640.358) [-2636.573] -- 0:00:39
      779000 -- [-2636.092] (-2636.164) (-2630.851) (-2643.019) * [-2631.367] (-2631.231) (-2643.681) (-2635.353) -- 0:00:39
      779500 -- [-2639.041] (-2633.043) (-2634.060) (-2642.842) * (-2636.888) [-2636.680] (-2636.381) (-2632.798) -- 0:00:39
      780000 -- (-2638.975) [-2635.137] (-2636.179) (-2640.715) * (-2633.848) (-2636.628) (-2637.217) [-2631.402] -- 0:00:38

      Average standard deviation of split frequencies: 0.000000

      780500 -- [-2639.985] (-2638.467) (-2636.508) (-2637.012) * (-2632.513) (-2636.909) (-2636.609) [-2636.612] -- 0:00:38
      781000 -- (-2636.574) [-2638.935] (-2635.198) (-2643.366) * (-2639.591) (-2638.835) (-2633.692) [-2639.345] -- 0:00:38
      781500 -- (-2630.035) [-2632.564] (-2637.092) (-2642.907) * [-2637.827] (-2642.369) (-2633.029) (-2638.818) -- 0:00:38
      782000 -- (-2638.514) (-2631.516) [-2636.230] (-2632.544) * (-2645.138) [-2633.226] (-2636.906) (-2638.529) -- 0:00:38
      782500 -- (-2635.343) (-2633.604) [-2637.079] (-2634.219) * (-2636.835) (-2637.937) (-2633.407) [-2641.132] -- 0:00:38
      783000 -- (-2637.982) (-2638.201) [-2633.805] (-2638.643) * (-2639.738) (-2632.242) (-2631.708) [-2636.710] -- 0:00:38
      783500 -- (-2634.401) [-2641.475] (-2639.720) (-2635.620) * (-2633.033) [-2637.748] (-2639.394) (-2633.376) -- 0:00:38
      784000 -- (-2637.368) [-2643.047] (-2642.149) (-2636.604) * [-2632.407] (-2640.335) (-2638.537) (-2638.127) -- 0:00:38
      784500 -- (-2644.752) (-2635.845) (-2635.967) [-2638.832] * (-2639.266) (-2634.982) [-2633.832] (-2637.513) -- 0:00:38
      785000 -- [-2639.003] (-2637.885) (-2634.673) (-2633.533) * (-2636.316) [-2634.827] (-2638.932) (-2641.330) -- 0:00:38

      Average standard deviation of split frequencies: 0.000000

      785500 -- [-2631.885] (-2635.489) (-2633.650) (-2638.063) * [-2633.520] (-2643.350) (-2640.174) (-2638.284) -- 0:00:37
      786000 -- (-2634.185) (-2636.191) (-2631.513) [-2635.987] * (-2637.977) (-2642.470) (-2633.301) [-2637.095] -- 0:00:37
      786500 -- (-2634.308) (-2631.485) (-2636.268) [-2633.712] * (-2639.309) (-2638.386) (-2639.605) [-2640.289] -- 0:00:38
      787000 -- (-2634.410) (-2638.013) [-2633.495] (-2633.708) * (-2638.443) (-2637.067) (-2635.431) [-2631.559] -- 0:00:37
      787500 -- (-2633.464) [-2630.185] (-2634.605) (-2639.432) * (-2638.148) (-2638.475) (-2636.415) [-2635.644] -- 0:00:37
      788000 -- (-2634.948) (-2633.013) [-2633.762] (-2637.592) * (-2636.370) [-2636.423] (-2638.377) (-2635.784) -- 0:00:37
      788500 -- (-2632.580) [-2633.501] (-2632.604) (-2636.196) * (-2637.572) (-2634.072) [-2636.734] (-2637.471) -- 0:00:37
      789000 -- (-2632.683) (-2637.313) [-2632.666] (-2639.782) * [-2635.774] (-2633.532) (-2634.305) (-2633.331) -- 0:00:37
      789500 -- (-2636.709) (-2637.100) [-2641.753] (-2638.952) * [-2634.978] (-2634.070) (-2634.191) (-2633.651) -- 0:00:37
      790000 -- (-2636.622) (-2635.604) (-2634.221) [-2633.141] * [-2636.337] (-2635.659) (-2637.593) (-2638.475) -- 0:00:37

      Average standard deviation of split frequencies: 0.000000

      790500 -- (-2643.129) (-2636.103) [-2641.317] (-2633.807) * (-2637.870) (-2637.618) (-2636.486) [-2634.031] -- 0:00:37
      791000 -- [-2633.994] (-2632.518) (-2642.391) (-2637.079) * [-2641.022] (-2639.454) (-2636.817) (-2632.646) -- 0:00:36
      791500 -- (-2633.424) (-2637.067) [-2632.809] (-2641.737) * (-2636.030) (-2636.811) [-2634.096] (-2637.144) -- 0:00:36
      792000 -- (-2635.074) [-2635.996] (-2635.720) (-2635.734) * (-2637.207) (-2636.915) (-2636.246) [-2633.229] -- 0:00:37
      792500 -- (-2638.555) [-2635.683] (-2634.223) (-2633.600) * (-2636.017) [-2634.194] (-2640.302) (-2634.637) -- 0:00:36
      793000 -- (-2634.202) (-2640.127) [-2632.286] (-2633.919) * (-2644.568) (-2636.229) [-2633.680] (-2638.636) -- 0:00:36
      793500 -- (-2641.239) [-2634.579] (-2635.893) (-2640.813) * (-2636.450) [-2633.463] (-2638.955) (-2634.650) -- 0:00:36
      794000 -- [-2637.050] (-2635.286) (-2633.775) (-2631.276) * (-2632.872) (-2631.631) [-2636.046] (-2639.376) -- 0:00:36
      794500 -- [-2634.410] (-2635.314) (-2636.698) (-2633.041) * (-2635.591) (-2637.752) [-2636.873] (-2633.643) -- 0:00:36
      795000 -- (-2634.773) (-2630.716) [-2631.896] (-2638.754) * (-2636.108) (-2639.656) [-2631.753] (-2629.839) -- 0:00:36

      Average standard deviation of split frequencies: 0.000000

      795500 -- (-2634.305) (-2636.883) [-2633.681] (-2635.054) * (-2634.151) (-2633.764) (-2634.300) [-2634.919] -- 0:00:36
      796000 -- [-2633.412] (-2641.675) (-2633.601) (-2647.882) * [-2633.780] (-2634.868) (-2637.720) (-2636.993) -- 0:00:36
      796500 -- [-2632.507] (-2634.651) (-2637.141) (-2632.666) * (-2637.512) [-2639.054] (-2637.019) (-2641.683) -- 0:00:36
      797000 -- (-2634.881) (-2636.989) [-2634.463] (-2638.456) * (-2636.006) (-2634.915) (-2637.279) [-2643.798] -- 0:00:35
      797500 -- (-2637.198) (-2635.644) [-2636.001] (-2635.677) * (-2635.641) (-2640.108) (-2638.031) [-2639.277] -- 0:00:35
      798000 -- (-2638.479) [-2630.353] (-2636.536) (-2633.527) * (-2636.165) (-2631.336) [-2634.785] (-2644.822) -- 0:00:35
      798500 -- [-2637.580] (-2638.408) (-2641.154) (-2631.516) * (-2634.415) (-2633.537) (-2631.448) [-2637.260] -- 0:00:35
      799000 -- (-2636.596) (-2636.621) [-2638.431] (-2633.518) * (-2634.895) (-2633.834) (-2640.236) [-2635.019] -- 0:00:35
      799500 -- (-2648.366) [-2633.718] (-2633.213) (-2638.919) * (-2636.184) (-2635.121) (-2637.404) [-2633.107] -- 0:00:35
      800000 -- (-2637.551) (-2638.912) [-2633.039] (-2632.359) * [-2635.549] (-2629.124) (-2641.499) (-2632.940) -- 0:00:35

      Average standard deviation of split frequencies: 0.000000

      800500 -- (-2636.611) (-2637.278) (-2641.102) [-2640.596] * (-2630.084) [-2630.155] (-2632.643) (-2634.645) -- 0:00:35
      801000 -- (-2636.914) [-2631.753] (-2637.882) (-2635.116) * (-2633.563) (-2636.735) (-2632.134) [-2633.920] -- 0:00:35
      801500 -- (-2637.893) (-2638.417) (-2633.595) [-2636.721] * [-2636.514] (-2633.649) (-2636.720) (-2641.890) -- 0:00:35
      802000 -- (-2633.702) (-2633.423) (-2633.144) [-2632.050] * (-2636.358) [-2636.011] (-2637.752) (-2641.831) -- 0:00:35
      802500 -- [-2639.352] (-2633.391) (-2638.018) (-2633.486) * (-2637.977) (-2632.495) (-2639.592) [-2641.326] -- 0:00:34
      803000 -- (-2636.078) (-2635.681) [-2636.401] (-2636.079) * (-2642.421) (-2637.234) (-2635.246) [-2635.586] -- 0:00:34
      803500 -- (-2635.103) (-2633.071) (-2633.854) [-2637.565] * (-2639.647) (-2633.680) [-2635.715] (-2636.902)