--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Nov 24 15:44:52 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/330/Nuf2-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2632.69 -2642.17 2 -2632.80 -2643.27 -------------------------------------- TOTAL -2632.74 -2642.86 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.292868 0.001361 0.224653 0.367981 0.289951 986.92 1073.57 1.000 r(A<->C){all} 0.050930 0.000446 0.009480 0.091528 0.049243 828.56 962.88 1.000 r(A<->G){all} 0.230984 0.001446 0.160011 0.307104 0.229374 943.49 980.67 1.001 r(A<->T){all} 0.196709 0.001489 0.124742 0.274732 0.194372 960.58 1031.38 1.000 r(C<->G){all} 0.074950 0.000425 0.036467 0.114605 0.072965 1077.02 1146.95 1.000 r(C<->T){all} 0.401968 0.002854 0.293142 0.498728 0.400924 859.86 899.34 1.001 r(G<->T){all} 0.044459 0.000424 0.007163 0.084166 0.041969 956.47 1055.02 1.000 pi(A){all} 0.304265 0.000159 0.280239 0.329815 0.304430 1079.01 1092.81 1.000 pi(C){all} 0.240237 0.000140 0.217410 0.262573 0.240090 1243.29 1305.74 1.000 pi(G){all} 0.268793 0.000150 0.245567 0.293464 0.268783 1224.14 1362.57 1.001 pi(T){all} 0.186705 0.000114 0.167092 0.207413 0.186623 1244.13 1295.38 1.000 alpha{1,2} 0.058569 0.001669 0.000154 0.133288 0.052753 885.29 1193.14 1.000 alpha{3} 2.072164 0.644669 0.758400 3.715849 1.941542 1269.79 1293.13 1.000 pinvar{all} 0.292851 0.009272 0.079044 0.459891 0.302357 1125.25 1200.08 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2545.585251 Model 2: PositiveSelection -2545.585251 Model 0: one-ratio -2549.397152 Model 3: discrete -2545.563025 Model 7: beta -2545.617532 Model 8: beta&w>1 -2545.578077 Model 0 vs 1 7.623802000000069 Model 2 vs 1 0.0 Model 8 vs 7 0.07891000000017812
>C1 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST >C2 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST >C3 MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST >C4 MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=395 C1 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR C2 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR C3 MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR C4 MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR **:*.******:*************.********:**********.:*** C1 LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP C2 LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP C3 LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP C4 MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP :*******:**.*******:**********************:*:***** C1 AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ C2 AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ C3 TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ C4 AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ :*******************:*****:******:***:**::*:*:**** C1 LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ C2 LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ C3 LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ C4 LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH *:****:**:******:*********************:*.:***: *: C1 GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE C2 SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE C3 TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE C4 NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE * :******:*****:*********************:******* *:* C1 HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN C2 HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN C3 HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN C4 HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN ***:*******.::****** :* **:****** ****::****** *** C1 YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR C2 YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR C3 YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR C4 YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR *** ****:***:**.* :*****.*********: .**::******** C1 KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST C2 KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST C3 KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST C4 KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST *******.: *:****:** ***** :*.*****.*****: *** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4740] Library Relaxation: Multi_proc [72] Relaxation Summary: [4740]--->[4740] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/330/Nuf2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.253 Mb, Max= 30.560 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST >C2 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST >C3 MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST >C4 MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST FORMAT of file /tmp/tmp7887021195037828782aln Not Supported[FATAL:T-COFFEE] >C1 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST >C2 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST >C3 MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST >C4 MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:395 S:100 BS:395 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 96.71 C1 C2 96.71 TOP 1 0 96.71 C2 C1 96.71 BOT 0 2 88.61 C1 C3 88.61 TOP 2 0 88.61 C3 C1 88.61 BOT 0 3 87.34 C1 C4 87.34 TOP 3 0 87.34 C4 C1 87.34 BOT 1 2 89.62 C2 C3 89.62 TOP 2 1 89.62 C3 C2 89.62 BOT 1 3 87.59 C2 C4 87.59 TOP 3 1 87.59 C4 C2 87.59 BOT 2 3 83.54 C3 C4 83.54 TOP 3 2 83.54 C4 C3 83.54 AVG 0 C1 * 90.89 AVG 1 C2 * 91.31 AVG 2 C3 * 87.26 AVG 3 C4 * 86.16 TOT TOT * 88.90 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCGTTATCAGTCGAAATTGAAAGGGTAATGGACCAGGGCAACTGCCT C2 ATGGCGTTATCAGTCGAAATTGAGAGGGTAATGGACCAGGGCAACTGCCT C3 ATGGCGTTTTCAGCCGAAATTGAGAGGGTGATGGACCAGGGCAACTGTCT C4 ATGGCGCTTTCAGCCGAAATAGAGAGGGTTATGAACCAGGGCAACTGCCT ****** *:**** ******:**.***** ***.************* ** C1 GATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACCGAGC C2 AATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACGGAGC C3 GATGCCAGACATCAACATTTGCCAGAGCGACTTGGCCAATCCCACCGAAC C4 GATGCCCGACATCAACATTTGCCAGAACGACTTGGCCAATCCCACCGAGC .*****.******** ** *****.*.****************** **.* C1 CCATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC C2 CGATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC C3 CATTTGTCACCAAGATCATGGTGCACTATTTGCGGTGTTACGGTTTCCGC C4 CCCTTGTCACCAAGATCATGGTGCACTATCTGCGTAGTTTCGGTTTCCGC * ************************** **** :***:*** ** *** C1 CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA C2 CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA C3 CTGGAGCCGCCATATAAGATTGGCTCCGAACTCGGCCACTCGTCGCGGGA C4 ATGGAGCCGCCCTATAAGATTGGCACCGAACTCGCCCACTCATCGCGCGA .**********.************:********* *****.***** ** C1 GGCGCGCGTCTTTCTTATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC C2 GGCGCGCGTCTTTCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC C3 GGCGCGCGTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC C4 GGCGCGCCTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC ******* **** ** ***************************** **** C1 AGATCAGCTTTCCCAACAAGACGTACACCTATATGGACATAATTAAACCA C2 AGATCAGCTTTCCCAACAAGACCTACACCTATATGGACATAATTAAACCA C3 AGATCAGCTTTCCCAACAAGACCTACTCCTATGTGGATATTATAAAACCA C4 AGATCAGCTTTCCCAACAAGACCTACACCTATGTGGATATCATAAAGCCA ********************** ***:*****.**** ** **:**.*** C1 GCTGTTAAAAAAACGCTCGCCACGCTGAGCTACCTTTTCAACCATCTGGC C2 GCTGTTAAAAAAACGCTCGCCACTCTGAGCTACCTTTTCAACCACCTGGC C3 ACTGTTAAAAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC C4 GCTGTTAAGAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC .*******.******** ** ** ******************** ***** C1 CTACTACAAGGTGTTCAAAAAGAAGGTGCTGGGACCTGTAGAGGAGGCCA C2 CTACTACAAGGTGTTTAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA C3 CTACTACAAAATGTTCAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA C4 CTACTACAAAGTGTTCAAAAAGAAGGTGGTGGGGCCTGTAGAGGAGGCCC *********..**** ************ ****.**:************. C1 TTAAGCTAAAGGATTCGCTGACCGCCGAGGTGAAGGCCAAAAGTCAACAG C2 TTAAGCTAAAGGATTCGCTGACAGCCGAGGTGAAGGCCAAGAGTCAACAG C3 TTAAGCTTAAAGAATCGCTGACAACCGAGGTGAAGGCCAAGAGTCAACAG C4 TTAAGCTGAAGGACTCGCTGGCTGCCGAGCTGAAGACCAAGAGTCAACAG ******* **.** ******.* .***** *****.****.********* C1 CTGGAGCAATGCAGCCAGAAGACGAAGGATTGCGAAGTGGCCATAAACAA C2 CTGGAGCAATGCAGTCAGAAGACGAAGGATTGCGAAGTGGCCATCAACAA C3 CTGGATCAATGCAGTCAGAAGACCAAGGATTGCGAAGTGGCCATCAACCA C4 CTGGAGCAGTGCAGTCAGAACACCAAGGAATGCGAAGTGGCCATCAACCA ***** **.***** ***** ** *****:**************.***.* C1 ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA C2 ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA C3 ACTCAAAAAGGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA C4 ACTTAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCATTGAAAA *** **.**.********************************:*****.* C1 AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATTGAGCAGCAGCAG C2 AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATCGAGCAGCAGCAG C3 AGTCCTGCAGCGAGCATGAAAGCACTCTGGAACTTCTCGCACAGCAGCAA C4 AGTCCTGCAGCGAGCAGGAAAACGCTCTGGAACTTCTCGAGCTGCAGCAT ******* ******** ****.*.********** .* *..*:****** C1 GGTGAGCTGGACAAACGCATCGGTCACTGGGAACAGCTAGTGGTGGAGGA C2 AGTGAGCTGGACAAACGCATCGGTCACTGGGAGCAGCTAGTGGTGGAGGA C3 ACTGAGCAGGAGAAACGTATCGGTCACTGGAAGCAGCTAGTGGTAGAGGA C4 AATGAGTTGGACAAACGTATAGGACACTGGGAGCAGCTAGTGGTGGAGGA . **** :*** ***** **.**:******.*.***********.***** C1 CAGTCAAGTGACAGAGCTGCGAGAGAAAATTAAGAGCGCATCGTCGCATG C2 CAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCGTCGCATG C3 CAGCCAAGTGACTGAGCTGCGAGAGAAGATTAAGAGTGCATCCTCGCATG C4 GAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCCTCGCATG ** ********:**.***********.******** ***** ******* C1 TCGAGAGCTGCAAGACGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA C2 TCGAGAGCTGCAAGGCGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA C3 TGGAGAGCTGCAAGGCGGAGCTGGCCAGCAAAAAACAGGAGACGAATGAA C4 TCGAGAGCTGCAAGACGGAGCTGGCCAGCAAAAAACAGGAGACGAAAGAA * ************.************* **********:******:*** C1 CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA C2 CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA C3 CACCGCCGGATAATTGAAAACAGTCAACATATAGCCACCGCTTTAGAGAA C4 CATCGCCGGATAATCGAAAACAGCCAACACATAGTCGCCTCCTTGGAGAA ** ********.** ******** ***** **** *.** * **.***** C1 GGCCACGGCTGTGCTTTCGCTGTGCAAGGTGGATGATTACAAAGAGAGCT C2 GGCCACGGCTGTGCTTTCGCAGTGCAAAGTGGATGATTACAAAGAGAGCT C3 GGCCACGGCTATGATTTCGCTGTGCAAACTGGATGACTACAAGGAGAGCT C4 AGCCACGGCTGCGCTTTCGCTGTGCAAAGTGGATGACTACAAGGAGAGCT .*********. *.******:******. ******* *****.******* C1 TCAAGCAGCTGGAGGCAGTGGAAAAGCAGTTGCCCACCTGTAAAGTTAAT C2 TGAAGCAGCTGGAGGCAGTGGAGAAGCAGTTGCCCACCTGGAAGGTTAAT C3 GCAAGCAGCTGGAGACGATGGAGAAGCAGTTGCCCACCTGCAAGGTAAAT C4 TCAAGCAGCTGGAGGCGGTGGAGAAGCAGTTGCCCACCTGGAAGGTCAAT ************.*..****.***************** **.** *** C1 TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT C2 TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT C3 TATCAGAAGCGCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT C4 TATCAGAAGCGCCTTCAGGATGCAAAGGCCAAGAAGGAGGAACTCGGTCT ********** *************.*********** ********* *** C1 TTGTGCACATCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC C2 TTGTGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC C3 TCGAGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAACC C4 TTGTGATCAGCGGTACGAGGAAAGAAGCCAGGAAAACGATGCCGAGAATC * *:*.:** ****************.********************* * C1 ACAAGGTGCAAAATGAACTCAAAAAGCTGCAGGTCGATGTTGAGGATCGC C2 ACAAGCTGCAAAACGAACTCAAACAGCTGCAGGTTGATGTTGAGGATCGC C3 ACAAGCTGCATAGCGAACTCAATCAGCTGCAGGTCGACGTTGAGGATCGC C4 ACAAGCTGCTTAACGAACTCAAACAGCTGCAGGTCGATGTTGAGGATCGC ***** ***::*. ********:.********** ** ************ C1 AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCA C2 AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCG C3 AAGAAACGCCTGGAGGATCTAAGTAATACCTTGATCGAGCTTGACCAGCA C4 AAGAAACGCCTAGAGGATCTGAGTAAAAACTTGGTCGAGCTTGACCAGCG ******** **.********.*.***:..****.*******:*******. C1 AAATTTGGAGCAAGATCAGCTATATGCCATATTAAATGAGCAAATCCATG C2 AAATTTGGAGCAAGATCAGTTATATGCCATATTAAGTGAGCAAATCCATG C3 AAATTTGGAGCAAGATCAGCTGTACGACATATTAAGTGAGCAAATCCACG C4 AAATTTGGGGCAAGATCAGCTGTATGCCATGTTAAATGAGCAAATCCATG ********.********** *.** *.***.****.************ * C1 AGGTTCTCGGACAAAACTGGCAGATGAATTCCACT C2 AGGCTCTCGGCCAAAACTGGCAGACGAATTCCACT C3 AGGCTCTCGGTCAAAACTGGCAGATAAATTCCACT C4 AGGCTCTTGGCCAAAACTGGCATATGAATTCCACT *** *** ** *********** * .********* >C1 ATGGCGTTATCAGTCGAAATTGAAAGGGTAATGGACCAGGGCAACTGCCT GATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACCGAGC CCATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA GGCGCGCGTCTTTCTTATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC AGATCAGCTTTCCCAACAAGACGTACACCTATATGGACATAATTAAACCA GCTGTTAAAAAAACGCTCGCCACGCTGAGCTACCTTTTCAACCATCTGGC CTACTACAAGGTGTTCAAAAAGAAGGTGCTGGGACCTGTAGAGGAGGCCA TTAAGCTAAAGGATTCGCTGACCGCCGAGGTGAAGGCCAAAAGTCAACAG CTGGAGCAATGCAGCCAGAAGACGAAGGATTGCGAAGTGGCCATAAACAA ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATTGAGCAGCAGCAG GGTGAGCTGGACAAACGCATCGGTCACTGGGAACAGCTAGTGGTGGAGGA CAGTCAAGTGACAGAGCTGCGAGAGAAAATTAAGAGCGCATCGTCGCATG TCGAGAGCTGCAAGACGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA GGCCACGGCTGTGCTTTCGCTGTGCAAGGTGGATGATTACAAAGAGAGCT TCAAGCAGCTGGAGGCAGTGGAAAAGCAGTTGCCCACCTGTAAAGTTAAT TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT TTGTGCACATCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC ACAAGGTGCAAAATGAACTCAAAAAGCTGCAGGTCGATGTTGAGGATCGC AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCA AAATTTGGAGCAAGATCAGCTATATGCCATATTAAATGAGCAAATCCATG AGGTTCTCGGACAAAACTGGCAGATGAATTCCACT >C2 ATGGCGTTATCAGTCGAAATTGAGAGGGTAATGGACCAGGGCAACTGCCT AATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACGGAGC CGATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA GGCGCGCGTCTTTCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC AGATCAGCTTTCCCAACAAGACCTACACCTATATGGACATAATTAAACCA GCTGTTAAAAAAACGCTCGCCACTCTGAGCTACCTTTTCAACCACCTGGC CTACTACAAGGTGTTTAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA TTAAGCTAAAGGATTCGCTGACAGCCGAGGTGAAGGCCAAGAGTCAACAG CTGGAGCAATGCAGTCAGAAGACGAAGGATTGCGAAGTGGCCATCAACAA ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATCGAGCAGCAGCAG AGTGAGCTGGACAAACGCATCGGTCACTGGGAGCAGCTAGTGGTGGAGGA CAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCGTCGCATG TCGAGAGCTGCAAGGCGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA GGCCACGGCTGTGCTTTCGCAGTGCAAAGTGGATGATTACAAAGAGAGCT TGAAGCAGCTGGAGGCAGTGGAGAAGCAGTTGCCCACCTGGAAGGTTAAT TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT TTGTGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC ACAAGCTGCAAAACGAACTCAAACAGCTGCAGGTTGATGTTGAGGATCGC AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCG AAATTTGGAGCAAGATCAGTTATATGCCATATTAAGTGAGCAAATCCATG AGGCTCTCGGCCAAAACTGGCAGACGAATTCCACT >C3 ATGGCGTTTTCAGCCGAAATTGAGAGGGTGATGGACCAGGGCAACTGTCT GATGCCAGACATCAACATTTGCCAGAGCGACTTGGCCAATCCCACCGAAC CATTTGTCACCAAGATCATGGTGCACTATTTGCGGTGTTACGGTTTCCGC CTGGAGCCGCCATATAAGATTGGCTCCGAACTCGGCCACTCGTCGCGGGA GGCGCGCGTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC AGATCAGCTTTCCCAACAAGACCTACTCCTATGTGGATATTATAAAACCA ACTGTTAAAAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC CTACTACAAAATGTTCAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA TTAAGCTTAAAGAATCGCTGACAACCGAGGTGAAGGCCAAGAGTCAACAG CTGGATCAATGCAGTCAGAAGACCAAGGATTGCGAAGTGGCCATCAACCA ACTCAAAAAGGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA AGTCCTGCAGCGAGCATGAAAGCACTCTGGAACTTCTCGCACAGCAGCAA ACTGAGCAGGAGAAACGTATCGGTCACTGGAAGCAGCTAGTGGTAGAGGA CAGCCAAGTGACTGAGCTGCGAGAGAAGATTAAGAGTGCATCCTCGCATG TGGAGAGCTGCAAGGCGGAGCTGGCCAGCAAAAAACAGGAGACGAATGAA CACCGCCGGATAATTGAAAACAGTCAACATATAGCCACCGCTTTAGAGAA GGCCACGGCTATGATTTCGCTGTGCAAACTGGATGACTACAAGGAGAGCT GCAAGCAGCTGGAGACGATGGAGAAGCAGTTGCCCACCTGCAAGGTAAAT TATCAGAAGCGCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT TCGAGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAACC ACAAGCTGCATAGCGAACTCAATCAGCTGCAGGTCGACGTTGAGGATCGC AAGAAACGCCTGGAGGATCTAAGTAATACCTTGATCGAGCTTGACCAGCA AAATTTGGAGCAAGATCAGCTGTACGACATATTAAGTGAGCAAATCCACG AGGCTCTCGGTCAAAACTGGCAGATAAATTCCACT >C4 ATGGCGCTTTCAGCCGAAATAGAGAGGGTTATGAACCAGGGCAACTGCCT GATGCCCGACATCAACATTTGCCAGAACGACTTGGCCAATCCCACCGAGC CCCTTGTCACCAAGATCATGGTGCACTATCTGCGTAGTTTCGGTTTCCGC ATGGAGCCGCCCTATAAGATTGGCACCGAACTCGCCCACTCATCGCGCGA GGCGCGCCTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC AGATCAGCTTTCCCAACAAGACCTACACCTATGTGGATATCATAAAGCCA GCTGTTAAGAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC CTACTACAAAGTGTTCAAAAAGAAGGTGGTGGGGCCTGTAGAGGAGGCCC TTAAGCTGAAGGACTCGCTGGCTGCCGAGCTGAAGACCAAGAGTCAACAG CTGGAGCAGTGCAGTCAGAACACCAAGGAATGCGAAGTGGCCATCAACCA ACTTAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCATTGAAAA AGTCCTGCAGCGAGCAGGAAAACGCTCTGGAACTTCTCGAGCTGCAGCAT AATGAGTTGGACAAACGTATAGGACACTGGGAGCAGCTAGTGGTGGAGGA GAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCCTCGCATG TCGAGAGCTGCAAGACGGAGCTGGCCAGCAAAAAACAGGAGACGAAAGAA CATCGCCGGATAATCGAAAACAGCCAACACATAGTCGCCTCCTTGGAGAA AGCCACGGCTGCGCTTTCGCTGTGCAAAGTGGATGACTACAAGGAGAGCT TCAAGCAGCTGGAGGCGGTGGAGAAGCAGTTGCCCACCTGGAAGGTCAAT TATCAGAAGCGCCTTCAGGATGCAAAGGCCAAGAAGGAGGAACTCGGTCT TTGTGATCAGCGGTACGAGGAAAGAAGCCAGGAAAACGATGCCGAGAATC ACAAGCTGCTTAACGAACTCAAACAGCTGCAGGTCGATGTTGAGGATCGC AAGAAACGCCTAGAGGATCTGAGTAAAAACTTGGTCGAGCTTGACCAGCG AAATTTGGGGCAAGATCAGCTGTATGCCATGTTAAATGAGCAAATCCATG AGGCTCTTGGCCAAAACTGGCATATGAATTCCACT >C1 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST >C2 MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST >C3 MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST >C4 MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1185 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480002065 Setting output file names to "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1762552316 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0013591831 Seed = 1446211906 Swapseed = 1480002065 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 28 unique site patterns Division 2 has 27 unique site patterns Division 3 has 55 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2970.288287 -- -26.620141 Chain 2 -- -2967.633263 -- -26.620141 Chain 3 -- -2970.288287 -- -26.620141 Chain 4 -- -2873.358094 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2970.288287 -- -26.620141 Chain 2 -- -2967.633263 -- -26.620141 Chain 3 -- -2967.633263 -- -26.620141 Chain 4 -- -2967.633263 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2970.288] (-2967.633) (-2970.288) (-2873.358) * [-2970.288] (-2967.633) (-2967.633) (-2967.633) 500 -- (-2687.970) (-2667.577) (-2668.826) [-2674.652] * (-2684.571) (-2678.587) (-2683.423) [-2670.879] -- 0:00:00 1000 -- (-2673.887) [-2652.788] (-2657.069) (-2659.025) * (-2673.949) [-2664.485] (-2670.629) (-2661.376) -- 0:00:00 1500 -- (-2661.957) (-2643.096) [-2649.889] (-2658.673) * (-2661.806) (-2656.027) (-2668.599) [-2656.417] -- 0:00:00 2000 -- (-2653.250) (-2645.773) [-2651.714] (-2645.252) * (-2655.516) [-2650.992] (-2668.350) (-2646.894) -- 0:00:00 2500 -- [-2643.651] (-2645.960) (-2645.873) (-2645.535) * (-2646.135) [-2648.054] (-2659.226) (-2642.101) -- 0:00:00 3000 -- (-2643.956) [-2633.575] (-2644.564) (-2641.461) * (-2646.176) (-2645.794) (-2654.042) [-2642.679] -- 0:00:00 3500 -- [-2634.455] (-2634.575) (-2635.952) (-2642.991) * (-2644.546) (-2649.585) (-2644.636) [-2641.722] -- 0:04:44 4000 -- (-2631.521) (-2636.519) (-2638.524) [-2635.211] * (-2641.337) (-2647.059) (-2636.975) [-2644.998] -- 0:04:09 4500 -- (-2634.914) [-2649.456] (-2634.014) (-2631.336) * (-2634.925) (-2651.273) (-2640.161) [-2639.432] -- 0:03:41 5000 -- (-2632.427) (-2648.275) (-2634.466) [-2633.847] * [-2636.928] (-2644.538) (-2645.036) (-2641.255) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- [-2640.066] (-2638.159) (-2635.242) (-2639.688) * [-2634.814] (-2634.980) (-2640.601) (-2644.930) -- 0:03:00 6000 -- [-2637.191] (-2648.697) (-2634.255) (-2636.836) * (-2635.042) (-2641.014) [-2638.231] (-2647.639) -- 0:02:45 6500 -- (-2635.271) (-2635.873) [-2632.417] (-2640.188) * (-2643.318) [-2636.383] (-2640.733) (-2633.807) -- 0:02:32 7000 -- (-2638.833) (-2635.321) (-2632.916) [-2631.991] * (-2640.246) [-2635.177] (-2634.023) (-2639.506) -- 0:02:21 7500 -- (-2634.919) [-2635.849] (-2640.993) (-2633.144) * (-2635.513) (-2631.356) [-2638.784] (-2632.231) -- 0:02:12 8000 -- (-2637.261) (-2634.574) (-2632.630) [-2631.739] * [-2635.225] (-2633.365) (-2640.070) (-2641.230) -- 0:02:04 8500 -- (-2644.533) [-2629.221] (-2633.029) (-2635.148) * (-2633.794) (-2653.191) [-2633.129] (-2635.404) -- 0:01:56 9000 -- (-2633.282) [-2636.863] (-2638.635) (-2634.935) * [-2638.602] (-2640.743) (-2643.784) (-2637.118) -- 0:03:40 9500 -- (-2638.507) [-2636.853] (-2637.224) (-2636.002) * [-2638.223] (-2641.887) (-2641.541) (-2631.503) -- 0:03:28 10000 -- [-2637.999] (-2638.742) (-2643.013) (-2634.292) * [-2639.019] (-2635.174) (-2642.899) (-2635.524) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- (-2639.043) [-2638.643] (-2634.704) (-2631.164) * (-2640.367) [-2638.981] (-2633.583) (-2637.283) -- 0:03:08 11000 -- (-2640.814) (-2641.430) (-2635.746) [-2636.566] * [-2634.316] (-2638.269) (-2635.536) (-2640.967) -- 0:02:59 11500 -- (-2636.858) (-2641.860) [-2635.796] (-2637.541) * (-2633.765) [-2634.146] (-2635.301) (-2642.088) -- 0:02:51 12000 -- [-2636.340] (-2641.927) (-2634.760) (-2635.611) * (-2634.424) (-2630.996) [-2632.247] (-2642.706) -- 0:02:44 12500 -- (-2638.122) [-2634.804] (-2637.194) (-2641.493) * [-2634.309] (-2635.897) (-2639.743) (-2644.624) -- 0:02:38 13000 -- (-2636.970) (-2640.396) [-2634.781] (-2649.285) * (-2637.545) [-2637.209] (-2636.784) (-2640.521) -- 0:02:31 13500 -- [-2634.949] (-2633.435) (-2643.840) (-2638.515) * (-2639.747) [-2639.606] (-2637.226) (-2637.283) -- 0:02:26 14000 -- (-2634.445) (-2636.967) [-2635.401] (-2638.800) * [-2633.061] (-2630.705) (-2632.803) (-2638.563) -- 0:02:20 14500 -- (-2639.914) (-2639.099) [-2633.950] (-2631.142) * (-2634.843) [-2633.268] (-2638.850) (-2642.498) -- 0:03:23 15000 -- (-2639.566) (-2638.546) [-2632.712] (-2631.502) * (-2633.825) (-2632.677) (-2637.277) [-2636.029] -- 0:03:17 Average standard deviation of split frequencies: 0.000000 15500 -- (-2638.258) (-2634.689) (-2634.614) [-2632.611] * (-2633.965) (-2635.721) [-2634.877] (-2635.299) -- 0:03:10 16000 -- (-2640.974) (-2645.318) (-2636.699) [-2631.499] * (-2639.790) (-2634.884) (-2640.259) [-2635.759] -- 0:03:04 16500 -- [-2640.304] (-2640.249) (-2640.202) (-2632.067) * (-2644.932) [-2633.217] (-2636.263) (-2634.854) -- 0:02:58 17000 -- (-2639.848) (-2639.924) [-2634.636] (-2638.613) * (-2637.875) [-2631.200] (-2637.557) (-2638.504) -- 0:02:53 17500 -- (-2639.235) (-2640.852) (-2633.202) [-2634.805] * (-2633.535) [-2634.874] (-2638.292) (-2632.604) -- 0:02:48 18000 -- [-2633.663] (-2635.737) (-2639.831) (-2635.428) * [-2632.802] (-2637.044) (-2645.167) (-2636.728) -- 0:02:43 18500 -- [-2635.548] (-2636.320) (-2633.291) (-2635.847) * [-2636.115] (-2640.289) (-2641.442) (-2635.262) -- 0:02:39 19000 -- (-2645.876) [-2636.515] (-2634.689) (-2632.333) * [-2641.638] (-2638.100) (-2636.742) (-2637.006) -- 0:02:34 19500 -- (-2637.388) [-2629.073] (-2636.446) (-2633.064) * (-2636.034) (-2639.818) (-2640.334) [-2631.363] -- 0:02:30 20000 -- (-2633.591) (-2632.487) (-2634.310) [-2635.302] * [-2633.370] (-2634.432) (-2644.641) (-2633.609) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 20500 -- (-2636.822) (-2633.245) (-2632.566) [-2642.792] * (-2638.601) [-2632.789] (-2636.005) (-2637.977) -- 0:03:11 21000 -- (-2639.436) [-2634.684] (-2633.009) (-2634.706) * (-2640.815) [-2634.255] (-2633.641) (-2637.471) -- 0:03:06 21500 -- (-2643.866) (-2636.132) [-2638.532] (-2635.973) * (-2631.798) (-2632.035) [-2637.371] (-2635.191) -- 0:03:02 22000 -- (-2647.856) (-2634.413) [-2634.202] (-2639.565) * [-2635.444] (-2637.191) (-2638.527) (-2632.992) -- 0:02:57 22500 -- [-2641.891] (-2635.352) (-2633.755) (-2636.298) * (-2639.388) (-2641.107) (-2631.696) [-2636.209] -- 0:02:53 23000 -- [-2634.289] (-2634.101) (-2638.628) (-2635.528) * [-2634.479] (-2645.970) (-2634.857) (-2634.220) -- 0:02:49 23500 -- (-2638.151) [-2637.281] (-2635.865) (-2639.431) * (-2633.476) (-2639.189) [-2633.696] (-2635.264) -- 0:02:46 24000 -- [-2632.011] (-2637.006) (-2635.609) (-2633.235) * [-2642.197] (-2638.278) (-2635.540) (-2640.576) -- 0:02:42 24500 -- (-2632.250) [-2634.916] (-2633.626) (-2636.412) * (-2636.073) [-2634.572] (-2640.474) (-2635.782) -- 0:02:39 25000 -- (-2635.297) (-2637.692) (-2634.745) [-2633.997] * (-2638.470) (-2635.095) (-2641.831) [-2635.118] -- 0:02:36 Average standard deviation of split frequencies: 0.000000 25500 -- [-2636.366] (-2641.286) (-2640.054) (-2634.203) * (-2635.585) (-2640.081) [-2638.209] (-2636.427) -- 0:02:32 26000 -- [-2634.772] (-2643.134) (-2633.951) (-2635.971) * (-2632.986) (-2638.486) (-2639.894) [-2632.530] -- 0:03:07 26500 -- (-2635.154) (-2637.159) (-2639.689) [-2639.945] * (-2639.077) [-2636.746] (-2643.364) (-2643.548) -- 0:03:03 27000 -- (-2630.978) (-2636.971) [-2630.805] (-2639.816) * [-2633.848] (-2635.541) (-2642.423) (-2636.989) -- 0:03:00 27500 -- (-2640.889) [-2636.682] (-2632.162) (-2647.831) * (-2638.367) (-2635.397) (-2645.451) [-2631.644] -- 0:02:56 28000 -- [-2634.340] (-2628.673) (-2642.427) (-2639.529) * (-2637.147) [-2638.592] (-2642.923) (-2635.828) -- 0:02:53 28500 -- [-2634.685] (-2634.626) (-2637.373) (-2635.057) * [-2631.873] (-2638.694) (-2639.299) (-2634.796) -- 0:02:50 29000 -- [-2639.073] (-2635.481) (-2633.304) (-2641.089) * (-2631.728) (-2636.384) (-2644.085) [-2635.911] -- 0:02:47 29500 -- (-2639.177) (-2636.872) [-2630.608] (-2638.725) * (-2632.489) (-2635.624) (-2643.224) [-2636.685] -- 0:02:44 30000 -- (-2635.035) [-2633.688] (-2632.334) (-2638.398) * [-2630.565] (-2638.219) (-2639.842) (-2638.872) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 30500 -- (-2635.412) (-2634.966) [-2633.665] (-2639.034) * (-2634.082) [-2636.371] (-2644.397) (-2639.339) -- 0:02:38 31000 -- (-2630.865) (-2633.463) [-2634.816] (-2643.457) * (-2632.875) (-2632.065) [-2634.176] (-2643.550) -- 0:02:36 31500 -- [-2634.220] (-2636.393) (-2634.663) (-2638.680) * (-2634.456) (-2637.240) (-2637.857) [-2635.409] -- 0:03:04 32000 -- [-2633.362] (-2631.527) (-2632.764) (-2638.394) * (-2637.092) (-2637.622) (-2635.105) [-2638.568] -- 0:03:01 32500 -- [-2639.103] (-2637.927) (-2634.868) (-2637.071) * (-2633.378) (-2636.920) (-2639.140) [-2634.342] -- 0:02:58 33000 -- (-2636.040) [-2639.245] (-2637.626) (-2645.645) * (-2635.345) [-2637.415] (-2643.907) (-2635.595) -- 0:02:55 33500 -- (-2637.145) [-2639.886] (-2636.281) (-2634.811) * (-2632.582) [-2636.311] (-2641.807) (-2631.331) -- 0:02:53 34000 -- (-2635.208) (-2637.809) (-2641.826) [-2631.049] * (-2640.268) (-2635.305) [-2634.366] (-2635.624) -- 0:02:50 34500 -- [-2636.545] (-2638.613) (-2634.417) (-2632.627) * [-2635.238] (-2639.718) (-2630.148) (-2632.141) -- 0:02:47 35000 -- (-2636.589) (-2633.498) [-2638.045] (-2628.803) * [-2640.408] (-2640.607) (-2630.789) (-2640.597) -- 0:02:45 Average standard deviation of split frequencies: 0.000000 35500 -- (-2636.304) [-2633.620] (-2640.016) (-2633.290) * (-2636.191) [-2634.321] (-2639.905) (-2639.985) -- 0:02:43 36000 -- (-2632.570) [-2638.442] (-2641.506) (-2634.025) * (-2636.741) (-2637.341) [-2642.322] (-2636.287) -- 0:02:40 36500 -- (-2635.062) (-2636.721) [-2634.982] (-2634.045) * (-2636.547) (-2634.564) [-2633.017] (-2638.904) -- 0:02:38 37000 -- (-2633.893) (-2640.770) (-2636.768) [-2632.895] * (-2634.319) (-2633.033) [-2635.031] (-2638.289) -- 0:03:02 37500 -- (-2631.009) (-2632.749) (-2631.976) [-2635.785] * (-2633.226) [-2631.453] (-2635.126) (-2635.678) -- 0:02:59 38000 -- [-2636.107] (-2639.857) (-2637.836) (-2636.494) * (-2633.999) (-2636.125) [-2635.454] (-2636.728) -- 0:02:57 38500 -- (-2637.578) [-2638.517] (-2632.099) (-2643.699) * (-2631.190) (-2630.993) (-2636.236) [-2637.058] -- 0:02:54 39000 -- (-2637.449) (-2639.441) [-2631.292] (-2638.792) * (-2638.376) [-2637.639] (-2644.134) (-2636.267) -- 0:02:52 39500 -- (-2641.886) [-2637.284] (-2635.485) (-2635.641) * (-2632.505) (-2631.136) [-2635.927] (-2635.317) -- 0:02:50 40000 -- (-2640.631) (-2636.158) [-2637.846] (-2636.368) * (-2634.377) [-2631.863] (-2633.399) (-2636.553) -- 0:02:48 Average standard deviation of split frequencies: 0.000000 40500 -- (-2634.130) (-2640.848) [-2632.266] (-2636.477) * (-2635.692) (-2635.655) [-2636.326] (-2633.776) -- 0:02:45 41000 -- (-2635.799) (-2634.059) (-2640.625) [-2634.461] * [-2631.655] (-2637.660) (-2640.533) (-2636.829) -- 0:02:43 41500 -- (-2634.093) [-2638.810] (-2640.326) (-2638.679) * (-2636.866) (-2633.417) [-2631.031] (-2643.392) -- 0:02:41 42000 -- (-2636.173) [-2637.631] (-2637.150) (-2638.247) * (-2637.490) (-2642.901) (-2631.811) [-2637.302] -- 0:02:39 42500 -- (-2635.917) (-2635.948) (-2641.227) [-2634.958] * (-2643.405) (-2638.244) (-2635.766) [-2638.997] -- 0:03:00 43000 -- (-2634.375) [-2634.011] (-2641.029) (-2644.112) * (-2640.641) (-2635.774) [-2637.534] (-2631.308) -- 0:02:58 43500 -- (-2633.042) [-2634.133] (-2636.191) (-2640.242) * (-2632.317) (-2632.170) [-2633.707] (-2638.884) -- 0:02:55 44000 -- (-2640.393) (-2634.558) [-2636.978] (-2635.976) * [-2638.919] (-2638.409) (-2632.360) (-2640.835) -- 0:02:53 44500 -- (-2638.968) (-2636.884) [-2637.529] (-2634.902) * (-2632.467) (-2632.791) (-2641.714) [-2632.999] -- 0:02:51 45000 -- (-2634.763) (-2643.091) (-2635.997) [-2637.329] * (-2632.324) [-2638.967] (-2639.555) (-2632.338) -- 0:02:49 Average standard deviation of split frequencies: 0.000000 45500 -- (-2631.526) [-2638.751] (-2635.247) (-2635.710) * (-2633.706) (-2636.506) (-2637.675) [-2634.911] -- 0:02:47 46000 -- (-2631.721) (-2637.668) [-2634.979] (-2632.499) * (-2637.032) (-2632.589) [-2634.623] (-2635.044) -- 0:02:45 46500 -- (-2636.414) (-2637.501) (-2641.266) [-2634.794] * (-2636.608) (-2636.461) (-2641.801) [-2634.724] -- 0:02:44 47000 -- (-2638.640) (-2637.931) [-2636.939] (-2634.045) * (-2637.542) [-2641.024] (-2633.676) (-2639.621) -- 0:02:42 47500 -- [-2637.726] (-2644.605) (-2639.567) (-2637.996) * [-2636.650] (-2636.741) (-2632.467) (-2640.260) -- 0:02:40 48000 -- [-2639.999] (-2638.641) (-2633.555) (-2633.680) * [-2641.356] (-2631.991) (-2635.895) (-2635.135) -- 0:02:38 48500 -- [-2634.714] (-2632.302) (-2633.175) (-2633.406) * (-2636.787) [-2632.714] (-2636.088) (-2636.900) -- 0:02:56 49000 -- [-2633.071] (-2639.945) (-2643.510) (-2635.125) * (-2636.465) [-2633.209] (-2636.766) (-2640.024) -- 0:02:54 49500 -- (-2643.489) (-2633.448) (-2640.228) [-2637.173] * (-2636.493) (-2632.680) (-2633.232) [-2648.178] -- 0:02:52 50000 -- (-2633.968) [-2631.944] (-2648.548) (-2634.082) * (-2633.030) [-2640.271] (-2639.770) (-2636.110) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 50500 -- [-2634.530] (-2632.184) (-2636.435) (-2633.588) * (-2638.255) (-2639.307) [-2633.230] (-2637.730) -- 0:02:49 51000 -- (-2638.662) [-2642.203] (-2636.555) (-2633.103) * [-2638.392] (-2634.840) (-2631.743) (-2636.398) -- 0:02:47 51500 -- [-2636.105] (-2632.294) (-2637.944) (-2635.600) * (-2633.408) (-2644.001) [-2632.024] (-2636.319) -- 0:02:45 52000 -- (-2637.722) (-2636.513) (-2634.481) [-2642.742] * [-2636.117] (-2641.596) (-2633.312) (-2637.422) -- 0:02:44 52500 -- (-2641.136) [-2641.414] (-2631.937) (-2633.074) * (-2636.087) (-2641.260) [-2635.236] (-2634.350) -- 0:02:42 53000 -- (-2637.514) (-2630.885) [-2631.804] (-2639.379) * (-2636.575) (-2638.066) (-2636.607) [-2633.063] -- 0:02:40 53500 -- (-2641.069) [-2636.683] (-2635.377) (-2634.442) * (-2637.978) (-2644.051) (-2638.770) [-2632.805] -- 0:02:39 54000 -- [-2634.652] (-2635.724) (-2634.903) (-2637.955) * (-2636.302) (-2637.428) (-2637.777) [-2631.686] -- 0:02:55 54500 -- (-2637.533) [-2634.779] (-2637.989) (-2634.883) * [-2638.633] (-2646.145) (-2633.164) (-2634.366) -- 0:02:53 55000 -- [-2633.003] (-2635.169) (-2632.965) (-2643.594) * (-2635.058) (-2642.660) [-2639.237] (-2632.896) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 55500 -- (-2631.882) (-2637.351) (-2636.011) [-2636.727] * (-2637.147) (-2634.112) [-2639.748] (-2631.104) -- 0:02:50 56000 -- (-2642.980) (-2632.994) [-2634.382] (-2640.493) * (-2640.091) [-2630.965] (-2639.988) (-2632.242) -- 0:02:48 56500 -- (-2641.065) (-2632.769) [-2633.827] (-2640.256) * [-2640.575] (-2642.486) (-2637.761) (-2639.716) -- 0:02:46 57000 -- [-2638.790] (-2641.277) (-2633.845) (-2637.901) * (-2639.245) (-2641.643) (-2641.554) [-2635.679] -- 0:02:45 57500 -- (-2645.945) (-2641.477) (-2633.492) [-2634.784] * (-2638.408) [-2633.281] (-2641.323) (-2635.207) -- 0:02:43 58000 -- (-2635.523) (-2636.056) (-2632.680) [-2635.646] * (-2637.323) [-2632.439] (-2640.012) (-2636.991) -- 0:02:42 58500 -- (-2637.680) (-2633.273) [-2635.615] (-2635.551) * (-2633.365) (-2630.851) [-2641.104] (-2636.077) -- 0:02:40 59000 -- (-2640.481) [-2634.371] (-2634.364) (-2631.764) * (-2637.119) (-2630.414) (-2641.518) [-2638.161] -- 0:02:39 59500 -- (-2635.218) [-2637.384] (-2634.403) (-2634.523) * (-2633.775) (-2635.875) (-2638.623) [-2638.793] -- 0:02:38 60000 -- (-2637.442) (-2638.387) [-2631.266] (-2645.725) * (-2633.721) (-2636.162) [-2632.930] (-2638.901) -- 0:02:52 Average standard deviation of split frequencies: 0.000000 60500 -- (-2642.040) (-2649.234) [-2633.592] (-2637.557) * (-2633.822) (-2634.407) (-2632.151) [-2633.365] -- 0:02:50 61000 -- (-2640.611) (-2637.563) [-2635.641] (-2636.791) * [-2634.283] (-2637.654) (-2633.057) (-2640.250) -- 0:02:49 61500 -- (-2636.200) (-2640.110) (-2635.563) [-2639.576] * (-2639.363) [-2633.426] (-2636.770) (-2642.268) -- 0:02:47 62000 -- [-2634.414] (-2642.676) (-2636.574) (-2637.558) * (-2633.523) (-2634.783) (-2631.017) [-2635.561] -- 0:02:46 62500 -- [-2637.409] (-2635.542) (-2635.160) (-2635.053) * [-2638.600] (-2639.587) (-2633.778) (-2632.663) -- 0:02:45 63000 -- (-2636.088) (-2638.385) [-2630.994] (-2640.510) * (-2638.883) [-2632.148] (-2633.707) (-2642.995) -- 0:02:43 63500 -- (-2637.846) (-2637.199) [-2632.597] (-2638.218) * (-2643.706) (-2636.833) (-2631.240) [-2639.731] -- 0:02:42 64000 -- [-2636.998] (-2639.649) (-2640.472) (-2638.184) * [-2634.540] (-2643.141) (-2643.580) (-2636.537) -- 0:02:40 64500 -- (-2631.579) (-2639.846) [-2638.309] (-2643.151) * (-2634.849) [-2633.055] (-2632.762) (-2640.533) -- 0:02:39 65000 -- (-2635.101) [-2635.403] (-2636.476) (-2643.761) * (-2635.136) [-2634.857] (-2633.780) (-2636.675) -- 0:02:38 Average standard deviation of split frequencies: 0.000000 65500 -- (-2632.048) [-2637.155] (-2635.891) (-2638.300) * (-2639.778) (-2636.026) (-2635.410) [-2637.882] -- 0:02:51 66000 -- (-2633.904) (-2636.962) [-2634.085] (-2640.051) * (-2636.082) (-2635.334) [-2630.208] (-2635.342) -- 0:02:49 66500 -- (-2636.603) [-2636.424] (-2630.575) (-2636.846) * (-2634.491) (-2637.608) [-2634.491] (-2639.530) -- 0:02:48 67000 -- (-2639.883) [-2637.342] (-2643.751) (-2640.989) * [-2635.136] (-2643.399) (-2634.097) (-2640.470) -- 0:02:47 67500 -- (-2643.888) (-2640.346) [-2641.042] (-2638.776) * [-2632.749] (-2633.810) (-2633.936) (-2639.374) -- 0:02:45 68000 -- (-2633.425) [-2633.905] (-2644.106) (-2639.575) * [-2633.363] (-2640.343) (-2636.637) (-2644.528) -- 0:02:44 68500 -- (-2637.908) [-2633.354] (-2648.108) (-2635.548) * (-2636.157) (-2634.168) (-2634.079) [-2643.649] -- 0:02:43 69000 -- (-2635.304) [-2630.750] (-2645.185) (-2637.075) * (-2637.302) (-2640.378) (-2634.211) [-2637.153] -- 0:02:41 69500 -- (-2634.188) (-2631.930) (-2639.274) [-2637.321] * (-2645.888) (-2637.465) [-2635.671] (-2640.418) -- 0:02:40 70000 -- [-2634.665] (-2634.650) (-2641.071) (-2644.862) * (-2642.546) (-2637.284) [-2633.180] (-2637.736) -- 0:02:39 Average standard deviation of split frequencies: 0.000000 70500 -- (-2633.817) (-2634.493) (-2635.202) [-2636.327] * (-2640.231) (-2637.945) [-2633.244] (-2634.589) -- 0:02:38 71000 -- (-2633.690) (-2634.386) [-2634.098] (-2639.761) * (-2643.076) [-2635.171] (-2635.054) (-2633.845) -- 0:02:50 71500 -- [-2631.459] (-2634.258) (-2637.640) (-2634.642) * (-2640.753) (-2640.365) (-2636.218) [-2636.507] -- 0:02:48 72000 -- [-2639.545] (-2637.059) (-2637.421) (-2640.132) * (-2637.613) (-2640.154) (-2634.955) [-2638.368] -- 0:02:47 72500 -- (-2644.238) (-2635.483) [-2634.801] (-2641.953) * (-2636.319) (-2641.619) (-2636.970) [-2640.159] -- 0:02:46 73000 -- (-2639.251) (-2642.219) (-2636.512) [-2632.306] * (-2631.042) (-2641.453) (-2633.011) [-2631.412] -- 0:02:45 73500 -- (-2638.043) (-2641.922) (-2638.781) [-2638.063] * [-2637.836] (-2636.924) (-2640.038) (-2637.541) -- 0:02:43 74000 -- (-2634.144) (-2638.975) (-2641.556) [-2638.801] * [-2631.802] (-2636.460) (-2640.774) (-2632.042) -- 0:02:42 74500 -- [-2638.710] (-2637.762) (-2636.908) (-2630.453) * [-2636.882] (-2644.352) (-2648.639) (-2636.307) -- 0:02:41 75000 -- (-2642.853) (-2637.865) [-2635.607] (-2633.742) * (-2632.967) (-2638.498) (-2639.312) [-2638.067] -- 0:02:40 Average standard deviation of split frequencies: 0.000000 75500 -- (-2641.079) (-2637.098) [-2637.142] (-2635.792) * [-2633.066] (-2639.613) (-2637.193) (-2633.044) -- 0:02:39 76000 -- [-2633.278] (-2635.287) (-2637.633) (-2639.576) * [-2638.596] (-2639.070) (-2638.721) (-2633.095) -- 0:02:38 76500 -- (-2633.651) [-2637.121] (-2638.987) (-2640.758) * (-2633.538) (-2637.119) (-2639.255) [-2637.255] -- 0:02:49 77000 -- [-2635.995] (-2637.696) (-2645.871) (-2638.371) * (-2639.103) (-2637.229) (-2643.123) [-2631.546] -- 0:02:47 77500 -- (-2639.743) (-2634.473) [-2636.210] (-2637.525) * (-2645.218) (-2635.342) (-2634.039) [-2639.056] -- 0:02:46 78000 -- (-2640.074) [-2632.239] (-2637.102) (-2638.256) * [-2638.284] (-2638.159) (-2637.373) (-2635.329) -- 0:02:45 78500 -- (-2637.249) [-2635.894] (-2640.209) (-2633.777) * (-2636.112) (-2633.905) (-2638.687) [-2638.361] -- 0:02:44 79000 -- (-2637.740) [-2629.732] (-2636.721) (-2632.310) * (-2635.223) (-2641.940) (-2630.505) [-2634.258] -- 0:02:43 79500 -- (-2641.358) (-2639.087) [-2636.005] (-2638.749) * [-2631.321] (-2635.619) (-2633.275) (-2638.450) -- 0:02:42 80000 -- (-2636.573) [-2637.980] (-2633.834) (-2634.693) * (-2642.320) [-2637.994] (-2634.508) (-2638.664) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 80500 -- (-2638.989) (-2634.625) [-2635.056] (-2635.727) * (-2637.663) (-2633.243) [-2635.589] (-2633.616) -- 0:02:39 81000 -- (-2636.794) (-2636.576) [-2633.399] (-2636.957) * (-2640.644) (-2631.809) (-2635.134) [-2632.144] -- 0:02:38 81500 -- [-2639.655] (-2647.264) (-2637.442) (-2639.310) * (-2636.732) (-2636.351) [-2634.799] (-2646.124) -- 0:02:37 82000 -- (-2635.809) (-2636.953) (-2637.860) [-2633.042] * (-2635.781) (-2632.237) [-2631.437] (-2639.591) -- 0:02:36 82500 -- (-2638.157) (-2638.890) (-2634.128) [-2632.138] * [-2633.851] (-2634.388) (-2632.920) (-2632.807) -- 0:02:46 83000 -- (-2637.238) (-2645.040) (-2643.275) [-2636.643] * (-2634.528) (-2633.084) (-2631.837) [-2638.194] -- 0:02:45 83500 -- (-2635.175) (-2638.747) (-2644.014) [-2634.438] * (-2639.544) [-2634.246] (-2639.617) (-2641.657) -- 0:02:44 84000 -- (-2638.959) (-2638.718) [-2631.032] (-2636.244) * (-2635.906) (-2635.082) [-2640.436] (-2635.884) -- 0:02:43 84500 -- (-2635.426) (-2643.625) (-2633.863) [-2634.841] * (-2634.765) [-2636.845] (-2642.262) (-2641.013) -- 0:02:42 85000 -- (-2634.989) (-2638.723) [-2629.537] (-2636.990) * (-2638.474) (-2632.006) [-2642.187] (-2634.746) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 85500 -- (-2639.905) [-2638.015] (-2633.618) (-2635.261) * (-2638.306) (-2640.761) (-2635.675) [-2640.324] -- 0:02:40 86000 -- (-2633.579) (-2634.053) (-2639.616) [-2633.387] * (-2635.732) (-2634.991) [-2631.344] (-2641.173) -- 0:02:39 86500 -- (-2633.481) [-2637.219] (-2637.259) (-2631.621) * [-2640.573] (-2640.807) (-2635.586) (-2644.608) -- 0:02:38 87000 -- (-2641.726) [-2642.768] (-2642.106) (-2634.612) * (-2639.950) [-2634.715] (-2646.411) (-2638.287) -- 0:02:37 87500 -- (-2640.091) (-2641.643) [-2643.768] (-2636.049) * (-2638.185) [-2638.022] (-2637.782) (-2642.368) -- 0:02:36 88000 -- (-2638.485) [-2635.450] (-2630.908) (-2635.642) * [-2636.609] (-2643.461) (-2636.044) (-2642.219) -- 0:02:45 88500 -- (-2631.775) (-2639.523) [-2640.468] (-2639.387) * (-2633.197) (-2642.554) [-2632.457] (-2635.148) -- 0:02:44 89000 -- (-2636.311) (-2633.483) (-2633.635) [-2642.122] * (-2634.698) (-2635.304) [-2636.616] (-2637.496) -- 0:02:43 89500 -- (-2641.924) (-2636.857) [-2633.468] (-2632.589) * [-2633.892] (-2636.276) (-2634.450) (-2637.999) -- 0:02:42 90000 -- (-2637.833) (-2635.923) (-2632.838) [-2638.674] * (-2639.031) (-2637.672) (-2645.619) [-2638.082] -- 0:02:41 Average standard deviation of split frequencies: 0.000000 90500 -- [-2633.341] (-2640.417) (-2638.238) (-2634.723) * (-2635.815) (-2634.410) (-2637.893) [-2636.132] -- 0:02:40 91000 -- (-2635.714) (-2634.257) (-2634.269) [-2632.331] * (-2636.987) (-2632.257) [-2635.506] (-2639.629) -- 0:02:39 91500 -- [-2631.249] (-2638.031) (-2636.883) (-2636.682) * (-2636.352) (-2633.625) (-2633.996) [-2632.774] -- 0:02:38 92000 -- [-2636.379] (-2638.986) (-2639.587) (-2636.736) * (-2637.965) (-2635.636) (-2641.928) [-2631.629] -- 0:02:37 92500 -- (-2634.695) (-2633.234) [-2634.297] (-2634.001) * (-2630.872) (-2633.892) (-2635.484) [-2632.469] -- 0:02:36 93000 -- [-2634.254] (-2637.401) (-2646.351) (-2632.965) * [-2630.111] (-2634.770) (-2633.363) (-2636.954) -- 0:02:36 93500 -- (-2635.289) (-2633.327) [-2638.814] (-2640.049) * (-2639.857) [-2635.200] (-2633.478) (-2633.088) -- 0:02:44 94000 -- [-2634.411] (-2634.478) (-2637.031) (-2637.156) * [-2633.462] (-2637.194) (-2649.882) (-2634.088) -- 0:02:43 94500 -- [-2633.618] (-2637.501) (-2636.257) (-2637.667) * (-2636.143) (-2635.656) (-2631.787) [-2635.276] -- 0:02:42 95000 -- [-2636.902] (-2641.914) (-2639.969) (-2636.882) * (-2639.878) (-2635.546) [-2632.623] (-2639.699) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 95500 -- (-2638.358) [-2647.850] (-2635.420) (-2639.284) * (-2637.462) (-2633.109) [-2637.460] (-2630.361) -- 0:02:41 96000 -- (-2636.075) (-2638.791) [-2637.821] (-2635.275) * [-2636.332] (-2632.077) (-2637.325) (-2640.806) -- 0:02:40 96500 -- (-2634.692) (-2633.413) [-2638.444] (-2637.571) * (-2644.508) (-2635.901) (-2637.744) [-2638.081] -- 0:02:39 97000 -- [-2634.267] (-2638.127) (-2634.647) (-2634.474) * [-2636.107] (-2632.836) (-2635.436) (-2642.879) -- 0:02:38 97500 -- (-2640.220) (-2638.353) [-2635.356] (-2633.495) * (-2632.032) (-2635.431) (-2637.969) [-2640.789] -- 0:02:37 98000 -- (-2633.928) [-2636.007] (-2630.547) (-2635.730) * [-2635.141] (-2632.978) (-2636.119) (-2639.156) -- 0:02:36 98500 -- (-2640.173) (-2635.718) (-2632.534) [-2634.031] * (-2636.403) [-2635.275] (-2638.906) (-2639.595) -- 0:02:35 99000 -- (-2636.972) (-2637.317) [-2635.429] (-2635.473) * [-2639.022] (-2639.804) (-2641.638) (-2640.568) -- 0:02:43 99500 -- (-2632.287) [-2631.483] (-2634.903) (-2642.002) * (-2635.892) (-2635.679) [-2634.274] (-2635.322) -- 0:02:42 100000 -- (-2637.151) [-2635.598] (-2637.451) (-2641.647) * [-2635.117] (-2634.786) (-2637.741) (-2636.687) -- 0:02:42 Average standard deviation of split frequencies: 0.000000 100500 -- (-2635.377) [-2631.890] (-2638.670) (-2647.446) * (-2638.500) [-2636.767] (-2641.344) (-2636.077) -- 0:02:41 101000 -- (-2637.017) [-2632.507] (-2634.257) (-2635.677) * (-2642.578) [-2631.836] (-2637.343) (-2635.457) -- 0:02:40 101500 -- (-2635.830) (-2637.602) (-2642.312) [-2639.676] * (-2642.471) (-2632.931) [-2636.620] (-2639.128) -- 0:02:39 102000 -- (-2641.259) [-2632.834] (-2641.007) (-2635.883) * (-2632.870) (-2640.296) (-2639.342) [-2634.158] -- 0:02:38 102500 -- (-2636.470) [-2637.390] (-2635.527) (-2634.063) * (-2636.871) [-2636.795] (-2639.370) (-2636.476) -- 0:02:37 103000 -- [-2640.363] (-2635.929) (-2634.588) (-2646.665) * [-2634.337] (-2633.001) (-2633.720) (-2646.859) -- 0:02:36 103500 -- (-2643.774) [-2636.776] (-2632.987) (-2644.002) * (-2634.610) [-2631.403] (-2639.911) (-2640.320) -- 0:02:35 104000 -- (-2633.631) (-2638.454) [-2636.488] (-2641.636) * (-2634.127) [-2637.781] (-2634.477) (-2638.617) -- 0:02:35 104500 -- (-2640.013) (-2647.420) [-2638.275] (-2640.604) * (-2637.282) (-2637.000) [-2634.051] (-2643.148) -- 0:02:42 105000 -- (-2638.928) (-2646.471) [-2636.667] (-2639.138) * (-2635.371) [-2639.029] (-2635.313) (-2639.900) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 105500 -- (-2632.313) (-2631.309) [-2633.926] (-2636.470) * (-2635.150) [-2632.367] (-2636.603) (-2641.036) -- 0:02:41 106000 -- (-2636.118) [-2637.733] (-2634.429) (-2635.475) * [-2641.685] (-2633.782) (-2635.657) (-2638.151) -- 0:02:40 106500 -- [-2629.387] (-2634.617) (-2635.768) (-2635.600) * (-2634.956) (-2634.819) (-2638.752) [-2634.700] -- 0:02:39 107000 -- (-2630.874) [-2634.608] (-2634.843) (-2636.990) * [-2631.852] (-2646.582) (-2636.375) (-2637.534) -- 0:02:38 107500 -- (-2633.032) [-2633.638] (-2637.761) (-2639.559) * (-2633.781) (-2634.994) (-2636.247) [-2644.116] -- 0:02:37 108000 -- [-2634.826] (-2632.458) (-2632.654) (-2642.916) * (-2637.574) [-2632.736] (-2640.418) (-2637.287) -- 0:02:36 108500 -- [-2631.395] (-2636.026) (-2633.195) (-2646.814) * (-2635.681) [-2636.807] (-2641.361) (-2635.825) -- 0:02:36 109000 -- (-2633.943) [-2639.035] (-2628.997) (-2634.770) * [-2641.153] (-2637.086) (-2635.285) (-2633.207) -- 0:02:35 109500 -- (-2637.435) (-2631.516) [-2634.660] (-2635.026) * (-2635.986) (-2643.380) [-2632.213] (-2641.975) -- 0:02:34 110000 -- [-2630.746] (-2635.114) (-2633.405) (-2636.311) * (-2639.726) (-2641.180) [-2634.789] (-2634.691) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 110500 -- [-2635.043] (-2638.196) (-2643.163) (-2632.188) * [-2635.176] (-2642.303) (-2638.399) (-2634.025) -- 0:02:40 111000 -- (-2638.929) [-2640.290] (-2640.596) (-2635.549) * [-2633.345] (-2631.910) (-2634.019) (-2634.403) -- 0:02:40 111500 -- [-2633.293] (-2635.445) (-2646.083) (-2640.589) * (-2635.871) (-2639.951) [-2635.337] (-2638.734) -- 0:02:39 112000 -- (-2634.500) [-2640.542] (-2645.343) (-2637.159) * (-2635.315) (-2641.516) [-2634.751] (-2638.134) -- 0:02:38 112500 -- (-2634.612) [-2633.401] (-2642.339) (-2639.043) * (-2634.365) [-2638.331] (-2642.042) (-2634.643) -- 0:02:37 113000 -- (-2633.782) [-2632.966] (-2638.139) (-2635.229) * (-2644.857) (-2636.627) (-2637.358) [-2633.964] -- 0:02:36 113500 -- (-2636.869) [-2636.235] (-2634.280) (-2633.416) * [-2634.037] (-2634.772) (-2639.187) (-2638.387) -- 0:02:36 114000 -- (-2635.073) (-2638.347) [-2632.196] (-2632.490) * [-2638.040] (-2635.467) (-2635.224) (-2641.956) -- 0:02:35 114500 -- (-2635.054) (-2636.523) (-2636.258) [-2633.992] * (-2634.512) [-2634.203] (-2636.959) (-2633.986) -- 0:02:34 115000 -- (-2635.960) [-2641.569] (-2639.277) (-2639.627) * (-2635.089) [-2635.619] (-2633.810) (-2636.706) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 115500 -- (-2637.755) (-2638.174) (-2638.741) [-2636.577] * (-2638.767) (-2639.644) (-2636.915) [-2633.231] -- 0:02:33 116000 -- (-2634.983) (-2639.950) (-2634.794) [-2643.686] * (-2632.592) (-2634.493) [-2635.588] (-2640.929) -- 0:02:40 116500 -- (-2639.791) [-2634.994] (-2632.041) (-2647.274) * (-2635.655) [-2632.184] (-2637.065) (-2643.189) -- 0:02:39 117000 -- (-2641.648) [-2635.743] (-2638.185) (-2641.425) * [-2637.637] (-2640.663) (-2641.408) (-2636.465) -- 0:02:38 117500 -- (-2634.057) (-2638.169) [-2635.111] (-2637.088) * [-2634.705] (-2632.372) (-2640.219) (-2643.731) -- 0:02:37 118000 -- (-2633.276) [-2636.738] (-2634.045) (-2641.117) * (-2636.765) [-2640.273] (-2636.093) (-2636.431) -- 0:02:36 118500 -- (-2635.305) (-2639.244) (-2635.389) [-2637.507] * (-2635.876) [-2636.576] (-2643.663) (-2635.775) -- 0:02:36 119000 -- (-2640.224) (-2635.068) (-2638.425) [-2636.034] * [-2638.947] (-2636.013) (-2636.126) (-2631.328) -- 0:02:35 119500 -- (-2638.674) (-2639.617) (-2642.116) [-2641.417] * (-2642.079) (-2634.855) [-2634.923] (-2629.430) -- 0:02:34 120000 -- [-2635.268] (-2634.027) (-2636.076) (-2635.636) * (-2637.197) (-2635.235) (-2640.581) [-2633.048] -- 0:02:34 Average standard deviation of split frequencies: 0.000000 120500 -- [-2636.150] (-2634.516) (-2639.007) (-2639.515) * [-2634.652] (-2642.354) (-2636.751) (-2640.219) -- 0:02:33 121000 -- (-2639.898) (-2635.545) (-2637.142) [-2632.658] * (-2638.462) [-2636.024] (-2636.483) (-2640.831) -- 0:02:32 121500 -- (-2647.035) (-2638.043) [-2634.602] (-2638.105) * (-2638.101) (-2637.905) (-2635.468) [-2640.936] -- 0:02:39 122000 -- (-2637.189) (-2633.790) (-2641.435) [-2632.865] * [-2636.608] (-2634.961) (-2637.121) (-2635.985) -- 0:02:38 122500 -- (-2635.888) [-2636.862] (-2641.889) (-2632.454) * (-2634.426) (-2633.165) (-2636.574) [-2631.603] -- 0:02:37 123000 -- [-2637.632] (-2637.980) (-2636.298) (-2632.253) * [-2637.789] (-2632.985) (-2640.328) (-2632.229) -- 0:02:36 123500 -- (-2628.867) (-2636.304) [-2644.618] (-2634.263) * (-2636.473) (-2633.677) (-2636.456) [-2637.839] -- 0:02:36 124000 -- (-2633.720) [-2635.381] (-2642.616) (-2633.118) * (-2642.841) (-2633.186) [-2634.994] (-2639.361) -- 0:02:35 124500 -- (-2637.875) (-2635.323) (-2633.532) [-2633.926] * (-2637.102) (-2632.932) (-2638.265) [-2634.337] -- 0:02:34 125000 -- (-2633.517) (-2641.962) (-2639.472) [-2632.367] * (-2640.794) (-2638.101) (-2642.578) [-2636.160] -- 0:02:34 Average standard deviation of split frequencies: 0.000000 125500 -- (-2639.774) (-2636.769) (-2639.144) [-2632.620] * [-2634.004] (-2634.286) (-2640.744) (-2635.836) -- 0:02:33 126000 -- (-2636.952) (-2630.887) [-2640.826] (-2637.041) * (-2634.354) (-2634.616) (-2636.566) [-2642.493] -- 0:02:32 126500 -- [-2632.661] (-2639.772) (-2634.009) (-2636.235) * (-2636.703) (-2641.049) [-2632.890] (-2637.856) -- 0:02:31 127000 -- (-2634.394) (-2644.741) [-2634.222] (-2635.519) * (-2636.178) (-2637.869) [-2636.476] (-2640.212) -- 0:02:31 127500 -- (-2635.661) (-2636.745) (-2635.464) [-2639.841] * (-2635.708) (-2632.729) [-2634.041] (-2641.921) -- 0:02:37 128000 -- (-2642.589) [-2636.769] (-2632.605) (-2634.612) * [-2631.515] (-2636.992) (-2635.142) (-2644.359) -- 0:02:36 128500 -- [-2636.276] (-2637.926) (-2631.783) (-2634.875) * (-2637.027) (-2641.631) [-2635.311] (-2646.394) -- 0:02:35 129000 -- [-2644.623] (-2637.751) (-2640.776) (-2641.380) * [-2639.957] (-2635.190) (-2632.940) (-2635.977) -- 0:02:35 129500 -- (-2635.270) [-2636.652] (-2636.585) (-2637.488) * [-2634.245] (-2639.671) (-2636.088) (-2633.499) -- 0:02:34 130000 -- (-2643.863) [-2633.705] (-2643.346) (-2636.706) * [-2634.602] (-2639.284) (-2641.076) (-2634.938) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 130500 -- (-2636.022) [-2639.187] (-2641.364) (-2638.077) * (-2639.657) [-2637.860] (-2645.327) (-2632.181) -- 0:02:33 131000 -- [-2635.322] (-2642.687) (-2635.136) (-2633.577) * (-2633.895) (-2634.144) [-2634.821] (-2640.669) -- 0:02:32 131500 -- (-2636.121) (-2641.066) [-2635.868] (-2636.451) * (-2639.014) [-2635.597] (-2635.206) (-2636.209) -- 0:02:31 132000 -- [-2635.600] (-2632.995) (-2636.440) (-2638.296) * (-2633.771) (-2637.820) (-2634.814) [-2629.960] -- 0:02:31 132500 -- (-2637.943) (-2635.026) (-2636.099) [-2631.011] * (-2637.006) (-2636.535) [-2641.977] (-2632.045) -- 0:02:30 133000 -- (-2635.583) (-2640.724) [-2632.035] (-2632.171) * [-2637.050] (-2637.076) (-2638.823) (-2637.102) -- 0:02:36 133500 -- [-2635.738] (-2641.782) (-2637.663) (-2638.006) * (-2637.551) (-2642.579) [-2636.664] (-2638.132) -- 0:02:35 134000 -- (-2635.182) (-2643.617) [-2637.283] (-2633.727) * (-2636.925) [-2636.081] (-2633.872) (-2639.158) -- 0:02:35 134500 -- (-2632.644) (-2638.520) (-2637.888) [-2631.287] * (-2642.650) (-2637.669) (-2631.561) [-2637.395] -- 0:02:34 135000 -- (-2635.373) (-2637.817) (-2641.019) [-2636.241] * (-2634.388) [-2636.329] (-2637.941) (-2641.992) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 135500 -- (-2637.607) (-2639.556) [-2635.009] (-2638.114) * (-2633.191) [-2633.758] (-2636.806) (-2644.770) -- 0:02:33 136000 -- [-2634.268] (-2641.114) (-2635.568) (-2633.087) * [-2636.870] (-2635.467) (-2640.325) (-2643.963) -- 0:02:32 136500 -- (-2637.677) (-2637.056) (-2640.843) [-2632.637] * (-2640.700) [-2631.010] (-2639.827) (-2636.076) -- 0:02:31 137000 -- (-2632.397) (-2637.211) (-2635.492) [-2636.769] * (-2643.140) (-2632.759) (-2635.781) [-2642.994] -- 0:02:31 137500 -- (-2634.236) (-2635.809) [-2640.956] (-2636.809) * [-2633.111] (-2632.596) (-2634.780) (-2638.624) -- 0:02:30 138000 -- [-2631.541] (-2636.425) (-2641.005) (-2636.460) * (-2633.831) (-2635.114) [-2638.317] (-2633.968) -- 0:02:29 138500 -- (-2632.618) (-2636.636) [-2635.071] (-2639.957) * [-2632.096] (-2635.395) (-2637.280) (-2643.252) -- 0:02:35 139000 -- (-2638.382) (-2633.924) [-2632.543] (-2634.759) * (-2632.981) (-2636.402) [-2639.608] (-2643.263) -- 0:02:34 139500 -- (-2642.145) [-2634.443] (-2638.131) (-2636.843) * [-2638.241] (-2632.789) (-2641.698) (-2636.053) -- 0:02:34 140000 -- (-2654.753) (-2638.827) [-2634.979] (-2646.818) * (-2631.730) [-2639.376] (-2637.663) (-2634.310) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 140500 -- [-2637.823] (-2636.880) (-2629.258) (-2639.903) * (-2637.642) (-2634.711) [-2632.502] (-2638.287) -- 0:02:32 141000 -- [-2635.810] (-2632.963) (-2636.507) (-2636.012) * [-2639.540] (-2636.776) (-2640.642) (-2635.745) -- 0:02:32 141500 -- (-2637.316) [-2634.923] (-2637.202) (-2633.719) * (-2633.799) (-2636.505) (-2639.277) [-2633.451] -- 0:02:31 142000 -- (-2641.428) (-2636.092) (-2641.507) [-2630.133] * (-2633.779) (-2639.299) (-2633.263) [-2638.287] -- 0:02:31 142500 -- [-2635.131] (-2638.250) (-2633.488) (-2646.384) * (-2636.270) [-2635.200] (-2636.942) (-2634.478) -- 0:02:30 143000 -- (-2635.023) (-2640.954) [-2634.998] (-2640.803) * [-2635.756] (-2637.913) (-2637.482) (-2642.559) -- 0:02:29 143500 -- (-2633.482) [-2634.103] (-2637.140) (-2636.207) * (-2635.294) (-2643.189) (-2637.797) [-2635.114] -- 0:02:29 144000 -- (-2635.751) [-2633.833] (-2633.694) (-2632.722) * (-2635.969) (-2640.243) [-2631.310] (-2636.303) -- 0:02:34 144500 -- (-2640.832) (-2639.609) (-2639.518) [-2634.479] * (-2635.825) (-2639.976) (-2641.256) [-2634.771] -- 0:02:33 145000 -- (-2637.124) [-2632.832] (-2643.760) (-2631.879) * (-2634.285) [-2636.434] (-2638.600) (-2634.337) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 145500 -- (-2635.895) (-2637.617) [-2637.713] (-2631.962) * [-2638.541] (-2633.498) (-2640.940) (-2636.317) -- 0:02:32 146000 -- (-2633.744) [-2633.260] (-2648.361) (-2636.292) * (-2648.429) [-2636.814] (-2635.216) (-2636.800) -- 0:02:32 146500 -- (-2633.628) (-2644.493) (-2637.079) [-2632.737] * (-2636.432) [-2636.818] (-2635.883) (-2635.149) -- 0:02:31 147000 -- (-2632.704) [-2636.409] (-2638.259) (-2639.047) * (-2634.742) (-2638.703) (-2634.758) [-2634.701] -- 0:02:30 147500 -- (-2633.543) (-2633.446) (-2635.038) [-2633.500] * [-2632.717] (-2635.508) (-2638.996) (-2633.769) -- 0:02:30 148000 -- (-2638.668) (-2639.123) (-2633.952) [-2633.533] * (-2640.846) (-2638.293) [-2635.702] (-2641.245) -- 0:02:29 148500 -- (-2635.315) [-2635.120] (-2637.984) (-2635.187) * [-2637.098] (-2636.370) (-2640.802) (-2640.597) -- 0:02:29 149000 -- (-2636.189) (-2645.188) [-2633.702] (-2638.837) * (-2633.580) [-2636.431] (-2637.588) (-2636.489) -- 0:02:28 149500 -- (-2637.626) [-2634.817] (-2636.336) (-2635.884) * (-2636.087) [-2636.919] (-2634.555) (-2633.375) -- 0:02:33 150000 -- (-2633.726) [-2636.041] (-2638.387) (-2639.327) * (-2639.644) (-2636.624) [-2638.463] (-2645.889) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 150500 -- (-2632.701) (-2635.044) (-2640.680) [-2634.474] * (-2631.405) (-2636.797) [-2639.290] (-2643.946) -- 0:02:32 151000 -- [-2633.714] (-2634.163) (-2639.410) (-2638.448) * (-2636.522) (-2632.865) (-2639.644) [-2640.484] -- 0:02:31 151500 -- (-2632.741) (-2636.836) [-2636.487] (-2635.842) * (-2636.618) [-2633.272] (-2639.960) (-2636.070) -- 0:02:31 152000 -- (-2638.374) (-2635.075) (-2634.997) [-2640.485] * [-2634.380] (-2639.477) (-2637.954) (-2638.998) -- 0:02:30 152500 -- [-2632.015] (-2636.314) (-2636.332) (-2633.785) * [-2640.045] (-2636.523) (-2631.095) (-2639.808) -- 0:02:30 153000 -- (-2635.246) [-2636.180] (-2635.827) (-2637.648) * (-2638.910) [-2640.100] (-2636.660) (-2641.184) -- 0:02:29 153500 -- (-2635.836) (-2635.519) [-2632.867] (-2643.265) * [-2644.849] (-2642.419) (-2635.915) (-2642.552) -- 0:02:28 154000 -- [-2637.622] (-2638.892) (-2635.532) (-2644.184) * (-2638.742) (-2644.004) (-2634.897) [-2634.358] -- 0:02:28 154500 -- (-2631.542) (-2638.417) [-2636.887] (-2634.054) * (-2640.259) (-2636.136) (-2648.356) [-2639.158] -- 0:02:27 155000 -- (-2641.055) (-2636.024) (-2642.124) [-2635.284] * (-2633.921) (-2637.105) (-2630.987) [-2638.818] -- 0:02:27 Average standard deviation of split frequencies: 0.000000 155500 -- (-2639.336) (-2631.972) [-2633.212] (-2640.181) * [-2632.036] (-2635.991) (-2632.355) (-2637.284) -- 0:02:32 156000 -- (-2638.984) (-2635.706) (-2639.599) [-2632.064] * (-2636.568) [-2633.598] (-2636.659) (-2639.953) -- 0:02:31 156500 -- (-2635.132) (-2632.766) (-2634.737) [-2636.445] * (-2633.936) (-2641.515) [-2634.789] (-2636.988) -- 0:02:30 157000 -- (-2641.537) (-2636.432) [-2634.747] (-2639.071) * (-2635.373) (-2633.633) (-2640.744) [-2634.158] -- 0:02:30 157500 -- (-2635.663) [-2631.802] (-2637.574) (-2637.730) * (-2638.474) (-2637.833) (-2637.074) [-2637.452] -- 0:02:29 158000 -- (-2635.260) (-2634.921) [-2634.160] (-2639.130) * (-2633.282) (-2636.620) (-2640.071) [-2633.176] -- 0:02:29 158500 -- (-2634.939) (-2636.009) (-2638.354) [-2637.516] * [-2636.156] (-2636.112) (-2636.672) (-2634.016) -- 0:02:28 159000 -- [-2632.894] (-2639.724) (-2636.994) (-2634.906) * (-2637.862) (-2631.963) (-2635.925) [-2633.950] -- 0:02:28 159500 -- (-2637.197) (-2633.320) (-2632.822) [-2636.089] * [-2635.677] (-2637.144) (-2634.911) (-2639.799) -- 0:02:27 160000 -- (-2631.173) [-2631.726] (-2635.013) (-2629.735) * (-2634.238) (-2636.081) (-2634.841) [-2637.853] -- 0:02:27 Average standard deviation of split frequencies: 0.000000 160500 -- [-2634.104] (-2634.608) (-2637.331) (-2635.221) * (-2634.403) [-2633.563] (-2642.213) (-2636.386) -- 0:02:26 161000 -- (-2632.207) (-2634.224) (-2632.990) [-2636.108] * (-2637.072) [-2634.466] (-2632.915) (-2635.379) -- 0:02:31 161500 -- (-2638.281) [-2637.005] (-2635.444) (-2643.056) * [-2637.312] (-2637.315) (-2637.543) (-2638.808) -- 0:02:30 162000 -- [-2632.578] (-2638.253) (-2633.142) (-2632.619) * (-2636.097) [-2633.759] (-2640.494) (-2641.255) -- 0:02:30 162500 -- (-2635.291) (-2640.107) (-2638.993) [-2632.168] * [-2632.997] (-2635.568) (-2639.675) (-2639.312) -- 0:02:29 163000 -- (-2641.243) (-2634.240) [-2635.592] (-2645.677) * (-2631.871) (-2636.332) [-2637.723] (-2637.945) -- 0:02:28 163500 -- (-2631.999) [-2635.080] (-2633.324) (-2638.683) * (-2637.650) (-2634.836) [-2642.084] (-2638.281) -- 0:02:28 164000 -- (-2642.675) (-2634.827) [-2632.419] (-2639.220) * (-2634.470) [-2634.514] (-2638.366) (-2638.454) -- 0:02:27 164500 -- (-2635.062) (-2637.886) [-2632.920] (-2642.425) * [-2639.220] (-2637.329) (-2631.105) (-2635.275) -- 0:02:27 165000 -- (-2638.299) (-2635.953) (-2641.496) [-2637.569] * [-2634.106] (-2636.346) (-2635.021) (-2636.620) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 165500 -- [-2630.640] (-2632.506) (-2635.760) (-2637.794) * (-2642.049) [-2637.969] (-2639.576) (-2639.460) -- 0:02:26 166000 -- (-2636.483) (-2634.335) (-2639.437) [-2634.746] * (-2635.276) (-2634.418) (-2634.434) [-2632.969] -- 0:02:25 166500 -- [-2632.635] (-2639.547) (-2635.926) (-2634.603) * (-2641.371) [-2631.649] (-2639.693) (-2638.265) -- 0:02:30 167000 -- (-2637.295) (-2638.195) [-2634.470] (-2638.451) * [-2634.500] (-2633.978) (-2638.220) (-2636.111) -- 0:02:29 167500 -- [-2634.301] (-2635.875) (-2642.047) (-2636.455) * (-2633.057) [-2632.473] (-2637.284) (-2640.384) -- 0:02:29 168000 -- [-2632.654] (-2636.369) (-2631.725) (-2633.584) * [-2634.660] (-2635.625) (-2635.751) (-2641.602) -- 0:02:28 168500 -- [-2631.760] (-2639.360) (-2637.088) (-2652.322) * (-2637.200) (-2639.505) [-2632.202] (-2634.955) -- 0:02:28 169000 -- [-2633.268] (-2633.148) (-2638.175) (-2642.908) * [-2641.089] (-2636.223) (-2637.273) (-2633.719) -- 0:02:27 169500 -- (-2632.917) (-2637.086) [-2634.618] (-2641.850) * (-2638.624) (-2636.263) (-2639.129) [-2638.169] -- 0:02:26 170000 -- (-2633.761) (-2639.862) [-2634.749] (-2641.390) * (-2648.419) (-2638.583) (-2639.715) [-2632.416] -- 0:02:26 Average standard deviation of split frequencies: 0.000000 170500 -- (-2630.149) (-2632.964) (-2638.412) [-2637.418] * (-2640.625) [-2638.764] (-2643.168) (-2634.113) -- 0:02:25 171000 -- (-2636.683) [-2636.856] (-2634.617) (-2638.161) * (-2633.320) (-2633.479) (-2634.292) [-2634.135] -- 0:02:25 171500 -- (-2641.279) (-2637.577) (-2632.675) [-2633.230] * (-2633.428) (-2631.008) [-2633.653] (-2633.814) -- 0:02:24 172000 -- (-2637.608) [-2632.845] (-2633.400) (-2638.294) * [-2637.517] (-2634.891) (-2637.647) (-2634.988) -- 0:02:29 172500 -- (-2637.878) (-2636.850) [-2636.380] (-2635.849) * (-2635.327) [-2633.753] (-2635.184) (-2646.323) -- 0:02:28 173000 -- (-2637.876) (-2639.236) [-2634.404] (-2633.454) * (-2631.521) (-2637.079) (-2633.916) [-2638.990] -- 0:02:28 173500 -- (-2634.976) (-2636.167) (-2641.791) [-2636.266] * [-2638.318] (-2640.010) (-2631.659) (-2639.435) -- 0:02:27 174000 -- [-2634.848] (-2641.629) (-2634.047) (-2638.105) * (-2639.173) [-2642.031] (-2634.035) (-2636.942) -- 0:02:27 174500 -- [-2636.198] (-2643.703) (-2635.477) (-2632.491) * [-2631.807] (-2643.309) (-2638.370) (-2636.111) -- 0:02:26 175000 -- (-2635.000) (-2638.627) (-2642.655) [-2633.212] * [-2642.749] (-2635.767) (-2641.223) (-2643.492) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 175500 -- (-2641.165) (-2635.620) [-2633.855] (-2636.676) * [-2636.556] (-2642.028) (-2635.845) (-2638.367) -- 0:02:25 176000 -- (-2632.531) (-2633.794) [-2634.510] (-2636.521) * (-2639.316) (-2638.717) [-2636.967] (-2641.005) -- 0:02:25 176500 -- [-2636.271] (-2635.809) (-2635.058) (-2637.727) * (-2639.796) (-2640.810) (-2636.196) [-2638.877] -- 0:02:24 177000 -- (-2640.933) (-2635.471) [-2634.240] (-2632.052) * [-2637.931] (-2638.742) (-2639.379) (-2638.597) -- 0:02:24 177500 -- (-2646.282) (-2635.980) (-2638.783) [-2637.782] * (-2639.947) [-2635.285] (-2638.813) (-2641.428) -- 0:02:23 178000 -- [-2635.634] (-2633.847) (-2634.471) (-2639.337) * (-2635.202) [-2634.534] (-2640.591) (-2635.883) -- 0:02:27 178500 -- (-2632.845) (-2633.083) (-2635.590) [-2636.722] * (-2635.255) (-2638.933) (-2638.539) [-2635.009] -- 0:02:27 179000 -- [-2633.031] (-2634.822) (-2632.236) (-2644.367) * [-2630.637] (-2634.392) (-2638.381) (-2635.589) -- 0:02:26 179500 -- [-2634.710] (-2639.146) (-2636.106) (-2635.129) * (-2630.022) (-2632.329) [-2635.307] (-2635.760) -- 0:02:26 180000 -- (-2632.608) (-2645.057) [-2638.380] (-2633.082) * (-2636.740) (-2632.586) (-2640.760) [-2637.819] -- 0:02:25 Average standard deviation of split frequencies: 0.000000 180500 -- [-2632.579] (-2635.648) (-2638.197) (-2640.779) * [-2632.511] (-2632.909) (-2634.856) (-2634.311) -- 0:02:25 181000 -- (-2639.675) [-2633.080] (-2632.181) (-2637.021) * (-2636.915) [-2638.492] (-2636.221) (-2637.690) -- 0:02:24 181500 -- [-2636.108] (-2639.304) (-2639.477) (-2646.328) * [-2633.872] (-2635.863) (-2632.375) (-2632.414) -- 0:02:24 182000 -- (-2643.434) (-2634.334) (-2635.527) [-2637.240] * (-2637.913) (-2634.159) (-2631.973) [-2634.560] -- 0:02:23 182500 -- [-2636.139] (-2636.346) (-2637.393) (-2639.536) * [-2637.482] (-2632.863) (-2632.691) (-2631.958) -- 0:02:23 183000 -- [-2636.174] (-2639.684) (-2635.897) (-2634.754) * (-2634.512) (-2631.959) [-2632.912] (-2635.277) -- 0:02:22 183500 -- (-2632.949) (-2634.588) [-2633.958] (-2635.568) * (-2636.573) [-2637.867] (-2635.086) (-2640.977) -- 0:02:26 184000 -- (-2636.576) (-2634.721) (-2634.582) [-2642.640] * (-2636.312) (-2638.339) [-2636.183] (-2646.818) -- 0:02:26 184500 -- (-2641.666) (-2638.754) [-2632.895] (-2642.749) * (-2639.235) (-2637.748) [-2635.534] (-2636.196) -- 0:02:25 185000 -- [-2638.612] (-2639.261) (-2634.404) (-2638.108) * (-2634.264) (-2633.545) [-2633.251] (-2639.750) -- 0:02:25 Average standard deviation of split frequencies: 0.000000 185500 -- (-2635.333) (-2641.257) [-2633.637] (-2638.291) * (-2633.948) (-2633.373) [-2634.102] (-2637.972) -- 0:02:24 186000 -- (-2633.406) (-2636.451) (-2632.900) [-2638.804] * [-2641.491] (-2636.526) (-2638.945) (-2639.469) -- 0:02:24 186500 -- (-2635.502) [-2634.686] (-2631.271) (-2635.170) * (-2637.964) (-2634.419) [-2632.212] (-2641.372) -- 0:02:23 187000 -- [-2634.613] (-2644.895) (-2635.555) (-2635.690) * (-2640.101) [-2636.608] (-2634.729) (-2638.677) -- 0:02:23 187500 -- (-2635.621) (-2639.097) [-2636.761] (-2637.745) * (-2635.530) [-2630.026] (-2637.599) (-2632.290) -- 0:02:23 188000 -- (-2634.706) [-2643.267] (-2637.418) (-2635.314) * (-2635.165) [-2636.366] (-2637.370) (-2638.696) -- 0:02:22 188500 -- (-2633.455) (-2641.204) [-2634.024] (-2634.547) * (-2635.230) (-2640.113) [-2634.938] (-2635.960) -- 0:02:22 189000 -- (-2631.024) (-2642.192) (-2634.539) [-2635.594] * (-2640.688) (-2638.902) [-2634.088] (-2644.045) -- 0:02:25 189500 -- (-2641.182) (-2636.456) [-2634.065] (-2635.716) * (-2645.303) [-2634.360] (-2638.638) (-2637.343) -- 0:02:25 190000 -- [-2640.376] (-2633.809) (-2640.884) (-2636.801) * [-2637.272] (-2639.246) (-2638.298) (-2634.041) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 190500 -- (-2640.782) (-2634.011) (-2636.072) [-2634.888] * (-2636.967) (-2637.743) [-2634.130] (-2637.740) -- 0:02:24 191000 -- (-2633.688) [-2632.979] (-2639.473) (-2632.607) * (-2639.389) [-2639.422] (-2637.747) (-2632.512) -- 0:02:24 191500 -- (-2634.935) [-2632.324] (-2638.762) (-2635.872) * (-2638.429) [-2638.114] (-2633.823) (-2637.595) -- 0:02:23 192000 -- [-2634.361] (-2631.403) (-2637.359) (-2639.520) * (-2642.639) [-2638.223] (-2642.261) (-2633.050) -- 0:02:23 192500 -- (-2635.380) (-2637.945) [-2641.083] (-2632.339) * (-2636.034) (-2641.435) [-2630.203] (-2638.788) -- 0:02:22 193000 -- (-2632.807) [-2632.106] (-2642.467) (-2632.972) * [-2635.157] (-2639.533) (-2637.519) (-2636.908) -- 0:02:22 193500 -- (-2636.084) (-2639.364) (-2638.757) [-2634.474] * (-2635.967) (-2639.919) [-2631.898] (-2636.415) -- 0:02:21 194000 -- [-2637.372] (-2640.636) (-2633.552) (-2634.799) * (-2636.945) [-2637.416] (-2637.754) (-2632.025) -- 0:02:21 194500 -- (-2639.847) (-2636.808) (-2642.280) [-2636.339] * (-2631.372) (-2635.420) [-2637.918] (-2636.141) -- 0:02:24 195000 -- (-2643.062) (-2649.479) (-2640.200) [-2631.480] * (-2636.452) [-2637.206] (-2636.137) (-2637.457) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 195500 -- (-2642.742) (-2647.004) [-2640.615] (-2632.969) * (-2635.135) (-2642.640) [-2636.340] (-2636.906) -- 0:02:24 196000 -- (-2634.804) [-2635.475] (-2637.328) (-2632.271) * (-2640.065) [-2635.662] (-2638.182) (-2636.141) -- 0:02:23 196500 -- (-2635.373) (-2641.051) [-2637.803] (-2631.989) * (-2639.439) [-2636.105] (-2631.861) (-2638.316) -- 0:02:23 197000 -- (-2635.268) [-2640.345] (-2640.639) (-2637.345) * (-2638.146) (-2635.600) [-2637.224] (-2636.668) -- 0:02:22 197500 -- (-2637.718) [-2640.013] (-2634.622) (-2634.695) * (-2639.618) (-2635.158) (-2643.383) [-2631.522] -- 0:02:22 198000 -- (-2631.409) (-2642.471) [-2641.782] (-2632.190) * (-2630.831) (-2635.546) (-2634.933) [-2633.666] -- 0:02:21 198500 -- (-2640.745) (-2636.029) [-2635.986] (-2631.540) * (-2639.109) (-2636.538) (-2636.346) [-2639.221] -- 0:02:21 199000 -- (-2640.405) [-2635.587] (-2638.162) (-2633.631) * (-2635.155) [-2637.043] (-2636.882) (-2637.423) -- 0:02:20 199500 -- [-2636.129] (-2639.156) (-2635.471) (-2631.725) * (-2634.696) (-2634.427) [-2635.763] (-2636.967) -- 0:02:20 200000 -- (-2632.860) [-2640.306] (-2638.822) (-2635.312) * (-2638.908) [-2632.726] (-2634.192) (-2638.414) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 200500 -- (-2631.540) (-2639.903) [-2633.474] (-2639.485) * (-2635.262) (-2637.339) [-2635.162] (-2636.342) -- 0:02:23 201000 -- [-2636.663] (-2640.603) (-2633.480) (-2634.404) * [-2637.169] (-2637.095) (-2632.221) (-2637.969) -- 0:02:23 201500 -- (-2632.942) [-2633.491] (-2632.563) (-2636.170) * (-2633.644) (-2643.079) [-2638.088] (-2636.073) -- 0:02:22 202000 -- [-2631.629] (-2635.228) (-2634.643) (-2639.476) * (-2634.874) [-2634.526] (-2636.977) (-2635.089) -- 0:02:22 202500 -- (-2638.418) (-2637.514) (-2635.860) [-2639.308] * (-2630.281) (-2634.741) [-2633.706] (-2638.727) -- 0:02:21 203000 -- [-2632.715] (-2635.976) (-2636.930) (-2645.125) * (-2629.350) (-2631.179) [-2634.741] (-2635.411) -- 0:02:21 203500 -- [-2630.698] (-2631.605) (-2636.374) (-2636.160) * (-2631.166) (-2636.251) [-2634.040] (-2637.870) -- 0:02:20 204000 -- (-2635.221) [-2635.570] (-2635.686) (-2638.054) * [-2633.752] (-2634.686) (-2634.595) (-2634.804) -- 0:02:20 204500 -- (-2637.416) (-2632.188) (-2640.740) [-2634.227] * [-2630.119] (-2639.999) (-2629.446) (-2645.700) -- 0:02:20 205000 -- (-2638.753) (-2640.484) (-2635.457) [-2631.910] * (-2639.816) (-2635.049) (-2631.995) [-2635.687] -- 0:02:19 Average standard deviation of split frequencies: 0.000000 205500 -- (-2636.867) (-2632.284) [-2638.403] (-2635.018) * (-2633.352) (-2634.056) [-2639.884] (-2632.921) -- 0:02:19 206000 -- (-2634.355) [-2635.934] (-2639.839) (-2640.250) * [-2635.252] (-2634.575) (-2642.309) (-2633.632) -- 0:02:22 206500 -- (-2638.049) (-2635.329) [-2637.209] (-2633.062) * (-2634.948) (-2632.494) [-2638.479] (-2633.606) -- 0:02:22 207000 -- (-2637.384) [-2632.790] (-2642.941) (-2638.572) * (-2634.425) (-2634.938) [-2636.081] (-2633.229) -- 0:02:21 207500 -- (-2640.070) [-2637.600] (-2635.973) (-2632.030) * [-2633.776] (-2631.913) (-2636.128) (-2636.008) -- 0:02:21 208000 -- (-2638.385) (-2635.565) (-2634.063) [-2633.613] * [-2633.300] (-2631.802) (-2630.786) (-2637.409) -- 0:02:20 208500 -- (-2636.866) (-2636.550) [-2632.018] (-2636.492) * (-2630.299) [-2634.994] (-2636.447) (-2636.021) -- 0:02:20 209000 -- (-2632.352) [-2640.544] (-2643.767) (-2631.934) * (-2633.438) [-2632.572] (-2637.652) (-2635.641) -- 0:02:20 209500 -- (-2631.593) (-2634.185) (-2638.599) [-2631.850] * (-2635.335) (-2631.122) (-2638.639) [-2640.332] -- 0:02:19 210000 -- (-2638.667) (-2630.964) (-2637.251) [-2636.860] * (-2639.987) [-2633.273] (-2636.815) (-2635.523) -- 0:02:19 Average standard deviation of split frequencies: 0.000000 210500 -- (-2649.173) (-2638.784) (-2634.447) [-2635.567] * (-2637.596) (-2634.679) [-2634.184] (-2637.872) -- 0:02:18 211000 -- (-2637.685) (-2633.186) (-2632.021) [-2636.911] * (-2639.001) (-2638.303) [-2633.252] (-2637.021) -- 0:02:18 211500 -- [-2636.920] (-2638.643) (-2635.764) (-2639.782) * (-2644.678) (-2632.127) (-2636.120) [-2632.129] -- 0:02:21 212000 -- (-2635.306) (-2629.979) (-2639.020) [-2632.605] * (-2641.963) [-2634.396] (-2634.959) (-2637.759) -- 0:02:21 212500 -- (-2640.575) (-2641.885) (-2638.212) [-2633.768] * (-2641.527) (-2635.415) (-2639.624) [-2633.836] -- 0:02:20 213000 -- (-2638.126) [-2635.471] (-2636.704) (-2637.972) * (-2638.164) (-2637.845) [-2633.405] (-2635.650) -- 0:02:20 213500 -- [-2643.587] (-2636.927) (-2635.184) (-2641.612) * (-2638.990) (-2634.347) (-2630.651) [-2633.462] -- 0:02:19 214000 -- (-2637.172) (-2639.852) [-2638.262] (-2642.282) * (-2640.731) (-2637.082) [-2640.615] (-2637.739) -- 0:02:19 214500 -- [-2637.442] (-2634.775) (-2638.414) (-2638.722) * (-2633.625) (-2636.591) (-2634.663) [-2637.025] -- 0:02:19 215000 -- [-2637.639] (-2642.399) (-2640.980) (-2643.484) * (-2631.109) (-2635.151) (-2637.146) [-2632.636] -- 0:02:18 Average standard deviation of split frequencies: 0.000000 215500 -- (-2636.273) [-2633.932] (-2638.724) (-2636.655) * (-2630.631) (-2638.003) [-2633.012] (-2637.367) -- 0:02:18 216000 -- (-2633.157) (-2635.713) (-2643.000) [-2631.471] * (-2631.938) (-2637.960) [-2631.759] (-2639.855) -- 0:02:17 216500 -- [-2635.294] (-2635.902) (-2638.316) (-2634.238) * (-2641.597) [-2632.005] (-2634.137) (-2635.342) -- 0:02:17 217000 -- (-2635.903) (-2636.864) [-2636.792] (-2632.905) * [-2638.384] (-2636.673) (-2637.614) (-2639.201) -- 0:02:20 217500 -- (-2633.236) (-2638.842) (-2635.687) [-2631.946] * (-2634.391) (-2638.373) (-2635.534) [-2630.167] -- 0:02:20 218000 -- (-2637.269) [-2637.103] (-2637.788) (-2636.877) * (-2634.571) (-2642.568) (-2635.595) [-2633.113] -- 0:02:19 218500 -- [-2632.973] (-2639.449) (-2629.853) (-2639.176) * (-2634.490) [-2643.023] (-2643.806) (-2635.086) -- 0:02:19 219000 -- (-2635.063) [-2633.908] (-2637.300) (-2638.710) * [-2632.992] (-2636.338) (-2635.440) (-2633.958) -- 0:02:19 219500 -- (-2636.303) (-2635.900) (-2636.477) [-2639.573] * [-2637.944] (-2636.011) (-2636.159) (-2636.949) -- 0:02:18 220000 -- [-2634.512] (-2636.476) (-2639.534) (-2635.965) * (-2634.951) (-2636.570) (-2637.644) [-2631.427] -- 0:02:18 Average standard deviation of split frequencies: 0.000000 220500 -- [-2635.654] (-2635.109) (-2637.655) (-2641.397) * (-2638.651) [-2638.521] (-2637.593) (-2638.782) -- 0:02:17 221000 -- (-2639.452) [-2634.217] (-2632.616) (-2634.193) * (-2630.384) [-2633.238] (-2634.532) (-2632.149) -- 0:02:17 221500 -- (-2639.594) (-2632.689) [-2631.509] (-2634.522) * (-2633.728) (-2635.113) [-2633.558] (-2637.214) -- 0:02:17 222000 -- (-2632.948) (-2637.294) (-2636.592) [-2632.480] * (-2639.212) [-2633.593] (-2643.878) (-2639.629) -- 0:02:16 222500 -- (-2636.446) (-2640.369) (-2637.367) [-2638.421] * (-2638.847) [-2638.090] (-2638.958) (-2639.119) -- 0:02:16 223000 -- (-2639.931) [-2637.514] (-2640.866) (-2633.122) * (-2636.537) (-2639.448) (-2631.629) [-2635.949] -- 0:02:19 223500 -- [-2636.462] (-2647.714) (-2634.068) (-2635.814) * (-2640.491) (-2635.917) [-2637.078] (-2632.653) -- 0:02:18 224000 -- (-2635.554) (-2638.744) (-2638.209) [-2633.123] * (-2636.091) (-2635.155) [-2639.189] (-2642.485) -- 0:02:18 224500 -- (-2634.656) (-2634.293) (-2637.927) [-2633.296] * [-2634.898] (-2637.934) (-2640.315) (-2632.818) -- 0:02:18 225000 -- [-2634.346] (-2634.993) (-2633.956) (-2632.995) * [-2631.510] (-2629.313) (-2633.257) (-2636.996) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 225500 -- [-2633.866] (-2635.730) (-2637.501) (-2640.031) * (-2639.173) (-2632.005) [-2634.159] (-2643.854) -- 0:02:17 226000 -- (-2641.986) (-2641.339) (-2636.558) [-2635.670] * (-2632.435) (-2632.583) (-2634.540) [-2632.471] -- 0:02:16 226500 -- [-2632.084] (-2631.394) (-2634.584) (-2638.530) * [-2636.208] (-2634.050) (-2637.472) (-2635.636) -- 0:02:16 227000 -- (-2637.873) [-2633.004] (-2640.351) (-2636.168) * (-2637.361) [-2632.627] (-2633.404) (-2635.937) -- 0:02:16 227500 -- (-2634.007) (-2639.472) (-2646.633) [-2637.075] * (-2634.711) (-2633.245) (-2635.756) [-2638.484] -- 0:02:15 228000 -- (-2634.475) [-2644.304] (-2637.651) (-2636.187) * (-2634.050) (-2634.272) [-2637.781] (-2636.379) -- 0:02:15 228500 -- [-2633.000] (-2636.760) (-2640.984) (-2635.205) * [-2631.695] (-2632.389) (-2634.967) (-2633.645) -- 0:02:18 229000 -- (-2630.452) (-2634.976) [-2638.046] (-2635.065) * (-2633.025) (-2636.994) (-2636.831) [-2635.107] -- 0:02:18 229500 -- (-2632.620) (-2638.957) [-2632.280] (-2633.094) * (-2634.938) (-2632.171) [-2640.893] (-2647.830) -- 0:02:17 230000 -- (-2638.158) (-2638.305) (-2639.750) [-2633.960] * (-2638.791) [-2640.664] (-2631.723) (-2641.557) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 230500 -- [-2632.290] (-2642.573) (-2648.919) (-2636.611) * (-2639.385) (-2636.353) [-2634.663] (-2636.651) -- 0:02:16 231000 -- (-2640.298) [-2635.552] (-2635.907) (-2642.890) * (-2641.206) [-2637.064] (-2636.344) (-2636.858) -- 0:02:16 231500 -- (-2638.365) (-2639.944) (-2637.147) [-2633.463] * (-2636.608) [-2637.882] (-2636.360) (-2636.120) -- 0:02:16 232000 -- (-2637.819) [-2634.829] (-2635.429) (-2636.456) * (-2633.781) [-2632.813] (-2633.037) (-2643.704) -- 0:02:15 232500 -- (-2638.920) (-2636.949) (-2630.969) [-2632.736] * (-2641.966) [-2638.074] (-2635.330) (-2636.887) -- 0:02:15 233000 -- (-2641.860) [-2631.858] (-2632.346) (-2637.096) * (-2633.648) [-2637.273] (-2631.368) (-2638.592) -- 0:02:14 233500 -- (-2644.775) (-2637.077) (-2636.828) [-2633.582] * (-2637.738) [-2639.368] (-2640.510) (-2638.223) -- 0:02:14 234000 -- [-2637.480] (-2639.807) (-2641.702) (-2633.693) * (-2638.688) [-2637.078] (-2636.744) (-2642.725) -- 0:02:17 234500 -- (-2633.029) [-2638.937] (-2641.785) (-2643.693) * (-2638.528) (-2636.570) [-2636.415] (-2636.009) -- 0:02:17 235000 -- (-2634.531) (-2636.041) (-2646.165) [-2636.389] * (-2633.721) (-2635.937) [-2632.451] (-2633.492) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 235500 -- (-2634.945) (-2642.438) (-2640.553) [-2639.714] * [-2634.684] (-2634.250) (-2642.936) (-2640.195) -- 0:02:16 236000 -- (-2637.814) (-2632.430) (-2638.785) [-2638.118] * (-2635.662) (-2637.396) (-2635.716) [-2638.015] -- 0:02:15 236500 -- (-2636.041) [-2634.385] (-2644.622) (-2638.704) * (-2633.486) [-2635.204] (-2643.111) (-2640.193) -- 0:02:15 237000 -- [-2634.691] (-2632.374) (-2634.119) (-2634.380) * [-2634.928] (-2638.372) (-2649.372) (-2631.136) -- 0:02:15 237500 -- (-2638.632) (-2642.699) (-2638.720) [-2633.916] * (-2636.126) [-2631.613] (-2642.688) (-2636.754) -- 0:02:14 238000 -- (-2638.168) (-2635.291) (-2635.344) [-2636.165] * [-2632.110] (-2635.576) (-2636.248) (-2640.226) -- 0:02:14 238500 -- (-2635.956) (-2634.842) [-2636.958] (-2637.328) * (-2638.115) [-2637.096] (-2640.040) (-2632.827) -- 0:02:14 239000 -- (-2632.452) (-2632.299) [-2630.884] (-2631.706) * (-2638.769) [-2637.166] (-2638.854) (-2632.294) -- 0:02:13 239500 -- (-2633.877) (-2641.040) (-2640.214) [-2636.151] * (-2633.142) [-2637.317] (-2639.787) (-2639.940) -- 0:02:13 240000 -- (-2634.055) [-2635.920] (-2635.104) (-2638.839) * (-2632.472) (-2637.386) (-2634.661) [-2633.542] -- 0:02:16 Average standard deviation of split frequencies: 0.000000 240500 -- [-2636.439] (-2632.552) (-2636.725) (-2641.409) * (-2634.115) [-2636.430] (-2634.944) (-2635.507) -- 0:02:15 241000 -- (-2635.241) (-2633.035) (-2638.152) [-2632.852] * (-2634.428) (-2633.382) (-2634.327) [-2635.772] -- 0:02:15 241500 -- (-2635.049) [-2629.794] (-2632.060) (-2636.329) * (-2633.814) [-2636.325] (-2635.558) (-2637.468) -- 0:02:15 242000 -- (-2634.888) (-2640.694) [-2640.927] (-2637.405) * (-2632.288) (-2634.431) [-2635.751] (-2641.793) -- 0:02:14 242500 -- (-2637.414) [-2638.070] (-2634.330) (-2635.348) * (-2632.329) (-2631.902) (-2636.375) [-2638.649] -- 0:02:14 243000 -- [-2638.955] (-2641.566) (-2638.000) (-2634.889) * (-2634.816) [-2634.445] (-2642.475) (-2632.156) -- 0:02:13 243500 -- (-2636.071) (-2636.307) (-2634.701) [-2639.188] * (-2644.821) [-2632.385] (-2640.029) (-2631.935) -- 0:02:13 244000 -- (-2635.717) [-2634.236] (-2634.004) (-2641.523) * (-2638.899) (-2633.022) (-2637.199) [-2633.819] -- 0:02:13 244500 -- (-2635.800) (-2636.590) (-2636.017) [-2635.787] * (-2633.945) (-2636.615) [-2631.540] (-2644.616) -- 0:02:12 245000 -- [-2635.079] (-2633.842) (-2631.575) (-2637.322) * (-2637.443) [-2633.658] (-2643.149) (-2640.938) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 245500 -- [-2634.268] (-2633.493) (-2635.194) (-2637.836) * (-2635.116) [-2632.845] (-2631.676) (-2635.433) -- 0:02:15 246000 -- [-2632.435] (-2634.669) (-2639.318) (-2634.507) * [-2635.807] (-2636.090) (-2632.270) (-2644.756) -- 0:02:14 246500 -- (-2635.188) (-2638.122) (-2635.303) [-2635.862] * [-2633.405] (-2633.237) (-2633.410) (-2645.454) -- 0:02:14 247000 -- (-2636.174) (-2637.506) (-2635.501) [-2634.020] * [-2635.431] (-2639.249) (-2640.242) (-2651.575) -- 0:02:14 247500 -- (-2638.874) (-2637.032) (-2641.255) [-2636.837] * [-2636.058] (-2635.598) (-2635.015) (-2638.757) -- 0:02:13 248000 -- (-2634.487) [-2637.064] (-2643.122) (-2637.954) * (-2636.932) [-2631.620] (-2633.871) (-2632.782) -- 0:02:13 248500 -- (-2633.375) (-2637.594) (-2643.204) [-2635.934] * [-2641.787] (-2635.321) (-2636.224) (-2646.164) -- 0:02:13 249000 -- (-2636.513) (-2635.247) (-2635.398) [-2639.045] * (-2634.885) (-2639.041) (-2634.953) [-2647.159] -- 0:02:12 249500 -- (-2633.185) [-2639.110] (-2638.662) (-2636.070) * (-2635.750) (-2633.455) [-2634.418] (-2638.321) -- 0:02:12 250000 -- (-2632.759) [-2640.994] (-2636.349) (-2637.106) * (-2636.453) (-2631.752) [-2631.818] (-2637.824) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 250500 -- (-2638.596) (-2642.634) [-2638.500] (-2636.614) * (-2632.735) [-2631.264] (-2631.129) (-2632.152) -- 0:02:11 251000 -- (-2638.320) [-2638.227] (-2636.860) (-2637.669) * (-2640.315) (-2636.141) (-2631.256) [-2638.958] -- 0:02:14 251500 -- (-2638.496) (-2636.364) [-2640.074] (-2639.111) * [-2641.134] (-2635.295) (-2630.985) (-2638.643) -- 0:02:13 252000 -- (-2637.858) (-2636.971) (-2632.525) [-2636.287] * [-2634.168] (-2645.534) (-2634.131) (-2635.896) -- 0:02:13 252500 -- (-2642.437) (-2632.838) (-2633.995) [-2637.513] * (-2633.801) (-2642.863) (-2635.098) [-2632.588] -- 0:02:13 253000 -- [-2640.982] (-2632.701) (-2633.846) (-2638.939) * (-2634.932) (-2639.720) (-2634.384) [-2634.781] -- 0:02:12 253500 -- (-2639.760) [-2642.463] (-2634.690) (-2642.342) * (-2635.993) (-2634.171) (-2633.083) [-2641.259] -- 0:02:12 254000 -- (-2641.864) [-2632.806] (-2636.323) (-2634.394) * [-2634.437] (-2634.822) (-2639.360) (-2638.062) -- 0:02:12 254500 -- [-2640.144] (-2637.839) (-2639.416) (-2634.946) * [-2639.083] (-2637.366) (-2640.323) (-2644.624) -- 0:02:11 255000 -- (-2635.826) (-2633.857) (-2635.831) [-2631.748] * (-2638.140) [-2635.906] (-2639.151) (-2634.355) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 255500 -- (-2637.451) [-2632.925] (-2639.578) (-2637.947) * (-2637.936) (-2633.541) (-2632.701) [-2634.173] -- 0:02:11 256000 -- (-2635.323) [-2633.236] (-2635.995) (-2634.684) * [-2636.372] (-2638.355) (-2634.001) (-2637.824) -- 0:02:10 256500 -- (-2640.212) (-2633.828) (-2639.071) [-2638.590] * (-2642.012) (-2643.238) [-2629.823] (-2634.070) -- 0:02:13 257000 -- (-2635.410) (-2640.929) (-2633.371) [-2637.380] * (-2636.075) (-2635.857) [-2632.986] (-2643.420) -- 0:02:12 257500 -- (-2641.041) (-2641.461) [-2632.070] (-2634.308) * (-2636.291) (-2632.995) [-2632.942] (-2636.172) -- 0:02:12 258000 -- (-2635.225) [-2635.454] (-2633.619) (-2646.598) * (-2636.463) (-2641.131) (-2634.712) [-2632.462] -- 0:02:12 258500 -- (-2633.944) [-2632.959] (-2636.828) (-2643.605) * [-2639.165] (-2635.702) (-2638.604) (-2629.278) -- 0:02:11 259000 -- [-2635.746] (-2634.864) (-2643.797) (-2640.329) * [-2631.343] (-2636.489) (-2638.217) (-2637.291) -- 0:02:11 259500 -- (-2633.206) (-2635.408) [-2634.813] (-2641.073) * [-2631.248] (-2642.796) (-2633.689) (-2634.589) -- 0:02:11 260000 -- (-2635.121) (-2641.742) (-2639.539) [-2636.536] * (-2640.097) (-2635.791) [-2634.184] (-2634.655) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 260500 -- (-2635.193) (-2638.612) [-2633.761] (-2636.574) * (-2643.409) (-2636.249) (-2631.055) [-2633.195] -- 0:02:10 261000 -- (-2641.801) (-2635.533) (-2637.270) [-2643.839] * (-2630.579) (-2633.838) [-2635.915] (-2637.310) -- 0:02:10 261500 -- (-2633.877) (-2636.090) (-2639.373) [-2632.026] * [-2632.556] (-2640.868) (-2640.181) (-2636.710) -- 0:02:09 262000 -- [-2639.409] (-2638.044) (-2634.999) (-2634.111) * (-2633.647) (-2633.040) (-2640.892) [-2636.541] -- 0:02:12 262500 -- (-2634.897) (-2634.788) (-2637.444) [-2632.009] * (-2637.096) [-2631.836] (-2638.952) (-2635.888) -- 0:02:12 263000 -- (-2634.488) (-2633.157) (-2636.527) [-2632.043] * (-2631.513) (-2636.352) (-2635.726) [-2635.878] -- 0:02:11 263500 -- [-2632.267] (-2629.990) (-2632.316) (-2636.035) * (-2633.447) (-2636.085) [-2632.099] (-2633.451) -- 0:02:11 264000 -- [-2633.785] (-2637.816) (-2633.255) (-2637.104) * (-2633.319) [-2635.882] (-2635.047) (-2641.928) -- 0:02:11 264500 -- (-2634.403) (-2632.780) (-2634.968) [-2633.612] * [-2638.582] (-2638.438) (-2639.879) (-2637.603) -- 0:02:10 265000 -- (-2634.402) [-2634.091] (-2636.192) (-2638.476) * (-2636.417) (-2636.481) (-2637.517) [-2633.279] -- 0:02:10 Average standard deviation of split frequencies: 0.000000 265500 -- [-2632.285] (-2636.835) (-2634.860) (-2636.854) * [-2633.110] (-2635.788) (-2630.628) (-2634.219) -- 0:02:10 266000 -- (-2635.209) [-2635.637] (-2636.441) (-2646.353) * (-2637.631) (-2630.612) (-2637.696) [-2632.201] -- 0:02:09 266500 -- [-2636.664] (-2639.616) (-2638.385) (-2645.452) * [-2642.385] (-2642.578) (-2637.898) (-2639.667) -- 0:02:09 267000 -- (-2638.634) (-2640.970) (-2635.116) [-2637.637] * (-2638.987) [-2634.705] (-2640.840) (-2634.267) -- 0:02:09 267500 -- [-2630.900] (-2640.814) (-2635.413) (-2635.474) * (-2637.698) (-2632.157) [-2634.324] (-2632.582) -- 0:02:08 268000 -- (-2636.580) (-2635.423) (-2636.286) [-2633.351] * [-2642.342] (-2633.939) (-2634.054) (-2634.873) -- 0:02:11 268500 -- (-2644.604) [-2633.199] (-2640.507) (-2642.004) * (-2640.232) (-2637.299) (-2635.219) [-2635.100] -- 0:02:10 269000 -- (-2647.668) [-2636.608] (-2638.086) (-2636.779) * [-2637.737] (-2634.738) (-2635.719) (-2629.006) -- 0:02:10 269500 -- (-2643.159) [-2632.910] (-2641.679) (-2633.061) * (-2644.316) (-2632.012) [-2637.939] (-2633.841) -- 0:02:10 270000 -- (-2637.622) (-2634.663) [-2633.861] (-2640.281) * (-2641.673) (-2634.744) (-2635.593) [-2635.569] -- 0:02:09 Average standard deviation of split frequencies: 0.000000 270500 -- (-2640.716) [-2637.550] (-2634.606) (-2639.235) * (-2645.209) (-2634.574) [-2637.756] (-2633.991) -- 0:02:09 271000 -- (-2635.223) [-2636.640] (-2631.136) (-2633.132) * [-2636.408] (-2647.098) (-2634.818) (-2633.781) -- 0:02:09 271500 -- (-2634.027) (-2634.324) (-2634.593) [-2635.488] * [-2636.002] (-2639.977) (-2632.930) (-2634.937) -- 0:02:08 272000 -- (-2634.618) (-2639.409) (-2629.363) [-2636.957] * (-2633.538) (-2633.233) [-2631.762] (-2637.365) -- 0:02:08 272500 -- (-2636.742) [-2639.114] (-2634.570) (-2643.543) * [-2632.530] (-2635.975) (-2634.803) (-2634.311) -- 0:02:08 273000 -- (-2639.259) (-2635.615) [-2633.454] (-2632.767) * (-2632.881) (-2634.711) [-2635.055] (-2637.610) -- 0:02:07 273500 -- (-2637.560) [-2640.221] (-2635.132) (-2636.387) * (-2633.469) (-2632.828) [-2632.839] (-2633.966) -- 0:02:10 274000 -- (-2632.506) (-2633.618) [-2635.934] (-2635.365) * (-2634.875) [-2634.000] (-2638.558) (-2640.246) -- 0:02:09 274500 -- (-2633.508) [-2633.814] (-2632.212) (-2634.751) * (-2640.433) (-2632.679) (-2645.383) [-2635.113] -- 0:02:09 275000 -- (-2632.045) (-2634.705) [-2636.665] (-2633.133) * (-2635.313) (-2631.645) [-2637.748] (-2639.927) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 275500 -- (-2635.035) (-2637.983) [-2632.146] (-2633.743) * (-2632.238) (-2631.965) (-2640.716) [-2632.466] -- 0:02:08 276000 -- (-2635.868) (-2640.285) (-2632.184) [-2636.722] * (-2635.836) [-2634.399] (-2637.482) (-2633.422) -- 0:02:08 276500 -- (-2631.950) (-2634.160) [-2632.052] (-2639.795) * (-2634.885) [-2643.570] (-2638.770) (-2633.481) -- 0:02:08 277000 -- (-2639.138) [-2631.146] (-2632.029) (-2629.752) * (-2638.108) [-2632.578] (-2635.080) (-2633.690) -- 0:02:07 277500 -- [-2632.795] (-2635.777) (-2634.558) (-2639.065) * (-2644.444) [-2633.841] (-2635.919) (-2635.033) -- 0:02:07 278000 -- (-2634.094) (-2635.070) (-2638.134) [-2633.966] * (-2640.226) [-2632.842] (-2636.548) (-2639.191) -- 0:02:07 278500 -- [-2636.767] (-2633.636) (-2642.179) (-2642.292) * (-2639.061) (-2631.523) (-2640.989) [-2638.985] -- 0:02:06 279000 -- (-2637.131) (-2635.203) [-2638.620] (-2633.308) * (-2632.484) (-2633.363) [-2634.362] (-2636.219) -- 0:02:09 279500 -- (-2637.619) (-2637.489) (-2639.610) [-2636.490] * (-2629.792) (-2633.987) (-2634.740) [-2633.602] -- 0:02:08 280000 -- [-2632.061] (-2633.856) (-2640.068) (-2639.910) * (-2633.493) [-2636.463] (-2639.099) (-2634.981) -- 0:02:08 Average standard deviation of split frequencies: 0.000000 280500 -- [-2636.019] (-2632.595) (-2646.450) (-2636.380) * (-2632.378) [-2632.564] (-2633.701) (-2634.909) -- 0:02:08 281000 -- (-2635.617) [-2635.530] (-2641.853) (-2635.019) * (-2635.711) (-2635.403) (-2632.310) [-2630.790] -- 0:02:07 281500 -- (-2636.518) (-2631.034) [-2632.012] (-2633.709) * [-2635.158] (-2638.258) (-2631.812) (-2633.204) -- 0:02:07 282000 -- [-2632.983] (-2633.190) (-2641.633) (-2634.474) * (-2631.270) [-2634.893] (-2640.975) (-2639.746) -- 0:02:07 282500 -- [-2636.653] (-2638.598) (-2636.199) (-2633.730) * (-2636.657) (-2632.445) [-2633.812] (-2634.056) -- 0:02:06 283000 -- (-2644.673) (-2633.182) [-2638.347] (-2633.762) * (-2637.981) (-2641.896) [-2635.726] (-2634.936) -- 0:02:06 283500 -- [-2632.637] (-2637.035) (-2639.993) (-2636.121) * (-2636.142) [-2633.149] (-2632.430) (-2636.828) -- 0:02:06 284000 -- [-2633.767] (-2634.079) (-2643.158) (-2644.001) * (-2639.574) (-2635.970) [-2637.385] (-2639.379) -- 0:02:06 284500 -- (-2635.094) [-2635.558] (-2637.219) (-2635.224) * (-2631.757) (-2638.153) (-2634.151) [-2632.044] -- 0:02:08 285000 -- (-2633.671) (-2632.640) (-2643.348) [-2634.408] * [-2634.382] (-2638.634) (-2634.120) (-2634.723) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 285500 -- (-2633.673) [-2634.227] (-2636.584) (-2635.315) * (-2639.966) (-2638.394) [-2634.426] (-2635.797) -- 0:02:07 286000 -- (-2633.271) (-2633.594) [-2633.996] (-2636.851) * (-2637.550) [-2633.374] (-2635.181) (-2638.659) -- 0:02:07 286500 -- [-2635.432] (-2638.647) (-2641.923) (-2639.446) * (-2633.880) (-2634.188) (-2638.456) [-2638.124] -- 0:02:07 287000 -- (-2628.471) [-2635.611] (-2641.325) (-2640.359) * (-2631.102) [-2631.565] (-2634.370) (-2640.582) -- 0:02:06 287500 -- (-2635.531) (-2638.827) [-2639.419] (-2641.232) * (-2634.861) (-2633.041) [-2636.286] (-2637.966) -- 0:02:06 288000 -- (-2631.890) [-2635.200] (-2630.683) (-2636.804) * (-2631.215) (-2632.901) [-2639.244] (-2635.718) -- 0:02:06 288500 -- [-2632.455] (-2638.298) (-2636.553) (-2636.982) * (-2635.565) (-2635.425) [-2634.447] (-2634.709) -- 0:02:05 289000 -- (-2635.129) (-2636.039) [-2636.748] (-2639.789) * [-2635.152] (-2633.516) (-2634.971) (-2633.901) -- 0:02:05 289500 -- (-2635.077) (-2637.236) [-2642.126] (-2644.237) * (-2637.795) (-2631.732) [-2633.095] (-2636.837) -- 0:02:05 290000 -- (-2634.572) (-2631.637) (-2642.680) [-2638.392] * [-2642.495] (-2634.243) (-2641.351) (-2638.814) -- 0:02:04 Average standard deviation of split frequencies: 0.000000 290500 -- (-2632.161) (-2632.616) [-2639.478] (-2631.857) * (-2637.044) (-2634.386) [-2640.102] (-2635.331) -- 0:02:07 291000 -- (-2638.169) [-2634.172] (-2634.855) (-2638.742) * (-2637.176) [-2631.710] (-2641.710) (-2638.791) -- 0:02:06 291500 -- (-2635.322) (-2633.733) [-2633.287] (-2636.081) * [-2632.377] (-2635.951) (-2642.070) (-2636.355) -- 0:02:06 292000 -- (-2635.071) [-2634.516] (-2636.126) (-2635.052) * [-2632.022] (-2636.838) (-2638.958) (-2633.594) -- 0:02:06 292500 -- [-2633.447] (-2638.950) (-2633.367) (-2635.189) * (-2634.415) (-2633.977) [-2636.239] (-2632.378) -- 0:02:05 293000 -- (-2632.323) (-2634.041) (-2638.004) [-2632.361] * [-2634.189] (-2630.504) (-2637.166) (-2635.862) -- 0:02:05 293500 -- (-2635.775) (-2635.620) [-2636.020] (-2634.313) * [-2633.065] (-2636.216) (-2642.372) (-2637.135) -- 0:02:05 294000 -- (-2637.086) (-2637.725) (-2634.018) [-2637.884] * (-2637.044) [-2636.671] (-2636.628) (-2642.135) -- 0:02:04 294500 -- [-2633.054] (-2637.117) (-2632.635) (-2638.610) * (-2633.718) (-2632.685) [-2638.977] (-2640.605) -- 0:02:04 295000 -- (-2635.619) [-2635.742] (-2635.561) (-2641.807) * (-2631.751) [-2635.002] (-2638.355) (-2637.102) -- 0:02:04 Average standard deviation of split frequencies: 0.000000 295500 -- (-2644.197) (-2635.880) (-2636.068) [-2633.187] * [-2633.834] (-2633.503) (-2637.382) (-2634.567) -- 0:02:03 296000 -- (-2635.958) (-2637.724) (-2637.767) [-2634.160] * (-2637.170) (-2632.469) (-2639.643) [-2634.125] -- 0:02:06 296500 -- (-2635.178) [-2634.398] (-2635.322) (-2635.840) * (-2636.361) (-2634.983) [-2635.385] (-2633.201) -- 0:02:05 297000 -- (-2636.085) (-2637.332) [-2633.153] (-2640.005) * (-2643.854) [-2631.933] (-2634.852) (-2634.942) -- 0:02:05 297500 -- (-2637.535) (-2637.006) (-2634.101) [-2638.487] * [-2633.116] (-2635.447) (-2638.654) (-2632.702) -- 0:02:05 298000 -- (-2631.185) (-2635.460) (-2632.725) [-2636.720] * (-2640.511) (-2636.544) [-2631.476] (-2636.544) -- 0:02:04 298500 -- (-2631.030) (-2632.500) [-2639.758] (-2638.816) * (-2640.732) [-2639.952] (-2631.167) (-2637.848) -- 0:02:04 299000 -- (-2641.179) (-2637.365) [-2639.362] (-2637.673) * (-2636.130) [-2634.894] (-2632.384) (-2632.690) -- 0:02:04 299500 -- (-2633.415) (-2633.546) (-2637.615) [-2645.237] * (-2633.328) (-2637.442) (-2632.748) [-2631.285] -- 0:02:03 300000 -- (-2636.267) (-2634.448) (-2637.200) [-2639.317] * (-2639.146) [-2635.126] (-2640.165) (-2637.097) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 300500 -- [-2629.741] (-2631.437) (-2639.548) (-2637.244) * (-2636.753) [-2629.626] (-2638.123) (-2635.199) -- 0:02:03 301000 -- [-2631.502] (-2634.399) (-2635.302) (-2635.019) * (-2636.600) (-2633.655) (-2641.987) [-2634.518] -- 0:02:03 301500 -- (-2631.865) (-2640.719) (-2632.305) [-2636.618] * [-2633.569] (-2641.264) (-2647.882) (-2636.590) -- 0:02:05 302000 -- (-2639.838) [-2637.865] (-2635.232) (-2637.578) * (-2641.413) [-2634.991] (-2641.864) (-2633.631) -- 0:02:04 302500 -- [-2638.933] (-2641.426) (-2635.064) (-2636.500) * (-2634.375) [-2638.681] (-2643.232) (-2631.279) -- 0:02:04 303000 -- (-2640.572) [-2639.809] (-2636.404) (-2636.002) * [-2637.075] (-2637.710) (-2637.467) (-2632.308) -- 0:02:04 303500 -- (-2639.800) [-2634.848] (-2633.135) (-2643.961) * (-2641.433) [-2634.381] (-2638.202) (-2639.667) -- 0:02:03 304000 -- (-2635.087) [-2641.003] (-2633.755) (-2636.904) * (-2632.399) (-2641.384) [-2635.500] (-2632.770) -- 0:02:03 304500 -- (-2631.362) [-2635.706] (-2640.711) (-2645.114) * (-2636.905) (-2640.289) (-2636.083) [-2635.642] -- 0:02:03 305000 -- (-2637.368) [-2635.810] (-2642.096) (-2638.258) * (-2636.893) (-2644.154) (-2634.109) [-2633.381] -- 0:02:03 Average standard deviation of split frequencies: 0.000000 305500 -- [-2639.348] (-2634.454) (-2634.002) (-2631.849) * (-2634.683) (-2635.061) [-2635.925] (-2646.083) -- 0:02:02 306000 -- [-2635.783] (-2633.597) (-2637.578) (-2632.664) * (-2630.830) [-2633.016] (-2637.356) (-2634.544) -- 0:02:02 306500 -- (-2633.075) (-2634.916) [-2636.606] (-2635.925) * (-2632.945) [-2638.164] (-2638.279) (-2636.067) -- 0:02:02 307000 -- [-2638.750] (-2639.123) (-2640.416) (-2635.340) * (-2633.257) (-2636.136) (-2638.073) [-2634.907] -- 0:02:04 307500 -- (-2639.705) (-2634.930) [-2637.083] (-2639.771) * (-2636.035) [-2629.275] (-2641.037) (-2633.346) -- 0:02:03 308000 -- (-2636.468) [-2639.064] (-2637.937) (-2633.705) * [-2634.516] (-2634.253) (-2646.349) (-2632.642) -- 0:02:03 308500 -- (-2635.845) [-2638.790] (-2634.450) (-2637.990) * [-2632.104] (-2635.851) (-2634.021) (-2640.066) -- 0:02:03 309000 -- (-2638.712) (-2637.093) (-2638.074) [-2637.989] * (-2633.237) (-2633.349) [-2634.527] (-2632.270) -- 0:02:02 309500 -- [-2631.936] (-2638.384) (-2640.935) (-2638.891) * [-2636.991] (-2634.648) (-2638.543) (-2633.662) -- 0:02:02 310000 -- [-2638.243] (-2635.915) (-2633.462) (-2642.209) * (-2633.716) (-2636.438) (-2633.511) [-2636.781] -- 0:02:02 Average standard deviation of split frequencies: 0.000000 310500 -- [-2634.414] (-2637.723) (-2639.721) (-2635.961) * (-2640.534) (-2637.169) [-2634.712] (-2638.182) -- 0:02:02 311000 -- (-2636.025) (-2640.443) (-2646.230) [-2632.909] * [-2632.028] (-2636.585) (-2638.880) (-2636.190) -- 0:02:01 311500 -- [-2637.170] (-2641.785) (-2638.482) (-2634.549) * (-2633.876) (-2639.148) [-2635.892] (-2635.250) -- 0:02:01 312000 -- (-2642.167) [-2630.533] (-2638.492) (-2642.309) * (-2632.838) [-2640.522] (-2632.004) (-2635.214) -- 0:02:01 312500 -- (-2634.780) (-2638.474) [-2635.201] (-2632.523) * (-2635.578) (-2639.148) (-2637.496) [-2635.767] -- 0:02:01 313000 -- (-2634.775) (-2635.796) (-2641.653) [-2636.146] * (-2634.584) (-2636.852) [-2635.947] (-2632.545) -- 0:02:02 313500 -- (-2632.858) (-2632.624) (-2645.718) [-2631.073] * (-2636.701) (-2638.554) (-2633.003) [-2632.414] -- 0:02:02 314000 -- (-2642.008) [-2634.819] (-2646.734) (-2636.003) * (-2633.634) (-2638.007) (-2636.124) [-2633.015] -- 0:02:02 314500 -- [-2632.645] (-2636.604) (-2645.224) (-2640.450) * [-2638.026] (-2631.658) (-2634.628) (-2633.952) -- 0:02:02 315000 -- (-2634.740) [-2636.910] (-2633.516) (-2638.266) * (-2635.457) (-2629.522) (-2632.061) [-2634.473] -- 0:02:01 Average standard deviation of split frequencies: 0.000000 315500 -- (-2633.905) (-2637.444) (-2632.185) [-2635.243] * [-2638.132] (-2635.889) (-2638.984) (-2639.014) -- 0:02:01 316000 -- (-2634.250) [-2639.697] (-2635.462) (-2635.096) * [-2638.771] (-2634.999) (-2634.357) (-2634.741) -- 0:02:01 316500 -- (-2637.230) (-2636.036) (-2635.765) [-2633.943] * (-2635.454) (-2631.871) (-2639.476) [-2635.378] -- 0:02:00 317000 -- (-2637.955) [-2639.216] (-2633.199) (-2636.779) * (-2637.737) [-2635.122] (-2644.790) (-2639.344) -- 0:02:00 317500 -- [-2643.929] (-2637.154) (-2638.013) (-2634.925) * (-2636.389) [-2634.763] (-2632.182) (-2638.964) -- 0:02:00 318000 -- (-2635.106) (-2634.846) (-2641.493) [-2637.270] * [-2639.458] (-2636.798) (-2631.680) (-2633.320) -- 0:02:00 318500 -- (-2636.782) [-2637.883] (-2642.380) (-2635.225) * (-2641.350) (-2642.451) [-2637.600] (-2643.397) -- 0:02:01 319000 -- (-2631.765) (-2642.391) [-2634.532] (-2637.446) * (-2640.560) [-2637.198] (-2634.879) (-2638.390) -- 0:02:01 319500 -- (-2639.072) (-2648.469) (-2631.825) [-2633.051] * (-2638.092) [-2637.611] (-2637.126) (-2631.255) -- 0:02:01 320000 -- [-2631.552] (-2637.336) (-2629.588) (-2638.736) * [-2636.562] (-2640.630) (-2635.237) (-2633.716) -- 0:02:01 Average standard deviation of split frequencies: 0.000000 320500 -- (-2632.980) (-2640.063) (-2634.139) [-2633.142] * (-2637.345) (-2632.842) (-2637.099) [-2638.051] -- 0:02:00 321000 -- (-2633.531) (-2650.163) (-2632.647) [-2632.439] * (-2639.834) (-2634.641) (-2635.312) [-2636.333] -- 0:02:00 321500 -- [-2634.645] (-2633.500) (-2645.852) (-2636.284) * [-2641.700] (-2640.534) (-2632.914) (-2634.690) -- 0:02:00 322000 -- [-2634.710] (-2634.700) (-2635.922) (-2637.025) * (-2638.323) (-2637.111) [-2631.675] (-2632.806) -- 0:02:00 322500 -- (-2634.989) (-2633.686) [-2635.702] (-2638.136) * (-2637.556) (-2634.980) (-2633.808) [-2634.686] -- 0:01:59 323000 -- (-2636.466) (-2632.138) [-2638.431] (-2642.358) * [-2635.068] (-2640.497) (-2639.060) (-2633.474) -- 0:01:59 323500 -- (-2631.600) [-2632.159] (-2636.180) (-2638.193) * [-2636.133] (-2637.305) (-2636.600) (-2639.535) -- 0:01:59 324000 -- (-2637.079) (-2633.181) [-2633.228] (-2641.766) * (-2642.060) (-2637.345) [-2632.776] (-2637.244) -- 0:02:01 324500 -- (-2634.606) (-2639.539) [-2632.411] (-2645.599) * (-2638.570) (-2632.253) [-2631.959] (-2638.997) -- 0:02:00 325000 -- [-2635.026] (-2632.862) (-2638.744) (-2643.046) * [-2630.580] (-2642.233) (-2634.420) (-2639.532) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 325500 -- (-2635.747) [-2631.656] (-2631.350) (-2637.875) * [-2633.222] (-2633.239) (-2634.731) (-2637.718) -- 0:02:00 326000 -- [-2632.054] (-2637.887) (-2637.648) (-2638.192) * (-2637.489) [-2632.178] (-2631.788) (-2636.556) -- 0:01:59 326500 -- [-2631.900] (-2635.333) (-2638.821) (-2640.078) * (-2631.781) (-2633.754) [-2635.217] (-2635.410) -- 0:01:59 327000 -- [-2635.986] (-2633.091) (-2637.283) (-2639.364) * [-2632.135] (-2633.975) (-2641.452) (-2636.135) -- 0:01:59 327500 -- (-2642.603) [-2632.323] (-2635.576) (-2640.152) * [-2633.670] (-2638.667) (-2632.866) (-2639.030) -- 0:01:59 328000 -- (-2642.712) (-2635.028) (-2642.233) [-2638.332] * [-2634.851] (-2634.588) (-2640.498) (-2632.860) -- 0:01:58 328500 -- [-2639.615] (-2637.206) (-2640.283) (-2637.308) * [-2635.944] (-2632.825) (-2633.235) (-2631.973) -- 0:01:58 329000 -- (-2645.261) [-2635.675] (-2635.193) (-2641.315) * (-2631.258) (-2633.825) [-2635.099] (-2635.968) -- 0:01:58 329500 -- (-2641.040) [-2634.103] (-2633.894) (-2634.363) * [-2634.399] (-2631.521) (-2634.234) (-2636.004) -- 0:02:00 330000 -- (-2634.963) (-2639.026) (-2635.231) [-2632.292] * (-2638.045) [-2629.736] (-2640.331) (-2633.896) -- 0:01:59 Average standard deviation of split frequencies: 0.000000 330500 -- (-2637.624) (-2633.310) (-2633.747) [-2638.370] * (-2636.433) (-2640.036) [-2638.680] (-2638.505) -- 0:01:59 331000 -- (-2634.538) (-2636.220) (-2642.987) [-2634.541] * (-2636.541) (-2643.721) (-2643.270) [-2634.481] -- 0:01:59 331500 -- [-2638.355] (-2637.522) (-2637.566) (-2633.259) * [-2632.901] (-2638.765) (-2635.253) (-2638.091) -- 0:01:58 332000 -- (-2642.204) [-2633.171] (-2640.606) (-2638.576) * (-2638.346) [-2636.146] (-2638.839) (-2634.267) -- 0:01:58 332500 -- (-2635.677) (-2633.356) (-2634.455) [-2631.912] * (-2633.375) (-2633.326) (-2636.787) [-2631.821] -- 0:01:58 333000 -- (-2633.836) [-2644.150] (-2631.990) (-2635.047) * (-2641.393) (-2645.975) (-2639.722) [-2636.784] -- 0:01:58 333500 -- (-2634.051) [-2637.181] (-2640.492) (-2635.622) * [-2630.833] (-2631.703) (-2638.659) (-2638.260) -- 0:01:57 334000 -- [-2634.922] (-2643.208) (-2633.617) (-2637.698) * (-2636.103) [-2631.775] (-2637.881) (-2640.014) -- 0:01:57 334500 -- (-2638.048) (-2641.547) (-2640.532) [-2632.378] * [-2637.412] (-2640.581) (-2632.569) (-2639.008) -- 0:01:57 335000 -- [-2636.251] (-2639.238) (-2635.257) (-2634.808) * [-2637.898] (-2635.855) (-2634.558) (-2638.717) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 335500 -- (-2640.265) (-2637.812) (-2638.614) [-2637.799] * (-2631.475) (-2635.223) [-2638.862] (-2635.654) -- 0:01:58 336000 -- (-2635.692) [-2633.199] (-2634.598) (-2639.264) * [-2638.315] (-2640.127) (-2638.232) (-2635.784) -- 0:01:58 336500 -- (-2636.940) (-2633.549) (-2632.572) [-2636.588] * [-2632.505] (-2637.047) (-2635.110) (-2640.310) -- 0:01:58 337000 -- (-2636.542) (-2635.162) [-2632.663] (-2641.328) * [-2638.079] (-2634.566) (-2636.816) (-2638.598) -- 0:01:58 337500 -- (-2637.481) (-2632.034) [-2633.180] (-2632.932) * (-2637.504) (-2633.783) (-2638.769) [-2636.617] -- 0:01:57 338000 -- (-2633.612) (-2633.402) [-2642.612] (-2634.343) * (-2636.031) (-2633.944) [-2632.729] (-2631.360) -- 0:01:57 338500 -- (-2640.298) [-2638.062] (-2638.343) (-2644.340) * (-2637.088) (-2632.762) [-2636.636] (-2634.987) -- 0:01:57 339000 -- (-2637.603) (-2637.261) (-2636.113) [-2635.135] * (-2637.305) (-2633.856) (-2633.514) [-2633.967] -- 0:01:56 339500 -- [-2634.207] (-2635.982) (-2636.560) (-2634.995) * (-2635.819) (-2635.290) (-2637.335) [-2638.662] -- 0:01:56 340000 -- [-2640.808] (-2644.744) (-2635.239) (-2644.211) * [-2634.303] (-2637.589) (-2645.149) (-2641.441) -- 0:01:56 Average standard deviation of split frequencies: 0.000000 340500 -- [-2631.853] (-2636.088) (-2636.931) (-2640.524) * (-2637.369) (-2637.239) [-2636.713] (-2634.817) -- 0:01:56 341000 -- (-2633.580) (-2633.677) (-2633.754) [-2633.179] * (-2638.719) [-2633.251] (-2639.374) (-2638.048) -- 0:01:57 341500 -- [-2641.156] (-2631.925) (-2633.993) (-2642.475) * (-2636.846) [-2632.735] (-2640.533) (-2639.003) -- 0:01:57 342000 -- (-2643.366) (-2637.162) [-2631.936] (-2644.381) * (-2634.505) [-2632.367] (-2644.313) (-2632.031) -- 0:01:57 342500 -- (-2633.835) (-2636.119) (-2630.789) [-2636.928] * (-2635.726) (-2638.699) (-2644.090) [-2635.895] -- 0:01:57 343000 -- (-2633.898) (-2639.182) [-2636.324] (-2638.446) * [-2639.419] (-2633.709) (-2640.293) (-2630.950) -- 0:01:56 343500 -- [-2635.320] (-2639.629) (-2635.616) (-2641.197) * (-2635.632) [-2636.231] (-2640.550) (-2635.589) -- 0:01:56 344000 -- (-2633.623) [-2638.743] (-2634.677) (-2637.907) * [-2631.830] (-2635.888) (-2640.141) (-2639.375) -- 0:01:56 344500 -- [-2637.143] (-2639.433) (-2646.172) (-2633.271) * [-2632.736] (-2636.856) (-2637.418) (-2644.088) -- 0:01:56 345000 -- [-2634.809] (-2642.128) (-2636.586) (-2633.109) * (-2638.402) [-2636.090] (-2643.839) (-2633.398) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 345500 -- (-2636.303) [-2634.720] (-2635.695) (-2633.061) * (-2636.245) (-2636.099) [-2645.919] (-2633.745) -- 0:01:55 346000 -- (-2635.500) (-2637.946) [-2636.413] (-2637.285) * (-2635.463) [-2633.807] (-2643.681) (-2636.476) -- 0:01:55 346500 -- (-2633.892) [-2633.557] (-2633.343) (-2639.204) * (-2631.291) (-2635.558) [-2633.653] (-2640.230) -- 0:01:56 347000 -- (-2636.748) (-2640.078) (-2638.611) [-2633.171] * (-2639.934) (-2629.629) [-2633.882] (-2636.150) -- 0:01:56 347500 -- [-2633.723] (-2637.644) (-2631.907) (-2635.845) * (-2630.565) [-2641.839] (-2630.702) (-2635.133) -- 0:01:56 348000 -- (-2630.477) (-2635.277) [-2635.424] (-2634.501) * (-2634.870) (-2639.610) (-2641.409) [-2634.805] -- 0:01:56 348500 -- (-2636.733) [-2635.180] (-2638.240) (-2635.328) * (-2635.532) (-2634.864) (-2635.825) [-2637.292] -- 0:01:55 349000 -- (-2639.480) (-2635.709) (-2639.354) [-2637.237] * (-2636.194) (-2634.023) [-2637.368] (-2637.921) -- 0:01:55 349500 -- (-2637.090) (-2633.344) [-2635.915] (-2637.720) * (-2635.848) (-2638.701) [-2631.640] (-2634.533) -- 0:01:55 350000 -- (-2643.766) (-2639.047) [-2638.189] (-2640.148) * (-2634.371) [-2634.699] (-2634.708) (-2638.185) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 350500 -- (-2639.881) (-2635.379) (-2637.556) [-2640.902] * (-2639.414) [-2635.957] (-2633.936) (-2643.826) -- 0:01:54 351000 -- (-2643.581) (-2636.963) [-2636.921] (-2633.700) * [-2634.591] (-2636.334) (-2643.622) (-2636.929) -- 0:01:54 351500 -- (-2641.991) (-2642.964) [-2631.878] (-2637.078) * (-2638.200) [-2634.955] (-2643.773) (-2633.505) -- 0:01:54 352000 -- (-2636.174) (-2640.612) [-2639.170] (-2640.581) * [-2630.945] (-2639.709) (-2634.376) (-2639.749) -- 0:01:55 352500 -- (-2631.491) [-2636.865] (-2636.487) (-2637.277) * (-2634.542) (-2633.170) [-2638.848] (-2636.874) -- 0:01:55 353000 -- (-2636.228) (-2651.706) [-2636.396] (-2638.937) * (-2631.867) (-2629.791) (-2639.423) [-2633.206] -- 0:01:55 353500 -- (-2641.145) (-2637.636) [-2633.570] (-2638.030) * (-2630.256) [-2637.682] (-2636.617) (-2637.905) -- 0:01:55 354000 -- (-2638.277) (-2636.350) (-2638.142) [-2633.883] * [-2636.628] (-2638.204) (-2633.052) (-2632.540) -- 0:01:54 354500 -- (-2638.547) (-2640.038) [-2641.189] (-2636.081) * (-2636.039) [-2639.374] (-2636.424) (-2637.608) -- 0:01:54 355000 -- (-2635.036) (-2637.494) (-2637.040) [-2633.785] * (-2638.492) [-2634.323] (-2637.554) (-2639.470) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 355500 -- (-2644.589) [-2636.704] (-2635.173) (-2635.656) * (-2638.379) (-2639.584) [-2636.199] (-2635.835) -- 0:01:54 356000 -- (-2634.198) [-2632.223] (-2632.186) (-2633.080) * [-2639.155] (-2635.501) (-2636.118) (-2634.347) -- 0:01:53 356500 -- [-2641.476] (-2639.524) (-2645.361) (-2635.525) * [-2632.984] (-2636.517) (-2640.379) (-2633.427) -- 0:01:53 357000 -- (-2644.134) [-2638.323] (-2636.115) (-2635.451) * (-2637.238) (-2637.278) [-2638.571] (-2641.285) -- 0:01:53 357500 -- (-2637.932) [-2633.056] (-2631.699) (-2630.858) * (-2635.134) (-2631.940) (-2643.092) [-2636.749] -- 0:01:55 358000 -- [-2636.162] (-2632.624) (-2640.042) (-2630.187) * (-2634.509) (-2639.248) [-2634.627] (-2630.567) -- 0:01:54 358500 -- (-2645.470) [-2638.679] (-2634.338) (-2630.111) * [-2633.698] (-2642.452) (-2639.698) (-2637.062) -- 0:01:54 359000 -- [-2638.103] (-2640.810) (-2642.320) (-2634.394) * (-2631.615) (-2635.050) [-2630.816] (-2634.420) -- 0:01:54 359500 -- [-2638.517] (-2633.708) (-2640.796) (-2648.630) * (-2633.916) (-2635.870) (-2634.558) [-2634.025] -- 0:01:54 360000 -- (-2641.579) [-2635.590] (-2635.583) (-2639.034) * (-2645.473) [-2639.544] (-2637.669) (-2637.436) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 360500 -- (-2638.424) (-2633.345) (-2636.295) [-2639.774] * (-2639.784) (-2639.688) (-2636.134) [-2632.548] -- 0:01:53 361000 -- (-2640.535) (-2640.844) (-2632.802) [-2636.851] * (-2631.108) (-2637.616) [-2634.560] (-2637.110) -- 0:01:53 361500 -- (-2638.795) [-2633.283] (-2635.306) (-2633.487) * (-2634.090) (-2631.106) (-2634.351) [-2639.209] -- 0:01:53 362000 -- [-2637.889] (-2639.610) (-2634.037) (-2636.500) * (-2634.569) (-2634.460) (-2631.780) [-2635.497] -- 0:01:52 362500 -- [-2635.144] (-2632.746) (-2640.719) (-2632.610) * [-2634.450] (-2634.502) (-2635.352) (-2631.727) -- 0:01:52 363000 -- (-2635.185) (-2633.942) (-2638.270) [-2639.104] * (-2634.003) (-2635.262) (-2633.835) [-2636.348] -- 0:01:52 363500 -- (-2644.057) (-2638.319) (-2639.520) [-2636.273] * (-2636.203) [-2634.946] (-2635.096) (-2633.292) -- 0:01:53 364000 -- [-2637.068] (-2638.051) (-2637.188) (-2634.911) * (-2629.945) [-2632.539] (-2642.943) (-2633.403) -- 0:01:53 364500 -- (-2637.944) (-2636.404) [-2630.957] (-2634.669) * (-2632.802) (-2637.992) (-2640.564) [-2638.828] -- 0:01:53 365000 -- (-2635.306) (-2640.976) [-2633.322] (-2632.833) * (-2636.860) (-2640.431) [-2639.079] (-2635.811) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 365500 -- [-2630.012] (-2636.120) (-2634.990) (-2638.515) * (-2632.508) (-2641.176) (-2634.525) [-2633.448] -- 0:01:52 366000 -- (-2630.440) (-2632.901) (-2638.120) [-2639.599] * (-2636.640) [-2635.658] (-2634.639) (-2638.828) -- 0:01:52 366500 -- (-2632.214) (-2635.244) [-2634.559] (-2631.712) * (-2634.784) [-2639.678] (-2634.725) (-2643.928) -- 0:01:52 367000 -- (-2634.251) (-2639.083) (-2638.678) [-2634.464] * [-2636.775] (-2637.155) (-2637.699) (-2631.262) -- 0:01:52 367500 -- [-2635.728] (-2643.610) (-2636.866) (-2638.942) * [-2633.071] (-2643.768) (-2635.610) (-2630.732) -- 0:01:51 368000 -- (-2641.865) (-2632.555) [-2636.070] (-2638.662) * (-2634.004) (-2635.259) (-2637.123) [-2636.966] -- 0:01:51 368500 -- (-2636.205) (-2634.872) [-2637.947] (-2645.915) * (-2633.743) (-2637.537) [-2634.449] (-2636.347) -- 0:01:51 369000 -- (-2638.217) (-2634.577) [-2631.485] (-2636.882) * (-2637.919) (-2635.670) (-2631.444) [-2636.145] -- 0:01:52 369500 -- (-2634.959) (-2635.664) (-2636.098) [-2631.805] * (-2633.361) (-2636.277) [-2635.721] (-2633.576) -- 0:01:52 370000 -- (-2633.989) [-2636.984] (-2637.445) (-2633.939) * [-2638.823] (-2638.300) (-2632.731) (-2635.218) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 370500 -- [-2633.995] (-2629.495) (-2634.649) (-2637.383) * (-2635.749) [-2630.716] (-2632.959) (-2633.330) -- 0:01:52 371000 -- [-2637.108] (-2638.897) (-2636.069) (-2634.440) * (-2646.462) (-2635.953) (-2640.431) [-2634.482] -- 0:01:51 371500 -- (-2636.728) [-2637.727] (-2636.346) (-2642.072) * [-2635.123] (-2641.011) (-2634.365) (-2639.818) -- 0:01:51 372000 -- [-2636.996] (-2639.150) (-2633.804) (-2640.204) * (-2636.268) [-2633.778] (-2641.288) (-2640.567) -- 0:01:51 372500 -- (-2634.286) (-2637.768) [-2636.367] (-2636.719) * [-2639.437] (-2635.908) (-2638.826) (-2641.751) -- 0:01:51 373000 -- (-2638.971) (-2634.958) (-2640.286) [-2634.786] * (-2635.230) (-2636.188) [-2632.780] (-2632.347) -- 0:01:50 373500 -- [-2633.027] (-2638.418) (-2638.363) (-2635.654) * (-2636.397) (-2633.435) [-2639.839] (-2639.041) -- 0:01:50 374000 -- (-2633.370) (-2634.036) [-2635.596] (-2632.882) * (-2639.866) (-2639.360) (-2637.528) [-2642.942] -- 0:01:50 374500 -- [-2634.820] (-2640.021) (-2635.992) (-2653.841) * (-2638.493) (-2639.926) [-2634.595] (-2636.669) -- 0:01:51 375000 -- [-2634.323] (-2633.991) (-2637.764) (-2632.946) * (-2638.839) (-2634.728) [-2636.159] (-2632.459) -- 0:01:51 Average standard deviation of split frequencies: 0.000000 375500 -- (-2630.973) (-2635.613) [-2633.302] (-2637.971) * [-2632.931] (-2634.500) (-2636.930) (-2642.012) -- 0:01:51 376000 -- (-2640.586) (-2635.120) [-2636.546] (-2640.784) * (-2639.616) [-2637.768] (-2632.086) (-2640.922) -- 0:01:51 376500 -- (-2639.796) (-2635.291) (-2636.527) [-2635.146] * [-2636.056] (-2636.426) (-2635.882) (-2634.007) -- 0:01:50 377000 -- (-2643.543) (-2640.443) [-2632.732] (-2632.030) * (-2638.448) (-2640.317) [-2634.504] (-2645.502) -- 0:01:50 377500 -- (-2636.401) [-2639.774] (-2636.492) (-2635.290) * (-2636.660) (-2635.579) (-2634.676) [-2633.833] -- 0:01:50 378000 -- (-2637.643) (-2645.445) (-2637.228) [-2637.994] * (-2639.091) [-2636.315] (-2635.016) (-2635.830) -- 0:01:50 378500 -- (-2635.761) [-2639.354] (-2640.706) (-2640.432) * (-2634.000) (-2631.085) [-2634.005] (-2643.998) -- 0:01:50 379000 -- (-2636.290) [-2631.293] (-2638.540) (-2642.644) * (-2642.904) (-2639.169) [-2634.660] (-2634.764) -- 0:01:49 379500 -- [-2637.943] (-2640.665) (-2633.471) (-2638.509) * (-2634.120) [-2635.272] (-2637.706) (-2636.458) -- 0:01:49 380000 -- (-2643.292) [-2634.813] (-2639.946) (-2636.148) * [-2639.805] (-2636.612) (-2640.662) (-2640.070) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 380500 -- [-2633.906] (-2639.309) (-2637.521) (-2639.747) * (-2635.950) (-2635.719) [-2632.365] (-2640.838) -- 0:01:50 381000 -- (-2633.747) (-2642.300) [-2634.946] (-2638.793) * (-2640.203) (-2635.284) (-2635.405) [-2636.991] -- 0:01:50 381500 -- (-2637.529) (-2632.900) [-2638.333] (-2634.574) * [-2632.169] (-2635.740) (-2632.159) (-2633.643) -- 0:01:50 382000 -- (-2632.130) (-2633.475) [-2637.266] (-2634.789) * (-2633.351) [-2642.141] (-2639.328) (-2632.711) -- 0:01:50 382500 -- [-2633.950] (-2636.471) (-2644.132) (-2635.436) * (-2629.543) (-2634.825) [-2641.591] (-2631.793) -- 0:01:49 383000 -- (-2633.508) (-2636.841) (-2644.768) [-2632.291] * [-2633.599] (-2638.509) (-2637.355) (-2639.996) -- 0:01:49 383500 -- [-2634.682] (-2637.119) (-2636.273) (-2634.497) * [-2640.033] (-2639.375) (-2634.840) (-2630.017) -- 0:01:49 384000 -- (-2636.063) [-2634.313] (-2637.783) (-2644.736) * (-2639.662) (-2641.679) (-2636.754) [-2638.105] -- 0:01:49 384500 -- (-2635.094) [-2636.842] (-2645.972) (-2640.130) * (-2634.050) (-2641.164) [-2635.785] (-2635.296) -- 0:01:48 385000 -- [-2640.316] (-2635.073) (-2634.691) (-2637.200) * (-2636.005) (-2632.868) (-2639.151) [-2636.855] -- 0:01:48 Average standard deviation of split frequencies: 0.000000 385500 -- (-2641.525) (-2638.389) [-2634.031] (-2645.182) * (-2633.161) [-2637.941] (-2640.809) (-2640.912) -- 0:01:48 386000 -- (-2637.620) (-2634.437) [-2634.128] (-2635.960) * [-2639.055] (-2633.712) (-2635.271) (-2633.346) -- 0:01:49 386500 -- (-2639.779) [-2631.952] (-2632.670) (-2632.338) * (-2645.048) (-2631.322) (-2641.064) [-2633.556] -- 0:01:49 387000 -- [-2631.238] (-2632.154) (-2638.623) (-2634.919) * (-2638.035) [-2632.939] (-2637.146) (-2639.468) -- 0:01:49 387500 -- (-2635.093) (-2632.953) (-2634.085) [-2633.723] * [-2630.383] (-2632.726) (-2634.177) (-2635.890) -- 0:01:49 388000 -- (-2636.806) (-2634.984) (-2632.346) [-2632.436] * (-2630.781) [-2634.482] (-2638.062) (-2642.307) -- 0:01:48 388500 -- (-2634.727) (-2650.176) [-2636.451] (-2635.917) * [-2632.683] (-2631.722) (-2638.620) (-2645.222) -- 0:01:48 389000 -- (-2634.830) [-2634.512] (-2635.354) (-2643.289) * [-2633.504] (-2641.462) (-2638.615) (-2638.129) -- 0:01:48 389500 -- (-2643.072) (-2636.591) (-2639.703) [-2632.759] * [-2633.473] (-2632.290) (-2633.499) (-2641.290) -- 0:01:48 390000 -- (-2638.788) (-2637.091) [-2635.690] (-2636.130) * [-2634.714] (-2634.981) (-2634.986) (-2636.114) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 390500 -- [-2640.257] (-2642.238) (-2635.660) (-2645.176) * [-2636.771] (-2638.386) (-2632.964) (-2633.708) -- 0:01:47 391000 -- (-2638.168) (-2642.305) [-2640.695] (-2639.064) * (-2632.917) (-2634.998) (-2642.057) [-2633.929] -- 0:01:47 391500 -- (-2636.976) (-2642.993) (-2635.603) [-2633.818] * (-2636.346) [-2635.228] (-2646.093) (-2632.987) -- 0:01:48 392000 -- (-2635.954) (-2634.558) (-2639.126) [-2634.013] * (-2638.029) [-2635.594] (-2642.233) (-2631.801) -- 0:01:48 392500 -- (-2641.492) (-2635.304) (-2635.764) [-2638.357] * [-2636.111] (-2632.892) (-2635.281) (-2634.190) -- 0:01:48 393000 -- (-2633.003) (-2634.573) (-2638.219) [-2636.147] * (-2640.229) (-2631.300) [-2637.439] (-2638.699) -- 0:01:48 393500 -- (-2638.849) (-2634.051) (-2641.089) [-2635.956] * (-2637.226) (-2637.465) [-2637.592] (-2638.208) -- 0:01:47 394000 -- (-2636.999) (-2633.467) (-2637.840) [-2635.697] * (-2635.792) [-2632.019] (-2636.322) (-2632.706) -- 0:01:47 394500 -- (-2633.425) (-2634.703) [-2632.390] (-2636.630) * (-2633.417) (-2637.382) [-2634.991] (-2638.311) -- 0:01:47 395000 -- (-2637.560) [-2634.806] (-2635.612) (-2634.843) * (-2641.893) (-2638.028) [-2638.063] (-2637.438) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 395500 -- (-2632.112) (-2634.696) (-2639.654) [-2634.673] * (-2641.317) (-2634.546) (-2636.560) [-2636.631] -- 0:01:46 396000 -- (-2636.466) [-2634.068] (-2630.410) (-2633.800) * [-2636.750] (-2634.514) (-2631.325) (-2636.716) -- 0:01:46 396500 -- (-2630.220) [-2637.021] (-2635.550) (-2634.903) * [-2632.580] (-2630.826) (-2641.938) (-2637.221) -- 0:01:46 397000 -- [-2639.838] (-2634.650) (-2630.652) (-2635.766) * (-2636.910) [-2635.244] (-2641.485) (-2635.734) -- 0:01:47 397500 -- (-2634.631) [-2634.571] (-2636.118) (-2634.677) * (-2640.205) [-2637.476] (-2640.864) (-2631.151) -- 0:01:47 398000 -- (-2631.974) (-2636.386) [-2632.989] (-2642.402) * [-2638.362] (-2631.383) (-2635.145) (-2638.266) -- 0:01:47 398500 -- (-2637.364) [-2637.572] (-2635.889) (-2633.326) * [-2633.400] (-2632.005) (-2638.780) (-2640.534) -- 0:01:47 399000 -- (-2644.206) [-2637.219] (-2637.651) (-2633.341) * (-2635.567) (-2633.088) (-2636.441) [-2646.821] -- 0:01:46 399500 -- (-2633.885) (-2644.988) (-2632.865) [-2634.060] * (-2638.883) [-2637.275] (-2631.966) (-2641.696) -- 0:01:46 400000 -- (-2637.795) (-2634.026) [-2632.873] (-2635.854) * (-2635.216) [-2637.253] (-2639.618) (-2635.430) -- 0:01:46 Average standard deviation of split frequencies: 0.000000 400500 -- [-2635.906] (-2638.467) (-2633.449) (-2639.264) * (-2641.307) (-2638.953) (-2635.163) [-2632.391] -- 0:01:46 401000 -- [-2634.535] (-2635.611) (-2635.104) (-2636.234) * (-2645.523) [-2638.701] (-2635.171) (-2640.302) -- 0:01:46 401500 -- (-2634.705) [-2633.189] (-2641.927) (-2630.317) * [-2632.830] (-2634.745) (-2636.334) (-2641.218) -- 0:01:45 402000 -- (-2638.785) [-2635.499] (-2637.493) (-2632.042) * (-2639.033) [-2633.227] (-2632.083) (-2647.901) -- 0:01:45 402500 -- (-2638.465) (-2644.608) (-2632.088) [-2632.691] * [-2639.019] (-2634.243) (-2634.017) (-2644.117) -- 0:01:46 403000 -- (-2643.412) (-2634.888) (-2635.981) [-2633.362] * (-2633.071) [-2634.086] (-2640.736) (-2640.276) -- 0:01:46 403500 -- (-2638.206) (-2634.827) [-2632.068] (-2633.073) * (-2634.909) [-2636.193] (-2636.889) (-2639.527) -- 0:01:46 404000 -- (-2636.477) [-2632.357] (-2633.195) (-2634.607) * [-2630.889] (-2631.752) (-2632.804) (-2638.573) -- 0:01:46 404500 -- (-2638.331) (-2632.049) (-2640.460) [-2636.322] * [-2630.691] (-2631.973) (-2637.683) (-2638.814) -- 0:01:45 405000 -- (-2637.934) [-2637.472] (-2640.269) (-2632.467) * (-2640.789) [-2634.068] (-2636.495) (-2646.004) -- 0:01:45 Average standard deviation of split frequencies: 0.000000 405500 -- (-2636.988) [-2635.527] (-2635.833) (-2638.862) * [-2636.494] (-2639.357) (-2634.455) (-2636.479) -- 0:01:45 406000 -- (-2632.408) [-2631.972] (-2645.941) (-2635.690) * [-2637.569] (-2639.096) (-2637.616) (-2634.544) -- 0:01:45 406500 -- (-2639.709) [-2635.817] (-2633.946) (-2635.759) * (-2635.694) (-2654.466) (-2632.485) [-2636.666] -- 0:01:45 407000 -- (-2637.393) [-2636.131] (-2633.933) (-2642.919) * (-2638.004) [-2642.278] (-2641.005) (-2636.767) -- 0:01:44 407500 -- (-2642.826) (-2642.879) [-2634.864] (-2636.897) * [-2634.998] (-2641.028) (-2640.380) (-2635.628) -- 0:01:44 408000 -- (-2638.338) [-2635.622] (-2634.397) (-2634.428) * [-2634.628] (-2637.349) (-2636.132) (-2642.332) -- 0:01:44 408500 -- [-2636.163] (-2638.357) (-2636.492) (-2633.979) * (-2638.501) [-2637.948] (-2641.330) (-2633.354) -- 0:01:45 409000 -- (-2631.614) (-2642.692) (-2635.086) [-2631.646] * (-2633.171) (-2634.069) (-2642.360) [-2636.199] -- 0:01:45 409500 -- (-2636.573) (-2642.719) (-2633.191) [-2631.385] * (-2639.248) (-2636.238) [-2632.048] (-2638.234) -- 0:01:45 410000 -- [-2639.072] (-2643.999) (-2636.892) (-2633.517) * (-2632.569) [-2633.317] (-2634.807) (-2640.745) -- 0:01:45 Average standard deviation of split frequencies: 0.000000 410500 -- (-2637.111) (-2633.981) [-2635.073] (-2632.853) * (-2631.289) (-2635.462) [-2634.600] (-2637.793) -- 0:01:44 411000 -- (-2638.524) [-2634.254] (-2637.235) (-2635.454) * (-2632.155) [-2638.571] (-2632.828) (-2643.113) -- 0:01:44 411500 -- (-2633.001) [-2634.061] (-2630.202) (-2634.566) * (-2635.864) (-2635.581) (-2633.134) [-2634.077] -- 0:01:44 412000 -- [-2634.109] (-2634.399) (-2634.029) (-2639.325) * [-2632.522] (-2639.803) (-2635.133) (-2638.650) -- 0:01:44 412500 -- (-2634.704) (-2634.803) [-2632.564] (-2642.199) * (-2636.136) [-2633.496] (-2638.259) (-2633.582) -- 0:01:43 413000 -- (-2643.110) [-2630.478] (-2634.316) (-2638.164) * (-2632.118) [-2633.713] (-2635.921) (-2633.478) -- 0:01:43 413500 -- (-2638.524) [-2634.376] (-2639.160) (-2637.209) * (-2635.120) (-2637.826) [-2633.370] (-2643.180) -- 0:01:43 414000 -- (-2631.884) (-2633.877) [-2634.747] (-2639.770) * (-2635.347) (-2640.414) (-2638.170) [-2636.569] -- 0:01:44 414500 -- (-2634.884) (-2636.725) (-2634.500) [-2632.502] * (-2641.728) [-2636.515] (-2635.420) (-2633.190) -- 0:01:44 415000 -- (-2637.067) (-2634.078) [-2630.497] (-2630.091) * (-2639.627) (-2637.637) (-2638.312) [-2633.053] -- 0:01:44 Average standard deviation of split frequencies: 0.000000 415500 -- [-2635.115] (-2639.530) (-2638.119) (-2633.348) * (-2632.667) [-2631.181] (-2640.883) (-2638.944) -- 0:01:44 416000 -- (-2637.392) (-2634.672) [-2634.162] (-2630.588) * (-2637.730) (-2631.050) (-2631.898) [-2638.273] -- 0:01:43 416500 -- (-2634.664) (-2640.768) [-2634.210] (-2636.089) * (-2634.984) [-2631.369] (-2638.752) (-2630.288) -- 0:01:43 417000 -- (-2638.096) (-2647.035) [-2639.148] (-2638.561) * [-2631.897] (-2638.723) (-2636.477) (-2640.049) -- 0:01:43 417500 -- (-2634.063) (-2638.829) (-2643.224) [-2637.974] * (-2636.740) [-2632.197] (-2639.716) (-2633.405) -- 0:01:43 418000 -- [-2631.911] (-2635.716) (-2634.884) (-2634.750) * (-2637.062) (-2632.502) (-2635.233) [-2635.696] -- 0:01:43 418500 -- (-2637.849) (-2635.468) (-2641.249) [-2636.149] * (-2636.481) [-2633.061] (-2635.674) (-2640.027) -- 0:01:42 419000 -- (-2632.068) (-2636.309) [-2637.952] (-2638.624) * (-2631.024) [-2632.648] (-2636.981) (-2633.709) -- 0:01:42 419500 -- (-2639.372) (-2639.966) [-2633.456] (-2638.769) * [-2634.375] (-2631.609) (-2634.591) (-2635.630) -- 0:01:43 420000 -- (-2637.805) (-2642.637) (-2639.154) [-2634.857] * [-2640.492] (-2634.680) (-2636.666) (-2642.402) -- 0:01:43 Average standard deviation of split frequencies: 0.000000 420500 -- [-2636.559] (-2637.818) (-2638.488) (-2639.216) * (-2636.315) (-2638.397) (-2641.759) [-2647.703] -- 0:01:43 421000 -- (-2637.091) [-2631.771] (-2639.794) (-2633.542) * (-2632.981) [-2638.077] (-2634.085) (-2637.330) -- 0:01:43 421500 -- [-2632.474] (-2638.203) (-2633.240) (-2643.290) * (-2632.879) (-2637.360) (-2631.144) [-2632.594] -- 0:01:42 422000 -- (-2634.470) (-2630.933) [-2639.045] (-2633.473) * (-2633.496) [-2638.474] (-2633.832) (-2636.433) -- 0:01:42 422500 -- (-2636.210) [-2633.062] (-2636.298) (-2633.339) * (-2630.707) (-2644.680) (-2632.625) [-2640.665] -- 0:01:42 423000 -- (-2636.543) (-2632.392) (-2646.495) [-2637.695] * (-2634.826) [-2636.445] (-2637.979) (-2636.284) -- 0:01:42 423500 -- (-2632.846) (-2633.238) (-2637.139) [-2635.428] * (-2634.144) (-2634.034) [-2638.273] (-2636.718) -- 0:01:42 424000 -- (-2639.628) [-2631.938] (-2639.245) (-2641.825) * (-2632.904) (-2638.029) (-2631.741) [-2632.269] -- 0:01:41 424500 -- [-2636.820] (-2632.054) (-2634.052) (-2638.656) * (-2637.367) (-2636.138) (-2634.051) [-2635.628] -- 0:01:41 425000 -- (-2637.708) [-2635.111] (-2632.680) (-2644.736) * (-2643.430) [-2632.330] (-2635.138) (-2638.689) -- 0:01:42 Average standard deviation of split frequencies: 0.000000 425500 -- [-2635.673] (-2636.571) (-2638.273) (-2637.508) * (-2638.318) [-2634.488] (-2633.603) (-2634.815) -- 0:01:42 426000 -- (-2635.657) (-2637.999) (-2635.287) [-2633.975] * (-2640.441) (-2636.925) [-2632.759] (-2642.876) -- 0:01:42 426500 -- (-2634.107) (-2635.540) [-2634.170] (-2640.406) * [-2637.677] (-2632.643) (-2641.183) (-2643.241) -- 0:01:42 427000 -- [-2632.712] (-2642.922) (-2639.168) (-2634.910) * [-2634.003] (-2632.074) (-2634.623) (-2640.241) -- 0:01:41 427500 -- (-2637.595) (-2636.865) [-2631.753] (-2634.400) * (-2639.930) (-2633.891) [-2630.878] (-2636.827) -- 0:01:41 428000 -- (-2632.939) (-2634.016) [-2634.683] (-2641.964) * (-2638.122) (-2638.198) [-2634.127] (-2638.448) -- 0:01:41 428500 -- (-2637.189) [-2634.435] (-2635.385) (-2636.179) * [-2631.789] (-2638.783) (-2632.990) (-2638.429) -- 0:01:41 429000 -- (-2634.135) [-2637.863] (-2637.427) (-2639.344) * (-2637.694) (-2637.749) (-2636.879) [-2630.814] -- 0:01:41 429500 -- (-2634.239) [-2632.372] (-2636.050) (-2635.307) * (-2635.927) (-2637.201) (-2634.781) [-2633.652] -- 0:01:40 430000 -- (-2635.375) (-2634.386) (-2631.771) [-2633.060] * [-2636.121] (-2637.232) (-2640.669) (-2636.944) -- 0:01:40 Average standard deviation of split frequencies: 0.000000 430500 -- [-2634.012] (-2636.726) (-2637.762) (-2632.653) * [-2632.949] (-2639.207) (-2635.241) (-2636.851) -- 0:01:40 431000 -- (-2634.467) [-2635.978] (-2633.952) (-2637.775) * [-2632.806] (-2636.519) (-2636.132) (-2640.542) -- 0:01:41 431500 -- (-2634.869) [-2635.103] (-2638.983) (-2634.514) * (-2635.600) (-2638.475) [-2632.612] (-2636.000) -- 0:01:41 432000 -- (-2638.825) [-2632.699] (-2635.656) (-2630.764) * [-2636.325] (-2637.495) (-2639.046) (-2640.864) -- 0:01:41 432500 -- (-2637.810) (-2637.753) [-2639.077] (-2637.889) * (-2637.443) (-2634.113) [-2643.208] (-2642.919) -- 0:01:41 433000 -- (-2635.662) (-2634.844) (-2635.371) [-2635.427] * (-2635.318) [-2639.061] (-2633.684) (-2639.720) -- 0:01:40 433500 -- (-2638.065) (-2631.560) (-2630.887) [-2634.346] * (-2634.511) (-2640.977) (-2633.635) [-2636.170] -- 0:01:40 434000 -- (-2635.541) (-2637.792) (-2635.426) [-2633.888] * (-2634.409) (-2640.563) (-2635.003) [-2633.667] -- 0:01:40 434500 -- (-2646.420) (-2638.728) (-2632.472) [-2630.764] * (-2642.276) [-2643.264] (-2635.514) (-2634.072) -- 0:01:40 435000 -- (-2631.217) (-2632.297) (-2633.478) [-2633.473] * (-2639.813) (-2639.105) (-2640.915) [-2635.617] -- 0:01:40 Average standard deviation of split frequencies: 0.000000 435500 -- (-2640.170) [-2629.914] (-2631.535) (-2643.296) * [-2638.652] (-2653.014) (-2639.233) (-2634.284) -- 0:01:39 436000 -- [-2634.556] (-2629.636) (-2646.959) (-2634.289) * (-2641.082) [-2636.244] (-2638.397) (-2641.085) -- 0:01:39 436500 -- (-2636.964) [-2634.543] (-2639.287) (-2640.667) * (-2637.095) (-2642.092) [-2636.515] (-2634.669) -- 0:01:40 437000 -- (-2633.834) [-2635.209] (-2637.081) (-2638.298) * [-2631.159] (-2652.649) (-2639.104) (-2634.473) -- 0:01:40 437500 -- (-2634.797) (-2630.682) [-2639.008] (-2632.326) * (-2635.531) (-2647.650) [-2635.061] (-2643.331) -- 0:01:40 438000 -- (-2632.389) [-2635.891] (-2633.696) (-2636.227) * (-2632.500) (-2639.006) (-2634.308) [-2633.422] -- 0:01:40 438500 -- [-2632.334] (-2634.130) (-2647.014) (-2642.800) * (-2636.833) (-2635.995) [-2634.225] (-2632.764) -- 0:01:39 439000 -- [-2629.381] (-2638.033) (-2638.993) (-2636.356) * (-2641.804) (-2635.342) (-2636.568) [-2633.786] -- 0:01:39 439500 -- (-2634.756) (-2641.990) (-2636.658) [-2641.513] * (-2633.426) (-2643.967) (-2633.089) [-2634.559] -- 0:01:39 440000 -- (-2632.563) [-2635.415] (-2634.779) (-2638.899) * (-2632.109) (-2637.431) (-2634.207) [-2632.524] -- 0:01:39 Average standard deviation of split frequencies: 0.000000 440500 -- [-2633.149] (-2639.612) (-2635.954) (-2641.116) * (-2634.615) (-2638.236) [-2638.229] (-2636.868) -- 0:01:39 441000 -- (-2639.448) [-2634.180] (-2633.463) (-2639.198) * (-2639.745) [-2635.580] (-2635.728) (-2642.164) -- 0:01:38 441500 -- (-2636.781) (-2636.111) [-2634.682] (-2638.372) * (-2634.081) (-2635.687) [-2640.275] (-2636.745) -- 0:01:38 442000 -- (-2634.540) (-2640.134) [-2636.145] (-2639.495) * [-2633.213] (-2635.559) (-2638.120) (-2638.660) -- 0:01:39 442500 -- (-2639.393) (-2637.467) [-2631.342] (-2638.491) * (-2642.432) (-2635.172) [-2633.399] (-2636.694) -- 0:01:39 443000 -- [-2634.722] (-2637.603) (-2636.873) (-2642.183) * (-2636.632) [-2634.443] (-2636.547) (-2634.700) -- 0:01:39 443500 -- (-2636.212) [-2633.069] (-2634.981) (-2637.282) * (-2645.405) [-2633.031] (-2642.430) (-2648.016) -- 0:01:39 444000 -- (-2639.426) (-2631.839) [-2637.315] (-2639.079) * (-2641.404) (-2632.661) [-2631.967] (-2641.362) -- 0:01:38 444500 -- (-2638.327) (-2636.247) [-2636.311] (-2632.958) * (-2637.338) (-2640.214) [-2637.211] (-2635.151) -- 0:01:38 445000 -- (-2633.457) (-2640.137) [-2636.189] (-2638.268) * (-2639.318) (-2634.972) (-2638.737) [-2634.536] -- 0:01:38 Average standard deviation of split frequencies: 0.000000 445500 -- (-2637.944) [-2637.326] (-2642.019) (-2639.705) * (-2640.488) [-2640.274] (-2635.056) (-2636.440) -- 0:01:38 446000 -- (-2631.273) (-2639.523) (-2637.064) [-2636.678] * (-2639.974) (-2634.138) (-2633.052) [-2634.313] -- 0:01:38 446500 -- [-2637.174] (-2640.184) (-2631.738) (-2637.891) * (-2641.297) [-2638.395] (-2633.021) (-2634.012) -- 0:01:37 447000 -- (-2648.713) (-2636.547) [-2636.597] (-2637.886) * (-2637.440) (-2644.856) [-2635.914] (-2636.196) -- 0:01:37 447500 -- (-2635.410) (-2633.285) [-2635.001] (-2640.341) * (-2639.721) (-2633.728) [-2634.407] (-2632.269) -- 0:01:37 448000 -- (-2642.088) [-2634.487] (-2636.529) (-2631.748) * [-2637.806] (-2633.076) (-2645.996) (-2637.037) -- 0:01:38 448500 -- [-2637.263] (-2642.292) (-2635.452) (-2634.706) * (-2637.189) [-2639.053] (-2640.038) (-2645.364) -- 0:01:38 449000 -- (-2638.629) [-2631.053] (-2640.201) (-2640.388) * [-2634.516] (-2637.568) (-2643.969) (-2636.964) -- 0:01:38 449500 -- (-2637.549) (-2632.043) [-2636.377] (-2638.907) * (-2639.240) (-2632.715) (-2640.355) [-2636.069] -- 0:01:37 450000 -- [-2640.077] (-2634.486) (-2641.872) (-2637.357) * (-2636.003) (-2637.043) (-2641.225) [-2636.106] -- 0:01:37 Average standard deviation of split frequencies: 0.000000 450500 -- (-2634.079) (-2634.794) (-2641.695) [-2634.686] * [-2635.046] (-2629.304) (-2636.599) (-2637.162) -- 0:01:37 451000 -- (-2635.915) (-2638.043) (-2641.993) [-2629.750] * (-2635.624) (-2637.749) [-2637.049] (-2632.967) -- 0:01:37 451500 -- [-2636.015] (-2637.204) (-2634.898) (-2640.529) * [-2637.925] (-2633.344) (-2637.421) (-2635.205) -- 0:01:37 452000 -- [-2642.959] (-2637.337) (-2639.248) (-2636.472) * (-2641.042) [-2637.791] (-2633.611) (-2635.919) -- 0:01:36 452500 -- [-2631.085] (-2634.838) (-2633.106) (-2633.419) * (-2636.496) (-2641.018) [-2633.782] (-2641.630) -- 0:01:36 453000 -- (-2640.471) (-2636.307) (-2637.534) [-2634.917] * (-2631.961) (-2636.590) (-2635.910) [-2632.512] -- 0:01:36 453500 -- (-2635.437) (-2635.498) (-2639.066) [-2642.514] * (-2633.180) (-2636.120) [-2632.159] (-2632.886) -- 0:01:37 454000 -- (-2635.155) [-2642.744] (-2633.994) (-2635.334) * (-2635.312) (-2637.899) (-2636.244) [-2635.657] -- 0:01:37 454500 -- [-2635.058] (-2636.626) (-2638.777) (-2638.696) * [-2636.092] (-2637.962) (-2638.129) (-2632.759) -- 0:01:37 455000 -- (-2634.469) (-2638.354) (-2636.590) [-2633.908] * [-2634.846] (-2646.168) (-2637.911) (-2638.469) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 455500 -- [-2636.697] (-2631.102) (-2637.274) (-2634.948) * [-2633.668] (-2642.425) (-2637.488) (-2636.121) -- 0:01:36 456000 -- [-2649.020] (-2633.368) (-2638.645) (-2640.540) * (-2636.858) (-2638.597) [-2636.447] (-2636.891) -- 0:01:36 456500 -- (-2635.126) (-2634.241) [-2637.210] (-2634.324) * (-2633.116) (-2639.569) (-2637.010) [-2635.809] -- 0:01:36 457000 -- [-2636.775] (-2634.355) (-2638.874) (-2637.352) * [-2632.690] (-2641.472) (-2631.550) (-2631.307) -- 0:01:36 457500 -- (-2639.555) (-2636.667) (-2631.838) [-2631.145] * [-2636.381] (-2635.195) (-2641.339) (-2634.918) -- 0:01:36 458000 -- (-2634.896) (-2640.091) (-2633.494) [-2634.535] * (-2634.509) [-2643.930] (-2641.348) (-2641.999) -- 0:01:35 458500 -- [-2634.280] (-2633.269) (-2636.683) (-2645.155) * (-2638.277) (-2642.269) (-2631.725) [-2633.979] -- 0:01:35 459000 -- (-2631.523) [-2638.010] (-2636.037) (-2634.578) * (-2638.050) [-2633.507] (-2643.229) (-2638.132) -- 0:01:36 459500 -- (-2635.659) [-2634.777] (-2637.469) (-2639.522) * (-2632.799) [-2634.601] (-2640.587) (-2633.626) -- 0:01:36 460000 -- (-2644.753) (-2647.674) (-2633.157) [-2638.332] * (-2637.152) (-2633.928) (-2636.483) [-2632.049] -- 0:01:36 Average standard deviation of split frequencies: 0.000000 460500 -- (-2639.446) [-2638.134] (-2630.904) (-2634.634) * [-2638.890] (-2633.517) (-2633.114) (-2636.341) -- 0:01:36 461000 -- [-2640.127] (-2632.469) (-2634.955) (-2638.138) * (-2635.809) (-2638.714) (-2638.935) [-2635.262] -- 0:01:35 461500 -- (-2635.234) [-2633.051] (-2634.037) (-2638.348) * (-2633.638) (-2636.072) [-2636.119] (-2641.663) -- 0:01:35 462000 -- (-2635.925) [-2633.229] (-2634.219) (-2632.100) * (-2645.576) [-2634.362] (-2635.229) (-2635.746) -- 0:01:35 462500 -- [-2638.464] (-2632.344) (-2638.794) (-2635.917) * (-2638.965) [-2638.339] (-2635.997) (-2642.275) -- 0:01:35 463000 -- [-2632.969] (-2630.646) (-2640.676) (-2629.032) * (-2634.823) (-2635.220) [-2634.544] (-2633.048) -- 0:01:35 463500 -- (-2633.869) [-2630.424] (-2639.014) (-2638.520) * [-2639.213] (-2632.651) (-2631.533) (-2644.442) -- 0:01:34 464000 -- (-2641.269) [-2635.390] (-2643.483) (-2638.199) * (-2635.955) (-2633.796) (-2630.498) [-2637.007] -- 0:01:34 464500 -- (-2633.984) (-2635.539) (-2634.324) [-2637.433] * [-2632.514] (-2633.765) (-2639.782) (-2636.528) -- 0:01:35 465000 -- (-2631.364) (-2631.628) (-2634.663) [-2639.534] * (-2638.107) (-2636.417) [-2637.910] (-2633.975) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 465500 -- (-2635.582) (-2640.520) (-2635.949) [-2634.500] * (-2636.506) [-2631.231] (-2638.333) (-2637.633) -- 0:01:35 466000 -- (-2637.219) (-2636.243) (-2637.200) [-2638.309] * (-2638.824) (-2632.948) [-2632.289] (-2636.247) -- 0:01:35 466500 -- (-2636.395) [-2631.843] (-2636.703) (-2639.730) * (-2635.739) [-2631.953] (-2637.781) (-2633.858) -- 0:01:34 467000 -- (-2636.144) (-2633.503) (-2637.081) [-2635.654] * (-2633.219) [-2633.512] (-2637.188) (-2638.739) -- 0:01:34 467500 -- (-2636.436) (-2636.809) (-2637.318) [-2636.552] * (-2635.110) [-2632.591] (-2637.419) (-2635.133) -- 0:01:34 468000 -- [-2643.752] (-2639.385) (-2639.603) (-2636.147) * (-2638.594) (-2640.064) [-2634.328] (-2636.301) -- 0:01:34 468500 -- (-2646.084) [-2636.389] (-2640.325) (-2635.157) * (-2635.755) [-2633.546] (-2640.595) (-2636.049) -- 0:01:34 469000 -- (-2638.944) [-2637.845] (-2640.083) (-2633.297) * (-2632.505) (-2634.266) (-2636.729) [-2636.759] -- 0:01:33 469500 -- (-2637.960) (-2636.181) (-2637.401) [-2635.078] * (-2638.270) (-2633.974) [-2634.434] (-2635.000) -- 0:01:33 470000 -- (-2633.132) (-2640.235) (-2633.421) [-2636.276] * (-2634.544) (-2637.119) (-2635.406) [-2632.941] -- 0:01:34 Average standard deviation of split frequencies: 0.000000 470500 -- (-2637.759) [-2636.509] (-2633.434) (-2638.970) * (-2635.165) (-2637.190) [-2633.401] (-2639.244) -- 0:01:34 471000 -- (-2634.508) [-2635.956] (-2632.745) (-2637.146) * [-2635.721] (-2632.239) (-2636.579) (-2632.010) -- 0:01:34 471500 -- (-2634.221) (-2634.444) [-2630.334] (-2633.832) * (-2639.707) [-2644.283] (-2638.663) (-2643.247) -- 0:01:34 472000 -- [-2637.456] (-2635.169) (-2634.043) (-2636.443) * [-2642.914] (-2636.656) (-2632.039) (-2636.278) -- 0:01:33 472500 -- [-2636.135] (-2640.968) (-2633.001) (-2635.012) * (-2637.504) (-2638.088) [-2632.578] (-2636.383) -- 0:01:33 473000 -- (-2633.321) [-2632.140] (-2635.170) (-2635.242) * [-2631.726] (-2636.428) (-2631.008) (-2639.465) -- 0:01:33 473500 -- (-2634.405) [-2635.161] (-2633.575) (-2633.674) * (-2635.073) (-2638.811) [-2631.340] (-2632.658) -- 0:01:33 474000 -- (-2637.630) [-2634.482] (-2637.365) (-2637.036) * (-2634.097) (-2634.052) (-2636.566) [-2634.355] -- 0:01:33 474500 -- (-2639.476) (-2635.329) (-2633.232) [-2634.703] * (-2635.845) [-2638.036] (-2638.124) (-2641.592) -- 0:01:33 475000 -- [-2635.258] (-2636.565) (-2635.918) (-2639.229) * (-2639.222) (-2631.823) [-2633.935] (-2635.043) -- 0:01:32 Average standard deviation of split frequencies: 0.000000 475500 -- (-2641.262) (-2635.883) [-2635.439] (-2637.376) * (-2632.600) (-2638.616) [-2637.732] (-2636.637) -- 0:01:33 476000 -- (-2645.031) [-2634.872] (-2637.145) (-2637.543) * [-2635.071] (-2634.007) (-2635.852) (-2634.098) -- 0:01:33 476500 -- (-2636.111) (-2640.834) (-2640.522) [-2641.630] * (-2638.740) (-2636.715) (-2646.831) [-2635.877] -- 0:01:33 477000 -- (-2636.646) [-2633.296] (-2634.604) (-2642.308) * (-2635.724) (-2637.616) [-2634.757] (-2635.921) -- 0:01:33 477500 -- (-2636.576) (-2633.628) (-2635.565) [-2639.880] * (-2643.286) (-2635.202) (-2635.384) [-2638.684] -- 0:01:33 478000 -- [-2635.974] (-2640.531) (-2638.370) (-2637.011) * (-2633.146) (-2633.770) [-2634.358] (-2635.909) -- 0:01:32 478500 -- [-2634.839] (-2641.388) (-2636.872) (-2633.905) * [-2633.646] (-2637.305) (-2641.922) (-2640.530) -- 0:01:32 479000 -- [-2630.848] (-2634.621) (-2634.632) (-2633.563) * (-2630.032) (-2637.745) (-2633.914) [-2636.503] -- 0:01:32 479500 -- (-2631.846) [-2636.147] (-2633.762) (-2638.404) * (-2639.040) (-2634.480) [-2639.725] (-2639.672) -- 0:01:32 480000 -- (-2636.644) (-2637.910) (-2640.923) [-2632.410] * (-2635.181) (-2635.994) (-2635.816) [-2631.716] -- 0:01:32 Average standard deviation of split frequencies: 0.000000 480500 -- [-2636.151] (-2637.611) (-2640.228) (-2632.045) * (-2635.335) (-2634.235) (-2632.917) [-2634.734] -- 0:01:31 481000 -- (-2639.985) (-2640.444) (-2643.388) [-2633.429] * (-2634.311) (-2632.105) (-2631.724) [-2634.571] -- 0:01:31 481500 -- (-2649.384) [-2641.999] (-2636.201) (-2636.810) * (-2632.672) (-2635.933) [-2634.584] (-2632.057) -- 0:01:32 482000 -- (-2635.156) (-2638.468) (-2633.660) [-2632.370] * (-2638.060) (-2634.274) [-2634.424] (-2633.951) -- 0:01:32 482500 -- (-2637.183) (-2637.238) (-2636.708) [-2633.258] * (-2635.710) [-2639.495] (-2638.104) (-2636.106) -- 0:01:32 483000 -- (-2641.260) (-2634.487) (-2640.579) [-2631.716] * (-2642.273) (-2634.791) [-2643.237] (-2632.803) -- 0:01:32 483500 -- (-2635.336) (-2631.516) (-2633.128) [-2632.679] * [-2640.545] (-2631.793) (-2636.611) (-2640.298) -- 0:01:31 484000 -- [-2635.562] (-2635.747) (-2634.865) (-2634.190) * (-2641.038) (-2637.207) [-2640.295] (-2632.928) -- 0:01:31 484500 -- (-2636.463) [-2630.728] (-2636.226) (-2632.796) * (-2635.971) (-2631.999) [-2642.433] (-2638.735) -- 0:01:31 485000 -- (-2637.623) [-2636.722] (-2634.928) (-2639.477) * (-2639.535) [-2631.124] (-2637.122) (-2630.745) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 485500 -- [-2633.164] (-2634.485) (-2634.756) (-2635.113) * (-2635.874) [-2634.969] (-2640.540) (-2638.713) -- 0:01:31 486000 -- [-2632.369] (-2633.290) (-2635.295) (-2647.777) * (-2636.670) (-2636.072) [-2634.272] (-2635.648) -- 0:01:30 486500 -- (-2636.514) [-2637.249] (-2639.992) (-2633.926) * (-2638.806) [-2637.804] (-2637.593) (-2635.515) -- 0:01:30 487000 -- (-2633.083) (-2637.881) [-2633.701] (-2631.914) * (-2635.005) (-2635.903) [-2634.095] (-2637.629) -- 0:01:31 487500 -- (-2632.969) (-2639.683) (-2637.669) [-2632.162] * (-2639.590) (-2635.947) (-2644.641) [-2635.674] -- 0:01:31 488000 -- (-2636.271) (-2639.691) (-2633.698) [-2636.597] * (-2632.794) (-2640.252) [-2638.804] (-2635.804) -- 0:01:31 488500 -- [-2635.130] (-2639.719) (-2634.022) (-2636.668) * (-2641.150) (-2635.650) (-2638.031) [-2635.543] -- 0:01:31 489000 -- [-2629.304] (-2639.247) (-2632.673) (-2636.787) * (-2633.599) [-2633.517] (-2637.147) (-2633.111) -- 0:01:30 489500 -- (-2635.438) [-2636.529] (-2635.512) (-2633.919) * [-2635.262] (-2637.589) (-2636.898) (-2641.552) -- 0:01:30 490000 -- (-2639.052) (-2635.549) (-2632.472) [-2638.173] * (-2634.151) (-2634.744) (-2635.112) [-2634.501] -- 0:01:30 Average standard deviation of split frequencies: 0.000000 490500 -- (-2636.034) (-2632.947) (-2635.783) [-2633.977] * (-2639.176) [-2634.332] (-2641.310) (-2633.918) -- 0:01:30 491000 -- (-2635.418) (-2632.228) (-2634.754) [-2634.231] * [-2642.047] (-2636.118) (-2641.434) (-2638.070) -- 0:01:30 491500 -- (-2638.064) (-2635.197) [-2642.157] (-2638.212) * [-2635.160] (-2634.859) (-2637.277) (-2639.042) -- 0:01:30 492000 -- (-2635.885) (-2632.735) (-2636.056) [-2639.621] * [-2637.281] (-2632.165) (-2636.651) (-2637.921) -- 0:01:29 492500 -- (-2637.015) [-2635.832] (-2635.097) (-2635.774) * (-2638.906) (-2636.036) (-2635.965) [-2637.704] -- 0:01:30 493000 -- [-2636.763] (-2636.113) (-2636.262) (-2642.593) * [-2634.047] (-2639.244) (-2641.484) (-2631.905) -- 0:01:30 493500 -- (-2634.914) (-2635.977) [-2635.558] (-2635.140) * [-2635.644] (-2639.272) (-2634.370) (-2634.401) -- 0:01:30 494000 -- (-2635.321) (-2647.756) [-2637.611] (-2634.244) * (-2640.632) (-2636.882) [-2634.190] (-2633.656) -- 0:01:30 494500 -- (-2636.274) (-2637.019) (-2635.134) [-2631.158] * (-2634.638) [-2636.529] (-2633.756) (-2633.293) -- 0:01:29 495000 -- (-2638.429) (-2635.907) (-2637.243) [-2634.856] * (-2638.869) (-2634.219) (-2642.273) [-2636.372] -- 0:01:29 Average standard deviation of split frequencies: 0.000000 495500 -- (-2635.554) (-2640.075) (-2634.106) [-2632.419] * (-2631.697) [-2635.300] (-2634.678) (-2636.328) -- 0:01:29 496000 -- (-2632.964) (-2630.243) (-2640.629) [-2629.944] * (-2633.196) [-2634.687] (-2632.712) (-2632.096) -- 0:01:29 496500 -- [-2637.886] (-2637.405) (-2640.013) (-2637.658) * (-2636.221) (-2640.681) (-2635.602) [-2631.556] -- 0:01:29 497000 -- (-2639.385) (-2635.949) (-2636.450) [-2637.784] * [-2637.421] (-2638.643) (-2643.054) (-2636.396) -- 0:01:29 497500 -- (-2633.722) (-2632.421) [-2637.647] (-2634.257) * (-2631.813) (-2642.793) (-2633.240) [-2634.525] -- 0:01:28 498000 -- (-2635.724) (-2632.747) [-2630.886] (-2633.708) * (-2637.220) (-2637.197) (-2636.397) [-2631.479] -- 0:01:29 498500 -- [-2631.340] (-2637.118) (-2637.035) (-2641.300) * (-2636.318) [-2633.435] (-2636.517) (-2630.459) -- 0:01:29 499000 -- (-2635.457) (-2637.821) [-2629.717] (-2639.089) * [-2633.575] (-2633.839) (-2635.950) (-2634.710) -- 0:01:29 499500 -- [-2638.302] (-2635.651) (-2632.969) (-2637.267) * (-2636.780) (-2635.572) [-2635.220] (-2633.956) -- 0:01:29 500000 -- (-2636.069) (-2635.679) (-2635.321) [-2629.867] * (-2637.092) (-2636.362) [-2633.078] (-2634.550) -- 0:01:29 Average standard deviation of split frequencies: 0.000000 500500 -- (-2636.270) (-2636.325) (-2638.672) [-2628.976] * (-2635.503) [-2632.612] (-2639.157) (-2639.144) -- 0:01:28 501000 -- (-2639.252) (-2634.840) (-2636.075) [-2637.029] * (-2638.768) (-2634.287) [-2630.762] (-2636.539) -- 0:01:28 501500 -- (-2641.679) [-2633.841] (-2633.202) (-2643.535) * (-2640.595) [-2633.491] (-2633.285) (-2637.541) -- 0:01:28 502000 -- (-2645.286) (-2639.868) (-2639.945) [-2634.356] * [-2640.081] (-2637.111) (-2637.008) (-2636.263) -- 0:01:28 502500 -- (-2641.615) (-2635.228) (-2637.650) [-2639.071] * [-2630.956] (-2632.715) (-2635.104) (-2636.756) -- 0:01:28 503000 -- [-2636.227] (-2640.046) (-2636.781) (-2634.940) * [-2641.920] (-2636.009) (-2636.431) (-2644.585) -- 0:01:27 503500 -- (-2634.815) (-2641.567) [-2636.654] (-2642.288) * (-2634.764) [-2640.436] (-2632.024) (-2646.916) -- 0:01:27 504000 -- [-2632.978] (-2642.285) (-2637.568) (-2634.026) * (-2636.836) (-2637.822) (-2641.065) [-2636.101] -- 0:01:28 504500 -- (-2634.879) [-2634.555] (-2630.918) (-2631.181) * (-2633.247) (-2637.243) [-2634.906] (-2634.512) -- 0:01:28 505000 -- [-2638.420] (-2633.872) (-2634.008) (-2635.095) * (-2635.579) (-2634.550) (-2635.685) [-2637.043] -- 0:01:28 Average standard deviation of split frequencies: 0.000000 505500 -- (-2639.096) [-2637.966] (-2642.154) (-2637.435) * [-2631.312] (-2635.308) (-2645.092) (-2636.040) -- 0:01:28 506000 -- [-2639.226] (-2635.262) (-2636.460) (-2635.920) * (-2635.051) (-2635.167) [-2634.242] (-2636.262) -- 0:01:27 506500 -- (-2640.461) (-2632.143) [-2636.324] (-2633.174) * (-2637.474) (-2641.150) [-2631.051] (-2634.002) -- 0:01:27 507000 -- (-2635.448) [-2636.248] (-2636.432) (-2635.480) * (-2631.237) (-2633.535) [-2633.124] (-2632.642) -- 0:01:27 507500 -- [-2634.816] (-2634.481) (-2635.423) (-2640.819) * (-2636.941) (-2637.688) [-2636.204] (-2636.943) -- 0:01:27 508000 -- [-2638.564] (-2632.435) (-2640.517) (-2646.243) * (-2639.410) (-2630.624) (-2635.197) [-2632.998] -- 0:01:27 508500 -- [-2636.299] (-2641.280) (-2636.692) (-2640.922) * [-2636.320] (-2636.823) (-2640.392) (-2639.328) -- 0:01:26 509000 -- [-2634.499] (-2641.581) (-2635.335) (-2636.997) * [-2631.085] (-2634.192) (-2637.199) (-2639.991) -- 0:01:26 509500 -- [-2635.616] (-2639.254) (-2634.986) (-2634.558) * (-2637.485) [-2639.851] (-2638.977) (-2642.931) -- 0:01:27 510000 -- (-2641.678) (-2638.881) [-2633.520] (-2635.905) * (-2636.563) (-2637.851) (-2636.972) [-2635.323] -- 0:01:27 Average standard deviation of split frequencies: 0.000000 510500 -- (-2643.917) [-2635.340] (-2635.124) (-2634.154) * (-2637.517) (-2638.972) (-2637.361) [-2637.562] -- 0:01:27 511000 -- (-2633.521) [-2637.287] (-2634.037) (-2636.827) * (-2632.662) [-2640.218] (-2635.765) (-2632.561) -- 0:01:27 511500 -- (-2636.597) [-2633.869] (-2635.272) (-2637.379) * (-2635.346) [-2635.483] (-2641.438) (-2639.126) -- 0:01:26 512000 -- (-2635.459) [-2633.435] (-2635.316) (-2638.996) * (-2634.727) (-2638.956) [-2634.147] (-2639.016) -- 0:01:26 512500 -- [-2638.557] (-2639.252) (-2633.284) (-2636.870) * [-2632.940] (-2639.419) (-2636.014) (-2630.657) -- 0:01:26 513000 -- [-2637.421] (-2638.976) (-2634.736) (-2638.688) * (-2634.525) (-2634.783) [-2631.962] (-2639.961) -- 0:01:26 513500 -- (-2637.175) [-2635.710] (-2637.025) (-2636.358) * [-2631.558] (-2634.190) (-2633.804) (-2633.293) -- 0:01:26 514000 -- (-2640.540) [-2629.989] (-2639.396) (-2640.194) * (-2631.190) [-2633.629] (-2635.870) (-2635.012) -- 0:01:26 514500 -- [-2636.138] (-2632.545) (-2636.075) (-2639.045) * (-2637.729) (-2635.191) [-2634.931] (-2632.824) -- 0:01:25 515000 -- [-2636.163] (-2632.598) (-2644.703) (-2632.755) * (-2645.908) (-2637.717) [-2636.409] (-2635.973) -- 0:01:26 Average standard deviation of split frequencies: 0.000000 515500 -- (-2631.627) [-2637.383] (-2635.881) (-2638.220) * (-2635.770) (-2636.483) [-2630.810] (-2634.903) -- 0:01:26 516000 -- [-2632.657] (-2636.343) (-2636.014) (-2636.642) * [-2638.894] (-2633.016) (-2637.033) (-2637.845) -- 0:01:26 516500 -- (-2634.271) (-2631.601) [-2638.632] (-2637.066) * (-2640.424) (-2633.502) [-2636.397] (-2635.771) -- 0:01:26 517000 -- (-2633.366) (-2633.012) [-2641.439] (-2634.889) * (-2640.490) [-2633.191] (-2639.877) (-2637.875) -- 0:01:25 517500 -- (-2636.319) [-2632.424] (-2642.386) (-2638.201) * (-2635.802) (-2636.250) [-2631.798] (-2642.992) -- 0:01:25 518000 -- (-2637.079) [-2638.585] (-2639.673) (-2649.449) * (-2642.400) (-2637.903) [-2634.399] (-2637.542) -- 0:01:25 518500 -- (-2633.401) (-2632.838) [-2634.743] (-2639.895) * [-2636.770] (-2633.273) (-2635.027) (-2638.237) -- 0:01:25 519000 -- [-2638.700] (-2642.091) (-2635.525) (-2632.411) * (-2637.037) (-2633.453) [-2632.877] (-2644.936) -- 0:01:25 519500 -- (-2635.581) [-2635.299] (-2635.066) (-2640.801) * (-2634.048) (-2636.048) [-2632.127] (-2639.540) -- 0:01:25 520000 -- (-2640.637) (-2641.167) (-2640.596) [-2635.946] * (-2631.142) (-2635.672) (-2634.226) [-2640.673] -- 0:01:24 Average standard deviation of split frequencies: 0.000000 520500 -- [-2635.644] (-2636.974) (-2646.828) (-2634.540) * (-2639.679) [-2637.237] (-2633.116) (-2632.757) -- 0:01:25 521000 -- (-2639.418) (-2635.224) (-2638.511) [-2638.661] * (-2632.306) (-2639.532) (-2634.369) [-2634.134] -- 0:01:25 521500 -- (-2637.633) (-2634.631) (-2641.355) [-2633.746] * (-2633.602) (-2635.065) [-2637.925] (-2634.735) -- 0:01:25 522000 -- (-2636.467) (-2639.389) [-2633.566] (-2633.893) * (-2648.762) [-2634.388] (-2635.762) (-2631.138) -- 0:01:25 522500 -- (-2637.039) [-2633.034] (-2636.999) (-2638.379) * (-2634.257) [-2636.614] (-2634.576) (-2634.292) -- 0:01:24 523000 -- (-2643.478) (-2638.992) [-2635.895] (-2633.251) * (-2641.317) (-2638.731) (-2635.054) [-2636.119] -- 0:01:24 523500 -- (-2640.148) [-2634.163] (-2639.143) (-2632.719) * [-2638.657] (-2632.124) (-2634.841) (-2632.252) -- 0:01:24 524000 -- (-2641.492) (-2633.209) [-2630.095] (-2633.996) * (-2641.180) [-2640.802] (-2636.053) (-2638.116) -- 0:01:24 524500 -- (-2643.532) (-2640.296) [-2631.756] (-2634.047) * (-2635.487) (-2636.380) [-2637.479] (-2636.232) -- 0:01:24 525000 -- (-2643.537) (-2644.870) (-2635.181) [-2643.087] * (-2638.185) (-2637.632) (-2640.174) [-2634.374] -- 0:01:24 Average standard deviation of split frequencies: 0.000000 525500 -- (-2636.540) (-2638.711) [-2635.343] (-2639.552) * (-2633.427) (-2636.649) (-2634.528) [-2636.338] -- 0:01:24 526000 -- [-2634.946] (-2635.507) (-2636.925) (-2640.047) * (-2636.442) [-2639.100] (-2635.080) (-2634.488) -- 0:01:24 526500 -- (-2636.021) (-2634.480) (-2636.813) [-2633.131] * (-2638.066) [-2638.534] (-2635.287) (-2635.253) -- 0:01:24 527000 -- (-2637.048) [-2631.710] (-2638.023) (-2635.681) * (-2636.725) (-2639.070) (-2639.480) [-2635.623] -- 0:01:24 527500 -- (-2633.931) (-2637.247) (-2634.221) [-2636.518] * [-2634.639] (-2644.336) (-2633.101) (-2632.550) -- 0:01:24 528000 -- (-2639.891) (-2633.471) [-2636.297] (-2640.019) * (-2636.397) [-2636.885] (-2637.219) (-2634.268) -- 0:01:24 528500 -- [-2634.188] (-2635.187) (-2640.078) (-2636.325) * (-2645.661) (-2634.353) [-2633.483] (-2640.755) -- 0:01:23 529000 -- (-2640.262) [-2640.000] (-2639.919) (-2633.681) * (-2640.395) [-2640.235] (-2635.683) (-2639.147) -- 0:01:23 529500 -- [-2633.600] (-2637.989) (-2638.401) (-2640.945) * (-2639.386) (-2636.593) (-2635.796) [-2632.185] -- 0:01:23 530000 -- [-2635.117] (-2638.557) (-2634.963) (-2638.630) * (-2636.029) (-2632.194) [-2635.255] (-2635.491) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 530500 -- (-2638.602) [-2638.164] (-2637.221) (-2645.365) * (-2642.479) [-2634.034] (-2632.984) (-2637.146) -- 0:01:23 531000 -- [-2632.883] (-2640.534) (-2635.159) (-2636.751) * [-2635.803] (-2635.932) (-2637.969) (-2641.161) -- 0:01:23 531500 -- (-2638.363) (-2638.775) (-2637.024) [-2635.533] * [-2636.171] (-2639.198) (-2638.704) (-2637.225) -- 0:01:23 532000 -- (-2632.184) [-2638.609] (-2640.146) (-2640.895) * [-2632.985] (-2642.491) (-2641.307) (-2632.508) -- 0:01:23 532500 -- [-2636.463] (-2641.103) (-2634.412) (-2634.789) * [-2631.286] (-2638.545) (-2635.131) (-2639.546) -- 0:01:23 533000 -- (-2639.763) (-2640.520) [-2632.860] (-2644.789) * (-2637.061) (-2632.351) (-2648.865) [-2637.649] -- 0:01:23 533500 -- (-2636.360) (-2634.428) [-2636.230] (-2644.523) * [-2632.979] (-2638.174) (-2637.091) (-2639.120) -- 0:01:23 534000 -- (-2632.563) (-2633.710) [-2634.241] (-2638.398) * [-2640.976] (-2640.834) (-2641.490) (-2638.750) -- 0:01:22 534500 -- (-2630.221) (-2635.591) (-2634.119) [-2637.729] * (-2639.260) (-2643.456) [-2634.365] (-2635.740) -- 0:01:22 535000 -- (-2638.203) (-2639.915) (-2643.683) [-2635.450] * [-2635.248] (-2643.034) (-2638.965) (-2631.092) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 535500 -- (-2635.648) (-2641.085) (-2632.245) [-2638.340] * [-2636.026] (-2631.727) (-2637.287) (-2634.066) -- 0:01:22 536000 -- [-2638.138] (-2636.527) (-2634.592) (-2636.325) * [-2633.572] (-2637.267) (-2636.796) (-2639.689) -- 0:01:22 536500 -- (-2637.417) (-2638.047) (-2636.075) [-2636.798] * (-2634.131) [-2631.326] (-2641.769) (-2635.301) -- 0:01:22 537000 -- [-2633.379] (-2635.031) (-2638.466) (-2634.068) * (-2639.459) [-2635.546] (-2638.861) (-2637.354) -- 0:01:22 537500 -- (-2632.880) [-2634.102] (-2632.876) (-2639.554) * (-2637.568) (-2632.473) [-2634.151] (-2636.923) -- 0:01:22 538000 -- (-2637.124) (-2637.315) (-2639.171) [-2635.879] * (-2640.236) [-2638.724] (-2634.194) (-2635.444) -- 0:01:22 538500 -- (-2639.508) [-2634.188] (-2637.959) (-2637.771) * (-2637.010) (-2639.883) [-2636.169] (-2639.299) -- 0:01:22 539000 -- [-2632.887] (-2640.458) (-2635.471) (-2635.316) * [-2631.012] (-2638.944) (-2634.583) (-2636.836) -- 0:01:22 539500 -- (-2639.126) [-2641.684] (-2639.293) (-2635.850) * (-2648.360) (-2639.610) (-2633.128) [-2633.185] -- 0:01:21 540000 -- [-2632.311] (-2632.381) (-2641.312) (-2637.089) * (-2633.202) [-2633.916] (-2639.419) (-2638.092) -- 0:01:21 Average standard deviation of split frequencies: 0.000000 540500 -- (-2635.493) [-2639.474] (-2639.250) (-2634.865) * (-2632.671) [-2632.949] (-2633.150) (-2637.760) -- 0:01:21 541000 -- (-2636.611) (-2640.984) [-2632.451] (-2639.617) * (-2634.799) (-2637.039) [-2634.331] (-2642.319) -- 0:01:21 541500 -- (-2633.464) [-2635.741] (-2634.172) (-2631.517) * (-2639.697) [-2639.519] (-2636.256) (-2642.014) -- 0:01:21 542000 -- [-2634.063] (-2638.162) (-2636.178) (-2637.152) * [-2633.635] (-2635.249) (-2639.762) (-2631.301) -- 0:01:21 542500 -- (-2633.917) (-2633.577) (-2634.723) [-2640.203] * (-2642.976) (-2638.397) (-2631.341) [-2639.507] -- 0:01:21 543000 -- (-2633.242) (-2633.344) [-2637.787] (-2631.814) * (-2637.212) [-2641.306] (-2633.071) (-2629.915) -- 0:01:21 543500 -- (-2636.486) [-2630.486] (-2633.722) (-2631.941) * [-2634.119] (-2635.336) (-2632.078) (-2636.638) -- 0:01:21 544000 -- [-2638.033] (-2638.950) (-2638.645) (-2633.968) * (-2637.521) (-2635.909) (-2633.995) [-2635.921] -- 0:01:21 544500 -- (-2632.525) (-2641.903) (-2646.745) [-2638.037] * (-2645.820) (-2638.058) [-2638.424] (-2636.780) -- 0:01:21 545000 -- (-2636.452) (-2635.962) [-2634.065] (-2635.028) * (-2636.194) [-2632.454] (-2631.978) (-2647.275) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 545500 -- [-2633.537] (-2638.621) (-2636.728) (-2634.545) * (-2637.801) (-2642.152) (-2633.120) [-2635.468] -- 0:01:20 546000 -- (-2634.674) [-2633.224] (-2633.089) (-2638.096) * (-2632.428) (-2636.554) [-2635.161] (-2633.506) -- 0:01:20 546500 -- (-2638.184) (-2634.722) [-2635.959] (-2632.734) * (-2633.972) (-2638.719) [-2634.213] (-2633.798) -- 0:01:20 547000 -- [-2638.072] (-2634.819) (-2629.169) (-2634.908) * (-2637.885) (-2634.474) (-2631.589) [-2631.300] -- 0:01:20 547500 -- [-2639.054] (-2639.113) (-2640.174) (-2634.310) * [-2632.752] (-2634.938) (-2633.281) (-2629.953) -- 0:01:20 548000 -- (-2643.826) (-2640.479) (-2635.186) [-2636.945] * (-2632.444) [-2640.346] (-2639.125) (-2639.100) -- 0:01:20 548500 -- (-2635.648) (-2633.330) [-2635.677] (-2641.299) * (-2633.731) [-2634.164] (-2632.635) (-2631.630) -- 0:01:20 549000 -- [-2631.283] (-2642.137) (-2638.759) (-2635.302) * [-2635.233] (-2641.424) (-2640.711) (-2634.800) -- 0:01:20 549500 -- (-2634.276) [-2635.947] (-2642.513) (-2633.034) * [-2639.289] (-2634.671) (-2636.563) (-2635.904) -- 0:01:20 550000 -- (-2636.488) (-2636.730) [-2643.384] (-2640.530) * (-2631.118) (-2632.237) [-2636.968] (-2636.303) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 550500 -- (-2636.923) [-2639.312] (-2635.405) (-2638.155) * (-2634.791) (-2636.034) [-2636.599] (-2633.671) -- 0:01:20 551000 -- (-2629.966) (-2639.786) (-2634.449) [-2632.635] * (-2642.718) [-2637.220] (-2646.916) (-2631.503) -- 0:01:19 551500 -- (-2636.401) (-2644.103) (-2642.993) [-2634.086] * (-2631.876) (-2635.448) (-2641.628) [-2636.201] -- 0:01:19 552000 -- (-2640.238) [-2635.869] (-2630.308) (-2642.891) * (-2635.822) [-2634.107] (-2636.117) (-2635.907) -- 0:01:19 552500 -- (-2638.807) [-2638.582] (-2635.013) (-2632.389) * (-2642.372) (-2635.085) (-2633.298) [-2633.650] -- 0:01:19 553000 -- (-2631.089) [-2633.714] (-2630.131) (-2629.750) * (-2635.215) [-2633.488] (-2636.884) (-2635.776) -- 0:01:19 553500 -- (-2631.936) (-2638.356) (-2634.971) [-2630.910] * [-2635.621] (-2636.667) (-2636.971) (-2631.569) -- 0:01:19 554000 -- [-2630.168] (-2641.336) (-2639.306) (-2634.887) * (-2629.802) (-2630.884) [-2631.646] (-2640.081) -- 0:01:19 554500 -- (-2630.808) (-2634.565) (-2645.814) [-2635.287] * (-2635.901) [-2635.218] (-2638.663) (-2634.531) -- 0:01:19 555000 -- (-2630.610) (-2643.246) [-2637.338] (-2631.840) * [-2636.277] (-2638.783) (-2637.195) (-2634.314) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 555500 -- (-2629.254) [-2632.892] (-2639.018) (-2634.395) * (-2635.563) (-2631.163) [-2632.979] (-2636.396) -- 0:01:19 556000 -- (-2630.405) (-2637.358) [-2638.187] (-2651.966) * [-2631.933] (-2638.079) (-2632.839) (-2633.294) -- 0:01:19 556500 -- (-2636.200) [-2635.589] (-2633.366) (-2635.154) * [-2631.369] (-2630.715) (-2637.121) (-2642.403) -- 0:01:18 557000 -- (-2640.038) [-2632.671] (-2643.451) (-2641.899) * [-2634.058] (-2636.926) (-2636.503) (-2637.134) -- 0:01:18 557500 -- (-2636.235) (-2634.987) [-2632.756] (-2637.201) * (-2632.305) (-2632.531) [-2639.775] (-2640.073) -- 0:01:18 558000 -- (-2637.032) [-2632.528] (-2635.699) (-2636.737) * (-2633.827) [-2633.439] (-2632.663) (-2631.171) -- 0:01:18 558500 -- (-2632.775) (-2638.144) (-2633.706) [-2635.221] * (-2640.415) [-2630.718] (-2641.619) (-2636.407) -- 0:01:18 559000 -- (-2636.568) (-2635.202) [-2638.588] (-2645.493) * (-2635.787) [-2640.544] (-2633.802) (-2633.146) -- 0:01:18 559500 -- (-2633.394) (-2633.789) [-2634.496] (-2641.194) * (-2634.983) (-2634.882) (-2640.588) [-2633.110] -- 0:01:17 560000 -- (-2645.319) (-2637.366) (-2633.477) [-2639.802] * (-2636.558) [-2636.396] (-2637.735) (-2633.339) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 560500 -- (-2636.792) (-2634.729) [-2639.216] (-2638.149) * [-2634.037] (-2632.820) (-2641.331) (-2635.279) -- 0:01:18 561000 -- (-2636.237) (-2643.882) [-2639.344] (-2636.980) * (-2633.228) (-2640.526) (-2637.240) [-2633.124] -- 0:01:18 561500 -- (-2638.596) (-2634.989) [-2640.108] (-2643.438) * (-2630.229) (-2634.885) (-2641.293) [-2637.355] -- 0:01:18 562000 -- (-2643.748) (-2635.959) [-2636.214] (-2638.410) * (-2639.218) (-2636.060) [-2635.789] (-2635.258) -- 0:01:17 562500 -- (-2633.493) (-2638.544) (-2643.481) [-2638.254] * [-2632.397] (-2636.579) (-2637.532) (-2635.968) -- 0:01:17 563000 -- (-2640.836) (-2638.425) [-2638.289] (-2636.604) * (-2642.616) (-2636.747) (-2639.534) [-2633.932] -- 0:01:17 563500 -- (-2646.387) (-2635.041) [-2635.540] (-2634.309) * [-2632.436] (-2639.792) (-2638.699) (-2636.295) -- 0:01:17 564000 -- [-2638.024] (-2635.797) (-2637.431) (-2635.761) * (-2635.227) [-2631.201] (-2634.914) (-2638.285) -- 0:01:17 564500 -- (-2633.826) (-2641.546) [-2638.971] (-2636.150) * (-2639.308) (-2634.243) (-2637.705) [-2637.765] -- 0:01:17 565000 -- [-2632.648] (-2636.325) (-2634.653) (-2632.107) * (-2639.506) (-2639.728) (-2646.156) [-2638.300] -- 0:01:16 Average standard deviation of split frequencies: 0.000000 565500 -- [-2632.163] (-2644.212) (-2640.509) (-2634.878) * (-2632.539) (-2641.273) (-2640.305) [-2639.981] -- 0:01:17 566000 -- (-2638.909) (-2642.823) (-2642.083) [-2637.940] * (-2645.186) (-2635.184) [-2635.795] (-2639.668) -- 0:01:17 566500 -- [-2634.576] (-2637.742) (-2643.453) (-2636.889) * (-2638.802) (-2639.305) (-2635.266) [-2640.379] -- 0:01:17 567000 -- (-2636.181) (-2640.605) (-2641.501) [-2638.316] * (-2639.704) [-2639.044] (-2645.226) (-2641.386) -- 0:01:17 567500 -- (-2637.410) [-2634.995] (-2636.323) (-2636.459) * [-2636.911] (-2641.228) (-2637.165) (-2636.515) -- 0:01:16 568000 -- (-2637.513) (-2637.590) (-2644.304) [-2638.456] * [-2632.160] (-2636.724) (-2641.803) (-2639.443) -- 0:01:16 568500 -- [-2640.442] (-2640.333) (-2640.912) (-2637.544) * [-2634.516] (-2649.408) (-2634.824) (-2633.380) -- 0:01:16 569000 -- (-2639.607) [-2635.264] (-2639.551) (-2636.507) * [-2643.468] (-2634.316) (-2635.061) (-2633.636) -- 0:01:16 569500 -- (-2642.135) (-2635.880) (-2628.896) [-2639.488] * (-2641.487) (-2631.160) (-2639.367) [-2639.402] -- 0:01:16 570000 -- (-2644.392) [-2634.072] (-2633.829) (-2636.272) * (-2637.547) (-2639.094) (-2654.588) [-2638.900] -- 0:01:16 Average standard deviation of split frequencies: 0.000000 570500 -- (-2639.914) (-2633.540) (-2633.180) [-2638.439] * (-2633.738) [-2638.368] (-2641.674) (-2633.941) -- 0:01:16 571000 -- (-2635.454) [-2636.674] (-2634.738) (-2634.002) * (-2629.818) (-2632.836) [-2634.334] (-2633.000) -- 0:01:16 571500 -- (-2640.205) (-2634.296) [-2638.568] (-2634.045) * (-2639.725) [-2632.136] (-2633.622) (-2636.090) -- 0:01:16 572000 -- (-2636.843) (-2643.621) [-2631.974] (-2633.781) * (-2636.722) (-2632.656) [-2632.224] (-2641.661) -- 0:01:16 572500 -- (-2647.210) (-2632.535) (-2636.560) [-2632.156] * (-2635.157) (-2636.121) [-2632.708] (-2641.464) -- 0:01:16 573000 -- (-2642.945) (-2639.498) [-2633.508] (-2641.375) * (-2638.084) (-2637.783) (-2642.986) [-2637.257] -- 0:01:16 573500 -- (-2637.670) (-2641.908) (-2636.203) [-2633.535] * (-2634.359) [-2632.516] (-2635.227) (-2639.761) -- 0:01:15 574000 -- [-2636.045] (-2638.103) (-2634.952) (-2642.770) * (-2641.589) (-2634.273) (-2635.303) [-2630.426] -- 0:01:15 574500 -- (-2631.178) (-2645.742) (-2632.054) [-2640.016] * (-2633.391) [-2637.144] (-2633.336) (-2632.126) -- 0:01:15 575000 -- [-2633.023] (-2634.536) (-2648.853) (-2637.771) * (-2649.445) [-2637.114] (-2648.591) (-2633.084) -- 0:01:15 Average standard deviation of split frequencies: 0.000000 575500 -- (-2631.636) [-2637.218] (-2639.493) (-2644.276) * (-2638.300) (-2640.137) (-2637.053) [-2634.451] -- 0:01:15 576000 -- [-2633.191] (-2636.727) (-2635.427) (-2637.937) * [-2637.215] (-2635.854) (-2634.833) (-2632.315) -- 0:01:15 576500 -- (-2637.363) (-2634.132) [-2636.656] (-2631.579) * (-2641.214) (-2634.335) (-2638.125) [-2633.684] -- 0:01:15 577000 -- [-2632.325] (-2638.260) (-2633.272) (-2635.492) * (-2641.732) (-2631.003) (-2639.327) [-2636.157] -- 0:01:15 577500 -- (-2635.760) [-2633.568] (-2634.469) (-2638.496) * (-2637.057) (-2640.584) [-2635.011] (-2637.961) -- 0:01:15 578000 -- (-2634.379) (-2631.946) (-2633.241) [-2632.256] * [-2635.004] (-2637.032) (-2635.275) (-2633.151) -- 0:01:15 578500 -- (-2647.344) (-2638.601) [-2630.958] (-2637.421) * (-2632.712) (-2632.220) (-2637.681) [-2634.861] -- 0:01:15 579000 -- (-2637.125) (-2643.133) (-2636.080) [-2644.255] * (-2634.214) (-2644.562) [-2634.063] (-2635.182) -- 0:01:14 579500 -- [-2635.891] (-2639.110) (-2636.964) (-2638.465) * (-2634.713) (-2646.922) (-2639.519) [-2634.519] -- 0:01:14 580000 -- (-2632.626) (-2632.829) [-2633.111] (-2632.864) * (-2643.379) (-2640.933) (-2636.361) [-2638.024] -- 0:01:14 Average standard deviation of split frequencies: 0.000000 580500 -- (-2630.538) [-2631.606] (-2635.217) (-2632.548) * (-2639.212) [-2635.819] (-2635.646) (-2633.195) -- 0:01:14 581000 -- (-2635.135) (-2639.389) (-2637.498) [-2634.432] * (-2637.910) (-2636.080) (-2636.587) [-2633.706] -- 0:01:14 581500 -- (-2635.714) (-2632.580) [-2633.836] (-2633.982) * [-2631.856] (-2639.224) (-2634.608) (-2637.120) -- 0:01:14 582000 -- (-2643.269) (-2634.440) (-2639.277) [-2635.746] * [-2631.128] (-2639.860) (-2631.706) (-2637.849) -- 0:01:13 582500 -- [-2635.495] (-2634.474) (-2632.130) (-2635.077) * (-2637.218) (-2643.115) [-2635.924] (-2632.845) -- 0:01:14 583000 -- (-2638.453) (-2637.328) [-2633.881] (-2632.309) * (-2642.736) (-2638.411) (-2636.662) [-2634.392] -- 0:01:14 583500 -- (-2646.026) [-2631.855] (-2637.648) (-2636.135) * (-2641.779) (-2633.734) (-2636.449) [-2634.537] -- 0:01:14 584000 -- (-2635.701) [-2636.990] (-2640.170) (-2647.005) * (-2635.878) (-2644.654) (-2636.717) [-2637.741] -- 0:01:14 584500 -- (-2640.686) (-2634.399) (-2635.941) [-2636.101] * (-2643.579) (-2638.760) [-2635.365] (-2634.870) -- 0:01:13 585000 -- (-2641.163) (-2634.995) [-2633.822] (-2646.881) * [-2637.009] (-2642.392) (-2651.001) (-2635.803) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 585500 -- [-2632.694] (-2642.369) (-2629.407) (-2633.887) * [-2638.045] (-2640.834) (-2638.418) (-2636.996) -- 0:01:13 586000 -- (-2636.138) [-2635.427] (-2634.452) (-2635.712) * (-2640.195) (-2639.676) [-2636.068] (-2637.817) -- 0:01:13 586500 -- (-2636.852) (-2638.297) [-2638.496] (-2643.068) * [-2634.727] (-2638.551) (-2635.067) (-2631.080) -- 0:01:13 587000 -- (-2638.636) (-2630.596) [-2641.598] (-2642.845) * (-2645.455) (-2631.974) [-2631.973] (-2636.171) -- 0:01:13 587500 -- [-2639.572] (-2631.700) (-2638.206) (-2645.412) * (-2637.617) (-2643.365) [-2636.015] (-2642.074) -- 0:01:13 588000 -- (-2638.631) [-2631.644] (-2634.788) (-2637.531) * (-2634.822) [-2642.012] (-2638.155) (-2632.459) -- 0:01:13 588500 -- [-2631.618] (-2636.157) (-2643.322) (-2633.088) * [-2640.909] (-2639.303) (-2633.704) (-2633.700) -- 0:01:13 589000 -- [-2631.964] (-2631.825) (-2638.443) (-2635.605) * (-2636.341) [-2633.779] (-2629.067) (-2641.508) -- 0:01:13 589500 -- (-2639.612) [-2634.398] (-2634.327) (-2639.770) * (-2640.371) (-2636.594) (-2635.156) [-2633.952] -- 0:01:13 590000 -- (-2638.527) [-2634.026] (-2635.743) (-2642.287) * (-2632.807) (-2634.861) (-2635.529) [-2636.566] -- 0:01:12 Average standard deviation of split frequencies: 0.000000 590500 -- (-2634.309) (-2635.111) [-2632.869] (-2640.495) * (-2640.183) (-2636.694) [-2636.045] (-2636.937) -- 0:01:12 591000 -- (-2636.495) (-2645.341) (-2628.408) [-2639.688] * (-2638.436) (-2640.925) (-2637.991) [-2634.113] -- 0:01:12 591500 -- (-2634.224) [-2642.740] (-2641.750) (-2641.205) * (-2641.255) (-2636.481) (-2633.605) [-2635.234] -- 0:01:12 592000 -- (-2631.632) [-2641.371] (-2640.173) (-2634.883) * (-2641.285) (-2635.366) [-2638.094] (-2632.765) -- 0:01:12 592500 -- [-2636.982] (-2640.446) (-2639.172) (-2633.728) * [-2636.131] (-2637.847) (-2632.317) (-2637.023) -- 0:01:12 593000 -- (-2632.032) [-2632.451] (-2634.489) (-2642.925) * [-2637.325] (-2639.774) (-2638.808) (-2637.488) -- 0:01:12 593500 -- (-2639.015) (-2631.821) (-2636.760) [-2638.995] * (-2635.382) [-2631.503] (-2628.711) (-2641.622) -- 0:01:12 594000 -- [-2641.056] (-2639.660) (-2631.820) (-2634.664) * (-2642.596) (-2640.563) [-2629.256] (-2637.278) -- 0:01:12 594500 -- (-2639.172) (-2633.807) [-2631.471] (-2639.127) * (-2646.569) (-2635.142) [-2633.073] (-2636.997) -- 0:01:12 595000 -- [-2632.660] (-2636.417) (-2637.124) (-2633.930) * (-2639.914) (-2642.582) (-2632.675) [-2639.968] -- 0:01:12 Average standard deviation of split frequencies: 0.000000 595500 -- (-2641.815) [-2639.908] (-2633.782) (-2634.501) * [-2640.780] (-2636.970) (-2635.744) (-2639.931) -- 0:01:12 596000 -- (-2632.970) [-2635.109] (-2642.099) (-2645.571) * (-2636.382) [-2638.013] (-2636.434) (-2643.084) -- 0:01:11 596500 -- (-2644.400) (-2639.226) (-2638.126) [-2640.112] * (-2629.871) [-2633.838] (-2634.705) (-2636.425) -- 0:01:11 597000 -- (-2639.968) [-2630.679] (-2633.957) (-2635.481) * (-2630.910) [-2635.892] (-2638.293) (-2642.278) -- 0:01:11 597500 -- [-2632.334] (-2635.706) (-2637.301) (-2634.388) * (-2634.480) [-2637.307] (-2633.620) (-2642.341) -- 0:01:11 598000 -- (-2636.484) [-2634.727] (-2633.230) (-2642.024) * [-2630.485] (-2636.751) (-2633.468) (-2633.649) -- 0:01:11 598500 -- (-2639.965) [-2636.530] (-2636.827) (-2632.795) * [-2633.173] (-2639.325) (-2637.005) (-2636.874) -- 0:01:11 599000 -- (-2636.495) (-2632.751) (-2638.350) [-2638.527] * [-2632.554] (-2638.880) (-2636.371) (-2634.140) -- 0:01:10 599500 -- (-2628.602) [-2633.610] (-2633.626) (-2640.548) * (-2636.323) (-2643.994) (-2637.744) [-2633.811] -- 0:01:11 600000 -- [-2636.117] (-2640.705) (-2631.623) (-2638.648) * [-2635.019] (-2637.411) (-2634.528) (-2635.206) -- 0:01:11 Average standard deviation of split frequencies: 0.000000 600500 -- (-2638.695) (-2630.152) (-2633.483) [-2635.481] * (-2637.518) [-2636.243] (-2642.132) (-2646.933) -- 0:01:11 601000 -- (-2632.406) (-2633.637) [-2634.517] (-2642.279) * (-2637.055) (-2643.869) [-2636.194] (-2640.793) -- 0:01:11 601500 -- (-2632.125) (-2633.063) (-2641.022) [-2632.539] * (-2633.636) (-2631.669) [-2632.832] (-2643.502) -- 0:01:10 602000 -- (-2637.330) (-2637.291) [-2633.721] (-2637.230) * [-2636.309] (-2639.545) (-2635.727) (-2641.484) -- 0:01:10 602500 -- (-2631.494) (-2637.548) (-2633.511) [-2634.568] * (-2633.237) (-2638.185) [-2636.749] (-2637.432) -- 0:01:10 603000 -- (-2637.014) (-2641.934) [-2631.649] (-2635.234) * [-2632.458] (-2637.926) (-2636.359) (-2639.677) -- 0:01:10 603500 -- (-2638.989) (-2636.624) (-2636.619) [-2636.048] * (-2632.039) (-2635.637) [-2637.277] (-2652.538) -- 0:01:10 604000 -- (-2637.544) (-2636.239) [-2635.092] (-2633.584) * (-2639.129) [-2636.868] (-2633.857) (-2638.108) -- 0:01:10 604500 -- (-2631.615) (-2635.336) (-2637.600) [-2637.073] * (-2636.535) (-2636.667) [-2645.177] (-2632.736) -- 0:01:10 605000 -- (-2636.407) (-2642.291) [-2632.940] (-2643.784) * (-2640.532) [-2639.152] (-2633.423) (-2635.047) -- 0:01:10 Average standard deviation of split frequencies: 0.000000 605500 -- [-2633.513] (-2647.086) (-2635.124) (-2642.749) * (-2633.525) (-2634.868) (-2638.587) [-2631.685] -- 0:01:10 606000 -- (-2634.101) (-2641.212) (-2637.788) [-2639.887] * [-2630.908] (-2641.819) (-2637.328) (-2636.662) -- 0:01:10 606500 -- (-2633.632) (-2634.702) (-2632.384) [-2635.972] * (-2640.835) [-2637.181] (-2637.772) (-2637.962) -- 0:01:10 607000 -- (-2635.121) [-2641.357] (-2636.506) (-2636.242) * (-2634.585) (-2637.100) [-2632.461] (-2635.100) -- 0:01:09 607500 -- (-2634.057) [-2637.619] (-2644.254) (-2631.279) * [-2632.709] (-2637.171) (-2633.095) (-2635.767) -- 0:01:09 608000 -- (-2633.208) (-2635.416) (-2644.413) [-2634.889] * (-2638.206) (-2641.668) (-2633.262) [-2635.052] -- 0:01:09 608500 -- (-2637.162) (-2635.151) [-2641.724] (-2634.066) * [-2635.711] (-2637.371) (-2635.778) (-2635.347) -- 0:01:09 609000 -- (-2638.270) (-2633.426) (-2636.745) [-2637.310] * (-2641.949) [-2639.144] (-2640.124) (-2635.711) -- 0:01:09 609500 -- (-2633.444) (-2634.806) [-2635.614] (-2634.223) * (-2637.030) (-2631.673) [-2636.352] (-2634.715) -- 0:01:09 610000 -- [-2634.708] (-2638.085) (-2635.904) (-2637.308) * (-2640.448) [-2630.660] (-2645.677) (-2637.503) -- 0:01:09 Average standard deviation of split frequencies: 0.000000 610500 -- (-2638.522) (-2635.199) (-2641.754) [-2639.805] * (-2637.986) [-2629.840] (-2644.708) (-2637.297) -- 0:01:09 611000 -- [-2635.423] (-2634.973) (-2640.588) (-2636.140) * (-2644.357) (-2634.529) (-2642.124) [-2635.041] -- 0:01:09 611500 -- [-2632.165] (-2637.061) (-2632.298) (-2636.976) * (-2638.718) [-2637.006] (-2637.807) (-2636.314) -- 0:01:09 612000 -- (-2637.201) (-2635.352) [-2633.313] (-2637.527) * (-2640.674) [-2635.663] (-2633.738) (-2639.424) -- 0:01:09 612500 -- (-2632.257) (-2636.281) [-2634.794] (-2636.576) * [-2634.582] (-2635.072) (-2632.772) (-2642.956) -- 0:01:08 613000 -- (-2635.234) (-2638.071) [-2629.328] (-2638.335) * (-2634.980) [-2636.172] (-2633.577) (-2640.715) -- 0:01:08 613500 -- (-2634.114) (-2634.314) (-2631.195) [-2636.262] * (-2635.763) (-2632.878) [-2631.917] (-2638.117) -- 0:01:08 614000 -- (-2635.738) (-2639.020) [-2631.961] (-2632.439) * (-2634.833) (-2638.710) (-2636.613) [-2632.593] -- 0:01:08 614500 -- (-2632.919) (-2633.267) [-2633.939] (-2635.794) * (-2640.081) [-2629.476] (-2634.721) (-2638.797) -- 0:01:08 615000 -- (-2639.252) (-2637.002) [-2634.510] (-2638.896) * (-2644.683) [-2636.399] (-2638.057) (-2631.953) -- 0:01:08 Average standard deviation of split frequencies: 0.000000 615500 -- (-2635.419) (-2636.709) [-2635.823] (-2636.195) * (-2636.244) (-2632.128) (-2642.744) [-2636.617] -- 0:01:08 616000 -- (-2634.890) [-2632.632] (-2638.705) (-2638.484) * (-2641.338) (-2648.032) (-2639.224) [-2638.360] -- 0:01:07 616500 -- (-2635.604) (-2636.198) (-2646.826) [-2633.804] * (-2634.452) (-2637.163) [-2640.316] (-2635.239) -- 0:01:08 617000 -- (-2633.615) (-2636.054) (-2635.139) [-2633.272] * [-2640.402] (-2631.895) (-2637.113) (-2635.190) -- 0:01:08 617500 -- (-2640.107) [-2639.876] (-2642.393) (-2638.075) * (-2635.827) (-2633.644) [-2634.954] (-2640.218) -- 0:01:08 618000 -- [-2634.236] (-2639.308) (-2638.426) (-2633.954) * (-2641.413) [-2633.942] (-2632.142) (-2636.851) -- 0:01:07 618500 -- [-2638.778] (-2637.556) (-2633.177) (-2641.791) * (-2636.405) (-2634.961) [-2631.378] (-2636.515) -- 0:01:07 619000 -- (-2637.167) (-2637.867) [-2633.492] (-2635.028) * [-2629.986] (-2642.517) (-2631.953) (-2630.587) -- 0:01:07 619500 -- (-2635.868) (-2640.136) [-2631.552] (-2634.505) * (-2635.985) [-2636.939] (-2639.026) (-2632.943) -- 0:01:07 620000 -- [-2633.147] (-2643.454) (-2636.058) (-2641.547) * [-2638.829] (-2633.880) (-2638.208) (-2643.171) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 620500 -- (-2635.841) (-2641.713) [-2632.134] (-2639.868) * (-2633.745) [-2634.739] (-2630.832) (-2638.936) -- 0:01:07 621000 -- [-2632.448] (-2634.230) (-2637.887) (-2633.008) * (-2630.186) (-2633.193) (-2635.485) [-2642.834] -- 0:01:07 621500 -- (-2636.191) (-2636.436) [-2639.985] (-2635.246) * (-2632.653) (-2634.158) [-2637.988] (-2632.288) -- 0:01:06 622000 -- (-2634.377) [-2631.699] (-2633.997) (-2634.830) * (-2640.572) [-2636.928] (-2633.011) (-2633.447) -- 0:01:07 622500 -- [-2633.886] (-2633.482) (-2633.240) (-2632.043) * (-2632.003) (-2637.746) [-2639.731] (-2636.457) -- 0:01:07 623000 -- [-2636.755] (-2639.742) (-2632.130) (-2633.896) * (-2634.108) (-2633.259) [-2635.148] (-2635.807) -- 0:01:07 623500 -- (-2632.537) (-2631.444) (-2631.755) [-2639.411] * (-2635.011) [-2635.117] (-2634.818) (-2644.426) -- 0:01:07 624000 -- (-2639.257) (-2636.838) [-2637.400] (-2639.663) * (-2636.787) (-2635.815) (-2635.519) [-2638.118] -- 0:01:06 624500 -- [-2637.772] (-2635.798) (-2647.243) (-2634.660) * (-2633.021) [-2636.810] (-2634.095) (-2634.504) -- 0:01:06 625000 -- [-2643.738] (-2630.663) (-2641.304) (-2637.101) * [-2630.564] (-2633.760) (-2635.806) (-2643.891) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 625500 -- (-2639.546) [-2641.900] (-2641.086) (-2632.562) * (-2631.865) [-2638.361] (-2635.583) (-2638.436) -- 0:01:06 626000 -- (-2638.625) [-2640.239] (-2640.504) (-2632.221) * (-2633.358) (-2637.142) [-2633.258] (-2631.829) -- 0:01:06 626500 -- (-2633.491) [-2637.462] (-2637.636) (-2632.861) * (-2633.204) (-2635.358) [-2633.954] (-2641.292) -- 0:01:06 627000 -- [-2631.330] (-2633.383) (-2644.679) (-2640.779) * (-2634.928) (-2634.005) (-2642.514) [-2635.783] -- 0:01:06 627500 -- (-2635.900) (-2636.215) [-2642.974] (-2636.849) * [-2634.137] (-2645.122) (-2637.876) (-2631.660) -- 0:01:06 628000 -- (-2638.018) [-2631.869] (-2648.616) (-2631.945) * (-2637.753) (-2634.188) (-2635.871) [-2636.709] -- 0:01:06 628500 -- (-2635.890) (-2635.012) (-2638.889) [-2645.671] * [-2634.677] (-2633.224) (-2635.725) (-2639.359) -- 0:01:06 629000 -- (-2634.544) [-2632.491] (-2640.326) (-2638.861) * [-2637.306] (-2638.443) (-2639.584) (-2635.905) -- 0:01:06 629500 -- (-2632.889) (-2633.698) [-2633.003] (-2639.533) * (-2635.215) (-2635.410) (-2637.298) [-2638.294] -- 0:01:05 630000 -- [-2636.724] (-2638.706) (-2639.609) (-2636.768) * (-2637.307) (-2641.499) (-2638.644) [-2639.275] -- 0:01:05 Average standard deviation of split frequencies: 0.000000 630500 -- [-2638.348] (-2637.285) (-2634.172) (-2641.267) * (-2638.672) (-2642.129) (-2634.426) [-2636.093] -- 0:01:05 631000 -- [-2631.683] (-2649.113) (-2634.213) (-2645.028) * [-2641.489] (-2639.095) (-2632.657) (-2629.960) -- 0:01:05 631500 -- (-2633.797) (-2637.298) (-2640.318) [-2635.918] * (-2636.797) (-2634.920) [-2633.694] (-2637.760) -- 0:01:05 632000 -- [-2635.120] (-2636.286) (-2635.536) (-2643.767) * (-2635.525) [-2632.171] (-2635.329) (-2639.484) -- 0:01:05 632500 -- (-2636.678) [-2633.906] (-2635.150) (-2632.021) * (-2637.068) [-2637.586] (-2639.284) (-2633.806) -- 0:01:05 633000 -- (-2638.206) [-2635.585] (-2634.645) (-2639.259) * (-2639.481) [-2635.126] (-2636.007) (-2631.606) -- 0:01:04 633500 -- (-2634.149) [-2638.136] (-2639.868) (-2636.588) * [-2641.119] (-2636.300) (-2634.141) (-2636.300) -- 0:01:05 634000 -- (-2635.809) (-2633.212) [-2635.416] (-2634.418) * (-2634.346) [-2636.840] (-2634.567) (-2637.556) -- 0:01:05 634500 -- [-2638.089] (-2635.461) (-2635.020) (-2636.215) * (-2635.719) (-2635.947) [-2639.145] (-2634.724) -- 0:01:05 635000 -- (-2639.001) [-2632.548] (-2636.880) (-2634.768) * (-2634.583) [-2636.236] (-2635.338) (-2639.388) -- 0:01:04 Average standard deviation of split frequencies: 0.000000 635500 -- [-2637.675] (-2633.843) (-2633.287) (-2633.978) * (-2636.978) (-2636.560) [-2632.196] (-2642.327) -- 0:01:04 636000 -- (-2642.315) (-2633.828) [-2638.159] (-2637.417) * (-2636.465) (-2634.432) [-2633.969] (-2641.634) -- 0:01:04 636500 -- [-2637.865] (-2633.207) (-2633.631) (-2641.006) * (-2632.854) [-2633.713] (-2637.580) (-2637.023) -- 0:01:04 637000 -- (-2644.006) [-2639.825] (-2638.296) (-2634.758) * [-2637.524] (-2637.284) (-2633.969) (-2638.817) -- 0:01:04 637500 -- (-2638.617) [-2633.420] (-2641.999) (-2632.361) * [-2634.754] (-2632.244) (-2637.606) (-2644.007) -- 0:01:04 638000 -- [-2635.711] (-2637.564) (-2645.070) (-2638.818) * [-2633.625] (-2639.027) (-2633.628) (-2631.883) -- 0:01:04 638500 -- (-2637.748) (-2637.239) (-2634.368) [-2635.019] * (-2636.093) [-2637.560] (-2638.960) (-2639.792) -- 0:01:03 639000 -- (-2632.809) (-2640.507) [-2633.720] (-2639.622) * (-2635.151) (-2635.879) [-2635.281] (-2636.742) -- 0:01:04 639500 -- (-2635.956) (-2633.881) [-2634.739] (-2634.534) * (-2635.966) (-2636.597) [-2635.739] (-2632.150) -- 0:01:04 640000 -- (-2634.471) (-2640.202) (-2637.668) [-2633.092] * [-2633.410] (-2636.960) (-2644.369) (-2636.047) -- 0:01:04 Average standard deviation of split frequencies: 0.000000 640500 -- (-2634.876) (-2640.643) (-2635.817) [-2628.826] * [-2634.666] (-2643.530) (-2645.167) (-2641.646) -- 0:01:03 641000 -- (-2638.263) (-2640.221) (-2634.860) [-2629.671] * (-2635.616) [-2638.540] (-2638.790) (-2635.003) -- 0:01:03 641500 -- (-2637.804) (-2635.867) [-2641.557] (-2631.313) * [-2640.323] (-2634.459) (-2641.081) (-2636.899) -- 0:01:03 642000 -- (-2640.591) [-2643.901] (-2632.407) (-2635.334) * [-2632.650] (-2633.078) (-2636.038) (-2633.615) -- 0:01:03 642500 -- (-2633.682) (-2641.500) (-2638.947) [-2630.486] * (-2633.061) (-2634.017) (-2641.759) [-2632.170] -- 0:01:03 643000 -- (-2634.853) (-2635.836) (-2636.829) [-2633.087] * (-2633.442) (-2636.857) [-2636.133] (-2640.867) -- 0:01:03 643500 -- [-2631.756] (-2647.127) (-2632.709) (-2637.443) * [-2635.840] (-2635.150) (-2635.570) (-2643.101) -- 0:01:03 644000 -- (-2636.286) (-2638.515) [-2630.831] (-2638.473) * [-2633.874] (-2635.564) (-2635.870) (-2637.583) -- 0:01:03 644500 -- (-2635.045) [-2635.303] (-2635.025) (-2639.506) * (-2636.482) [-2637.434] (-2635.887) (-2638.220) -- 0:01:03 645000 -- (-2634.558) [-2630.728] (-2633.613) (-2635.362) * [-2636.149] (-2634.729) (-2634.924) (-2644.254) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 645500 -- (-2638.745) (-2635.289) (-2636.457) [-2640.669] * (-2637.340) (-2636.459) (-2630.670) [-2637.512] -- 0:01:03 646000 -- (-2633.369) (-2631.563) (-2629.932) [-2634.167] * [-2639.801] (-2637.605) (-2638.467) (-2635.742) -- 0:01:03 646500 -- (-2636.426) (-2632.256) (-2639.826) [-2639.729] * (-2638.551) [-2635.467] (-2633.999) (-2635.296) -- 0:01:02 647000 -- (-2633.444) (-2635.470) (-2636.974) [-2639.858] * (-2636.120) (-2638.251) [-2633.009] (-2635.545) -- 0:01:02 647500 -- [-2634.900] (-2631.844) (-2640.802) (-2634.287) * (-2634.481) (-2633.967) [-2633.959] (-2635.013) -- 0:01:02 648000 -- (-2635.584) (-2637.300) [-2638.547] (-2632.082) * (-2634.881) [-2634.677] (-2636.163) (-2637.387) -- 0:01:02 648500 -- (-2639.779) [-2629.742] (-2632.563) (-2635.890) * (-2632.579) (-2639.528) [-2631.669] (-2632.651) -- 0:01:02 649000 -- (-2639.296) [-2630.687] (-2638.133) (-2649.603) * (-2632.155) (-2640.798) (-2639.052) [-2632.647] -- 0:01:02 649500 -- (-2636.159) [-2631.973] (-2630.599) (-2643.391) * (-2635.898) (-2642.335) [-2635.577] (-2633.715) -- 0:01:02 650000 -- (-2636.058) (-2637.911) (-2638.664) [-2637.792] * (-2634.520) (-2641.853) [-2631.843] (-2635.714) -- 0:01:01 Average standard deviation of split frequencies: 0.000000 650500 -- [-2637.884] (-2633.958) (-2632.754) (-2640.774) * (-2638.651) [-2639.014] (-2640.029) (-2636.874) -- 0:01:02 651000 -- (-2637.606) (-2633.355) [-2635.120] (-2638.177) * (-2634.171) (-2633.390) [-2635.970] (-2638.025) -- 0:01:02 651500 -- [-2634.471] (-2634.553) (-2636.812) (-2641.068) * [-2632.289] (-2638.120) (-2633.239) (-2641.564) -- 0:01:02 652000 -- [-2635.520] (-2636.836) (-2632.933) (-2636.626) * [-2635.962] (-2638.486) (-2631.506) (-2642.650) -- 0:01:01 652500 -- [-2633.690] (-2632.996) (-2630.152) (-2640.380) * (-2635.503) [-2637.326] (-2631.835) (-2647.161) -- 0:01:01 653000 -- [-2633.084] (-2638.197) (-2637.665) (-2633.211) * [-2633.372] (-2637.651) (-2634.908) (-2638.114) -- 0:01:01 653500 -- (-2634.995) (-2634.086) (-2635.855) [-2634.476] * [-2634.413] (-2640.449) (-2637.675) (-2635.861) -- 0:01:01 654000 -- (-2640.565) (-2639.273) [-2633.892] (-2637.654) * (-2638.694) [-2638.347] (-2640.291) (-2648.691) -- 0:01:01 654500 -- [-2637.547] (-2644.976) (-2633.266) (-2634.250) * (-2642.219) [-2639.452] (-2635.920) (-2635.904) -- 0:01:01 655000 -- (-2642.301) (-2636.472) (-2630.281) [-2634.664] * [-2634.316] (-2639.717) (-2636.875) (-2637.863) -- 0:01:01 Average standard deviation of split frequencies: 0.000000 655500 -- (-2640.151) (-2635.337) [-2632.600] (-2636.591) * (-2636.163) (-2640.120) (-2638.731) [-2636.687] -- 0:01:00 656000 -- (-2636.308) [-2636.564] (-2635.239) (-2637.428) * [-2640.132] (-2636.296) (-2639.734) (-2641.255) -- 0:01:01 656500 -- (-2638.373) (-2634.041) [-2630.476] (-2634.161) * (-2636.107) [-2638.965] (-2636.667) (-2636.149) -- 0:01:01 657000 -- (-2631.957) (-2635.280) (-2636.006) [-2635.254] * [-2640.631] (-2632.321) (-2636.839) (-2633.677) -- 0:01:01 657500 -- (-2637.859) [-2635.478] (-2637.480) (-2635.029) * (-2631.443) (-2639.580) (-2633.081) [-2640.804] -- 0:01:00 658000 -- (-2636.008) (-2632.008) [-2632.805] (-2641.682) * (-2640.414) (-2641.940) (-2636.000) [-2634.993] -- 0:01:00 658500 -- (-2633.781) (-2633.823) (-2633.535) [-2636.269] * (-2633.476) [-2632.448] (-2635.184) (-2632.965) -- 0:01:00 659000 -- (-2637.133) [-2633.792] (-2635.409) (-2635.263) * [-2639.765] (-2640.220) (-2636.692) (-2632.730) -- 0:01:00 659500 -- [-2636.311] (-2636.370) (-2638.948) (-2640.815) * (-2634.201) [-2633.703] (-2633.617) (-2635.573) -- 0:01:00 660000 -- (-2639.033) [-2636.266] (-2633.506) (-2633.651) * (-2638.947) [-2635.948] (-2637.175) (-2636.577) -- 0:01:00 Average standard deviation of split frequencies: 0.000000 660500 -- (-2637.056) (-2634.637) [-2633.120] (-2641.630) * (-2632.987) [-2630.683] (-2630.901) (-2636.917) -- 0:01:00 661000 -- (-2638.668) [-2635.108] (-2634.367) (-2638.320) * (-2634.168) [-2633.727] (-2630.858) (-2642.975) -- 0:01:00 661500 -- (-2636.250) [-2635.930] (-2639.950) (-2649.897) * [-2635.812] (-2633.400) (-2632.374) (-2638.505) -- 0:01:00 662000 -- (-2638.682) [-2641.535] (-2637.571) (-2648.028) * [-2636.216] (-2632.714) (-2634.624) (-2634.208) -- 0:01:00 662500 -- [-2637.422] (-2638.184) (-2635.681) (-2635.862) * (-2634.727) (-2644.048) [-2633.223] (-2632.513) -- 0:01:00 663000 -- (-2638.706) (-2637.350) (-2643.841) [-2637.015] * (-2635.077) (-2634.930) [-2631.877] (-2638.220) -- 0:00:59 663500 -- [-2634.396] (-2639.957) (-2638.362) (-2635.917) * (-2632.717) [-2631.492] (-2638.621) (-2637.932) -- 0:00:59 664000 -- (-2640.271) [-2637.492] (-2636.086) (-2632.352) * (-2636.387) [-2635.022] (-2634.451) (-2636.221) -- 0:00:59 664500 -- (-2638.785) (-2638.809) [-2638.047] (-2634.065) * [-2637.169] (-2634.715) (-2633.369) (-2648.449) -- 0:00:59 665000 -- (-2631.986) (-2638.875) [-2637.187] (-2640.719) * [-2638.127] (-2637.325) (-2636.048) (-2638.582) -- 0:00:59 Average standard deviation of split frequencies: 0.000000 665500 -- (-2638.329) [-2632.690] (-2635.175) (-2635.406) * [-2632.000] (-2639.755) (-2637.308) (-2638.457) -- 0:00:59 666000 -- (-2641.762) [-2632.016] (-2636.810) (-2634.954) * [-2635.295] (-2632.464) (-2640.052) (-2635.034) -- 0:00:59 666500 -- (-2636.500) [-2631.766] (-2635.939) (-2634.337) * (-2635.562) (-2631.823) (-2634.466) [-2637.254] -- 0:00:59 667000 -- [-2638.901] (-2632.984) (-2637.529) (-2632.125) * [-2635.060] (-2636.430) (-2633.706) (-2634.336) -- 0:00:58 667500 -- (-2635.001) (-2638.020) [-2633.090] (-2635.323) * (-2636.040) (-2642.616) (-2635.798) [-2638.603] -- 0:00:59 668000 -- [-2631.021] (-2642.225) (-2634.365) (-2642.199) * (-2633.813) (-2631.601) [-2638.238] (-2639.943) -- 0:00:59 668500 -- [-2632.883] (-2640.917) (-2634.817) (-2649.779) * (-2630.009) [-2634.769] (-2639.011) (-2641.746) -- 0:00:59 669000 -- (-2633.443) (-2635.291) (-2635.957) [-2632.997] * (-2640.985) [-2639.192] (-2634.348) (-2638.789) -- 0:00:58 669500 -- (-2635.295) (-2635.884) (-2636.869) [-2638.164] * (-2636.725) (-2638.433) [-2633.736] (-2642.918) -- 0:00:58 670000 -- (-2636.398) (-2637.972) [-2633.629] (-2635.320) * (-2649.568) (-2634.845) [-2634.583] (-2635.546) -- 0:00:58 Average standard deviation of split frequencies: 0.000000 670500 -- [-2636.047] (-2635.701) (-2638.805) (-2637.774) * [-2639.552] (-2640.177) (-2642.808) (-2633.235) -- 0:00:58 671000 -- (-2631.814) (-2632.411) [-2638.691] (-2634.171) * (-2634.432) (-2636.475) [-2638.567] (-2638.664) -- 0:00:58 671500 -- (-2637.072) [-2631.936] (-2638.270) (-2632.951) * (-2635.724) (-2635.895) (-2636.088) [-2640.440] -- 0:00:58 672000 -- [-2634.970] (-2635.555) (-2640.616) (-2634.106) * (-2631.906) (-2634.062) [-2631.160] (-2634.801) -- 0:00:58 672500 -- [-2640.332] (-2639.438) (-2645.902) (-2633.535) * [-2630.461] (-2635.920) (-2634.254) (-2644.598) -- 0:00:57 673000 -- (-2639.212) (-2638.462) (-2638.809) [-2634.903] * [-2634.190] (-2641.321) (-2636.102) (-2645.704) -- 0:00:58 673500 -- (-2636.665) (-2633.671) (-2632.406) [-2635.661] * (-2636.279) (-2640.772) [-2631.086] (-2641.234) -- 0:00:58 674000 -- (-2641.356) [-2632.193] (-2633.276) (-2640.780) * (-2637.442) (-2633.861) (-2629.925) [-2630.957] -- 0:00:58 674500 -- (-2638.434) [-2636.496] (-2632.436) (-2632.240) * (-2637.243) (-2634.691) [-2630.750] (-2638.439) -- 0:00:57 675000 -- (-2643.683) [-2632.833] (-2636.094) (-2636.538) * (-2640.486) [-2632.399] (-2636.015) (-2636.807) -- 0:00:57 Average standard deviation of split frequencies: 0.000000 675500 -- (-2634.471) (-2636.291) [-2636.079] (-2636.702) * [-2631.871] (-2631.733) (-2638.626) (-2637.491) -- 0:00:57 676000 -- (-2636.325) [-2632.846] (-2636.513) (-2634.459) * (-2634.471) (-2631.867) [-2636.533] (-2648.519) -- 0:00:57 676500 -- [-2634.512] (-2647.250) (-2636.047) (-2638.096) * (-2633.269) [-2634.668] (-2643.862) (-2637.829) -- 0:00:57 677000 -- (-2634.716) (-2631.790) (-2634.566) [-2636.885] * (-2634.314) (-2640.328) [-2642.428] (-2632.793) -- 0:00:57 677500 -- (-2634.287) (-2639.126) [-2633.990] (-2632.365) * (-2636.322) (-2641.372) (-2637.037) [-2633.445] -- 0:00:57 678000 -- (-2635.700) (-2637.168) [-2639.632] (-2635.817) * (-2633.842) (-2642.483) (-2637.268) [-2636.212] -- 0:00:56 678500 -- (-2639.756) [-2638.194] (-2637.284) (-2632.513) * [-2634.210] (-2635.843) (-2643.996) (-2634.146) -- 0:00:57 679000 -- [-2633.184] (-2633.077) (-2634.549) (-2634.195) * (-2633.477) (-2635.722) (-2646.255) [-2636.637] -- 0:00:57 679500 -- (-2637.226) [-2634.151] (-2637.133) (-2631.807) * (-2639.234) (-2633.299) (-2632.920) [-2639.196] -- 0:00:57 680000 -- (-2646.870) (-2637.089) (-2635.343) [-2634.343] * [-2638.107] (-2638.348) (-2643.365) (-2635.550) -- 0:00:56 Average standard deviation of split frequencies: 0.000000 680500 -- (-2641.164) (-2643.770) (-2635.304) [-2632.021] * (-2633.270) (-2634.388) (-2641.382) [-2633.633] -- 0:00:56 681000 -- (-2640.245) (-2638.703) (-2631.034) [-2635.666] * (-2632.405) [-2636.099] (-2634.589) (-2641.632) -- 0:00:56 681500 -- (-2641.032) (-2646.465) [-2635.224] (-2636.559) * (-2633.740) [-2632.524] (-2637.721) (-2638.900) -- 0:00:56 682000 -- (-2637.681) (-2637.044) (-2636.039) [-2637.758] * [-2634.100] (-2635.570) (-2634.943) (-2646.250) -- 0:00:56 682500 -- [-2634.953] (-2632.277) (-2637.765) (-2637.395) * (-2637.577) [-2636.258] (-2638.931) (-2636.538) -- 0:00:56 683000 -- (-2635.519) (-2632.307) [-2635.226] (-2638.987) * (-2637.454) (-2639.266) [-2639.701] (-2633.059) -- 0:00:56 683500 -- [-2629.564] (-2637.602) (-2634.428) (-2638.536) * (-2634.658) [-2634.906] (-2639.188) (-2636.754) -- 0:00:56 684000 -- (-2633.876) (-2636.846) (-2639.574) [-2638.749] * [-2637.508] (-2645.263) (-2637.019) (-2633.621) -- 0:00:55 684500 -- (-2633.474) [-2633.324] (-2639.425) (-2633.291) * (-2639.734) [-2636.250] (-2634.581) (-2637.900) -- 0:00:56 685000 -- (-2640.295) [-2636.023] (-2645.092) (-2633.951) * (-2633.155) [-2630.585] (-2641.804) (-2639.548) -- 0:00:56 Average standard deviation of split frequencies: 0.000000 685500 -- [-2637.766] (-2639.070) (-2632.768) (-2635.036) * [-2636.192] (-2639.561) (-2635.692) (-2631.415) -- 0:00:55 686000 -- [-2632.011] (-2631.680) (-2635.762) (-2640.256) * [-2639.292] (-2641.156) (-2638.012) (-2631.431) -- 0:00:55 686500 -- (-2637.070) (-2640.295) [-2634.010] (-2634.331) * (-2637.379) [-2636.847] (-2633.111) (-2635.911) -- 0:00:55 687000 -- (-2634.652) (-2632.140) [-2637.212] (-2634.029) * (-2636.091) (-2638.099) [-2636.000] (-2636.458) -- 0:00:55 687500 -- (-2637.042) (-2635.227) (-2632.239) [-2635.626] * (-2632.727) (-2634.853) [-2633.497] (-2639.016) -- 0:00:55 688000 -- (-2631.881) (-2642.257) [-2632.748] (-2632.053) * [-2633.752] (-2635.089) (-2636.231) (-2636.348) -- 0:00:55 688500 -- (-2634.089) (-2634.044) (-2633.838) [-2634.599] * (-2637.058) [-2633.350] (-2632.634) (-2642.260) -- 0:00:55 689000 -- (-2632.426) (-2635.153) (-2633.048) [-2635.149] * (-2636.792) [-2633.492] (-2640.769) (-2638.905) -- 0:00:55 689500 -- [-2633.628] (-2637.140) (-2635.898) (-2642.248) * (-2637.418) (-2632.987) (-2639.519) [-2636.712] -- 0:00:54 690000 -- (-2635.552) [-2638.222] (-2645.386) (-2633.105) * [-2640.845] (-2637.819) (-2638.246) (-2635.250) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 690500 -- [-2633.585] (-2635.485) (-2633.594) (-2635.316) * (-2636.635) (-2633.715) (-2637.033) [-2631.102] -- 0:00:55 691000 -- (-2640.458) (-2638.812) (-2635.164) [-2630.778] * (-2634.557) [-2631.998] (-2637.097) (-2635.481) -- 0:00:55 691500 -- (-2638.838) (-2638.504) (-2632.750) [-2635.395] * (-2639.007) (-2640.516) (-2634.162) [-2637.947] -- 0:00:54 692000 -- (-2638.588) (-2636.390) [-2633.303] (-2636.010) * (-2634.340) (-2640.815) [-2638.958] (-2642.036) -- 0:00:54 692500 -- (-2634.216) (-2633.012) (-2639.316) [-2637.612] * (-2633.295) (-2634.693) [-2635.712] (-2639.422) -- 0:00:54 693000 -- (-2630.185) (-2633.541) [-2635.220] (-2639.356) * (-2640.262) (-2636.561) (-2633.688) [-2634.720] -- 0:00:54 693500 -- (-2636.658) [-2634.636] (-2642.262) (-2634.814) * (-2639.050) (-2640.310) (-2639.891) [-2636.435] -- 0:00:54 694000 -- [-2636.109] (-2634.888) (-2638.278) (-2640.107) * (-2640.737) [-2635.491] (-2637.065) (-2634.666) -- 0:00:54 694500 -- (-2636.938) (-2634.808) [-2639.197] (-2640.216) * (-2639.730) (-2631.701) (-2632.240) [-2633.465] -- 0:00:54 695000 -- [-2636.332] (-2639.553) (-2639.104) (-2639.467) * (-2632.915) (-2634.019) [-2632.339] (-2639.450) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 695500 -- (-2637.736) (-2634.953) [-2636.499] (-2634.306) * (-2638.316) (-2634.800) (-2634.691) [-2635.725] -- 0:00:54 696000 -- [-2640.994] (-2638.173) (-2637.299) (-2635.828) * [-2643.605] (-2640.764) (-2638.447) (-2638.684) -- 0:00:54 696500 -- (-2634.941) (-2638.340) (-2637.497) [-2634.737] * (-2642.239) [-2631.831] (-2642.755) (-2639.926) -- 0:00:54 697000 -- (-2638.775) (-2635.648) [-2634.384] (-2642.519) * [-2639.166] (-2632.639) (-2634.205) (-2633.221) -- 0:00:53 697500 -- (-2637.253) [-2632.308] (-2634.268) (-2651.957) * [-2641.955] (-2636.872) (-2635.120) (-2636.644) -- 0:00:53 698000 -- (-2638.723) (-2634.252) (-2632.986) [-2637.567] * (-2643.928) (-2637.050) [-2634.791] (-2638.397) -- 0:00:53 698500 -- (-2632.409) [-2632.840] (-2637.711) (-2633.052) * [-2635.249] (-2640.174) (-2630.892) (-2635.239) -- 0:00:53 699000 -- (-2631.162) (-2637.523) [-2638.890] (-2638.042) * [-2639.789] (-2632.428) (-2633.361) (-2634.016) -- 0:00:53 699500 -- (-2634.581) (-2641.410) [-2630.884] (-2635.794) * (-2640.029) (-2638.133) (-2633.077) [-2636.033] -- 0:00:53 700000 -- (-2640.491) (-2633.768) (-2631.306) [-2638.473] * [-2636.820] (-2639.313) (-2638.510) (-2634.990) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 700500 -- [-2638.847] (-2634.681) (-2635.853) (-2639.184) * (-2634.462) (-2640.308) [-2634.157] (-2638.835) -- 0:00:53 701000 -- (-2636.440) (-2640.309) [-2639.230] (-2641.847) * (-2635.739) (-2633.687) (-2638.974) [-2633.155] -- 0:00:52 701500 -- [-2634.530] (-2633.830) (-2647.670) (-2638.469) * [-2631.825] (-2642.933) (-2636.247) (-2632.596) -- 0:00:53 702000 -- (-2637.439) (-2642.205) [-2636.513] (-2637.476) * (-2646.256) (-2637.352) [-2633.398] (-2632.939) -- 0:00:53 702500 -- (-2637.701) [-2639.931] (-2631.640) (-2636.195) * (-2638.002) [-2632.783] (-2631.256) (-2639.384) -- 0:00:52 703000 -- (-2634.563) [-2637.125] (-2644.922) (-2635.394) * (-2634.842) [-2630.590] (-2635.948) (-2636.895) -- 0:00:52 703500 -- [-2636.385] (-2637.761) (-2633.563) (-2631.844) * (-2642.738) [-2635.922] (-2638.038) (-2633.380) -- 0:00:52 704000 -- (-2635.732) (-2636.676) [-2632.876] (-2637.871) * [-2641.325] (-2636.873) (-2635.778) (-2630.176) -- 0:00:52 704500 -- (-2636.522) (-2638.264) [-2632.874] (-2632.111) * (-2640.439) [-2640.398] (-2638.254) (-2632.648) -- 0:00:52 705000 -- (-2636.524) (-2634.237) [-2632.857] (-2637.641) * (-2636.212) (-2634.612) (-2634.601) [-2632.658] -- 0:00:52 Average standard deviation of split frequencies: 0.000000 705500 -- (-2636.860) [-2636.993] (-2633.434) (-2638.817) * (-2632.311) (-2637.491) (-2638.875) [-2636.860] -- 0:00:52 706000 -- (-2634.446) (-2636.877) (-2634.570) [-2634.363] * (-2633.612) [-2640.798] (-2634.724) (-2632.337) -- 0:00:52 706500 -- (-2637.208) (-2636.208) (-2640.319) [-2633.033] * (-2637.376) (-2633.576) [-2633.131] (-2634.520) -- 0:00:51 707000 -- (-2631.907) (-2640.733) (-2635.053) [-2637.582] * [-2636.017] (-2634.855) (-2645.241) (-2633.921) -- 0:00:52 707500 -- (-2635.890) (-2636.277) [-2642.409] (-2638.833) * (-2637.270) [-2632.132] (-2636.761) (-2636.010) -- 0:00:52 708000 -- (-2632.894) [-2634.258] (-2641.112) (-2641.750) * (-2636.311) [-2637.833] (-2631.720) (-2635.673) -- 0:00:51 708500 -- [-2634.919] (-2637.252) (-2637.108) (-2633.517) * (-2637.002) (-2636.222) [-2634.753] (-2638.814) -- 0:00:51 709000 -- (-2636.056) (-2634.231) (-2637.823) [-2647.615] * (-2641.000) (-2637.718) [-2643.056] (-2635.499) -- 0:00:51 709500 -- (-2637.802) (-2632.113) (-2639.041) [-2639.697] * (-2644.427) (-2642.271) (-2636.688) [-2635.944] -- 0:00:51 710000 -- (-2631.453) [-2638.362] (-2635.572) (-2633.040) * (-2644.374) (-2638.786) [-2635.280] (-2639.550) -- 0:00:51 Average standard deviation of split frequencies: 0.000000 710500 -- (-2641.799) (-2636.786) [-2632.363] (-2633.592) * (-2639.744) (-2643.115) [-2633.620] (-2633.721) -- 0:00:51 711000 -- (-2634.422) (-2634.560) (-2638.128) [-2634.394] * (-2637.395) [-2637.859] (-2630.788) (-2639.078) -- 0:00:51 711500 -- [-2636.795] (-2632.458) (-2634.304) (-2630.336) * (-2635.266) (-2636.910) (-2636.877) [-2639.141] -- 0:00:51 712000 -- (-2637.061) (-2635.558) [-2633.578] (-2638.321) * [-2632.624] (-2640.467) (-2638.421) (-2634.610) -- 0:00:50 712500 -- [-2635.937] (-2638.004) (-2642.816) (-2640.929) * [-2637.084] (-2639.733) (-2641.185) (-2640.767) -- 0:00:51 713000 -- (-2633.107) (-2643.633) (-2639.974) [-2631.297] * (-2630.318) (-2631.876) [-2640.301] (-2638.846) -- 0:00:51 713500 -- (-2637.157) (-2634.371) (-2640.915) [-2639.200] * (-2631.887) (-2638.661) [-2636.149] (-2634.299) -- 0:00:50 714000 -- (-2638.431) (-2634.386) (-2639.102) [-2636.209] * [-2641.092] (-2633.454) (-2635.997) (-2631.700) -- 0:00:50 714500 -- (-2638.101) (-2636.222) (-2633.447) [-2637.385] * (-2633.977) (-2636.530) [-2634.299] (-2635.111) -- 0:00:50 715000 -- [-2637.382] (-2631.356) (-2644.472) (-2632.318) * (-2642.160) (-2633.059) [-2632.925] (-2643.487) -- 0:00:50 Average standard deviation of split frequencies: 0.000000 715500 -- [-2636.309] (-2635.899) (-2637.226) (-2640.011) * (-2639.535) [-2631.523] (-2635.890) (-2640.017) -- 0:00:50 716000 -- (-2633.762) (-2642.607) (-2634.646) [-2638.264] * (-2633.741) (-2635.774) [-2639.773] (-2641.456) -- 0:00:50 716500 -- [-2639.079] (-2633.332) (-2636.293) (-2642.207) * (-2639.485) (-2640.586) (-2635.211) [-2635.858] -- 0:00:50 717000 -- [-2637.022] (-2636.919) (-2637.311) (-2635.040) * [-2632.506] (-2637.055) (-2635.440) (-2630.423) -- 0:00:50 717500 -- (-2635.458) (-2634.689) (-2632.509) [-2634.849] * (-2632.888) [-2632.517] (-2634.434) (-2636.085) -- 0:00:50 718000 -- (-2635.032) (-2633.078) (-2636.229) [-2633.036] * (-2636.150) (-2634.880) (-2634.612) [-2640.113] -- 0:00:49 718500 -- [-2633.464] (-2634.415) (-2638.349) (-2631.466) * (-2633.074) [-2635.632] (-2640.104) (-2636.731) -- 0:00:50 719000 -- (-2641.698) (-2638.494) (-2633.244) [-2634.870] * (-2635.013) (-2637.339) [-2637.875] (-2637.157) -- 0:00:50 719500 -- [-2634.106] (-2643.505) (-2636.753) (-2634.467) * [-2635.288] (-2639.776) (-2634.930) (-2637.050) -- 0:00:49 720000 -- (-2630.819) [-2635.606] (-2636.590) (-2638.975) * (-2637.232) (-2637.715) (-2629.586) [-2636.054] -- 0:00:49 Average standard deviation of split frequencies: 0.000000 720500 -- (-2634.085) [-2637.324] (-2634.928) (-2635.015) * [-2635.224] (-2632.714) (-2637.607) (-2635.108) -- 0:00:49 721000 -- (-2639.796) [-2632.733] (-2633.398) (-2636.171) * (-2637.160) (-2636.612) (-2633.594) [-2636.595] -- 0:00:49 721500 -- (-2635.216) (-2638.813) (-2633.061) [-2636.755] * (-2642.410) (-2638.120) [-2636.651] (-2638.080) -- 0:00:49 722000 -- (-2638.063) (-2638.748) [-2631.575] (-2637.642) * (-2636.590) (-2638.995) (-2631.238) [-2632.284] -- 0:00:49 722500 -- (-2639.334) (-2635.361) [-2631.746] (-2633.101) * (-2640.116) [-2636.643] (-2637.455) (-2635.832) -- 0:00:49 723000 -- [-2632.365] (-2638.822) (-2636.282) (-2642.435) * (-2640.302) (-2635.297) (-2631.724) [-2636.858] -- 0:00:49 723500 -- [-2638.941] (-2635.864) (-2633.784) (-2642.930) * (-2637.394) [-2634.860] (-2633.620) (-2639.946) -- 0:00:48 724000 -- (-2634.540) [-2636.635] (-2634.457) (-2650.393) * (-2640.719) (-2644.684) [-2635.953] (-2643.605) -- 0:00:49 724500 -- (-2631.680) [-2637.479] (-2636.843) (-2633.222) * (-2641.291) [-2640.745] (-2640.233) (-2637.374) -- 0:00:49 725000 -- [-2633.262] (-2639.815) (-2634.381) (-2636.537) * (-2634.325) (-2633.779) [-2631.774] (-2638.386) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 725500 -- (-2636.266) (-2636.589) (-2630.726) [-2633.590] * [-2635.762] (-2634.012) (-2640.350) (-2631.661) -- 0:00:48 726000 -- (-2637.298) [-2634.831] (-2634.428) (-2635.046) * [-2633.740] (-2634.914) (-2642.311) (-2633.626) -- 0:00:48 726500 -- (-2637.102) (-2634.044) (-2639.373) [-2634.449] * (-2637.275) (-2638.173) (-2636.985) [-2637.021] -- 0:00:48 727000 -- (-2635.594) (-2636.971) [-2637.033] (-2641.253) * [-2635.985] (-2630.736) (-2637.026) (-2637.684) -- 0:00:48 727500 -- [-2632.817] (-2632.027) (-2633.127) (-2634.858) * [-2641.125] (-2639.345) (-2634.248) (-2631.461) -- 0:00:48 728000 -- [-2637.748] (-2636.084) (-2635.049) (-2636.874) * (-2637.730) [-2635.863] (-2633.733) (-2631.988) -- 0:00:48 728500 -- [-2636.732] (-2637.343) (-2634.229) (-2640.284) * (-2634.365) (-2633.305) (-2632.526) [-2633.720] -- 0:00:48 729000 -- (-2642.507) (-2634.221) [-2630.777] (-2633.995) * (-2636.234) [-2634.037] (-2641.408) (-2637.467) -- 0:00:47 729500 -- (-2640.823) [-2636.835] (-2635.015) (-2632.375) * (-2635.096) (-2632.834) [-2633.233] (-2634.952) -- 0:00:47 730000 -- (-2638.526) [-2633.950] (-2638.717) (-2638.068) * [-2635.760] (-2641.822) (-2635.178) (-2634.691) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 730500 -- [-2636.166] (-2641.948) (-2637.999) (-2636.863) * (-2639.427) (-2638.234) [-2635.954] (-2635.088) -- 0:00:47 731000 -- (-2633.541) [-2637.093] (-2636.652) (-2637.959) * (-2633.438) (-2637.144) [-2636.133] (-2634.263) -- 0:00:47 731500 -- [-2634.807] (-2644.237) (-2637.132) (-2638.761) * [-2635.481] (-2642.871) (-2638.874) (-2633.768) -- 0:00:47 732000 -- [-2635.802] (-2641.797) (-2632.779) (-2644.357) * (-2637.679) (-2635.514) (-2641.444) [-2633.962] -- 0:00:47 732500 -- (-2638.031) [-2643.798] (-2634.888) (-2647.622) * [-2635.112] (-2638.649) (-2640.782) (-2640.842) -- 0:00:47 733000 -- (-2645.840) (-2639.273) [-2637.962] (-2647.890) * (-2633.317) (-2632.949) (-2632.809) [-2635.018] -- 0:00:47 733500 -- (-2638.367) [-2633.448] (-2638.465) (-2641.678) * [-2633.425] (-2640.531) (-2634.216) (-2633.480) -- 0:00:47 734000 -- (-2635.010) (-2636.538) [-2633.986] (-2637.989) * (-2633.175) [-2634.174] (-2635.809) (-2635.596) -- 0:00:47 734500 -- (-2635.641) (-2643.385) [-2634.365] (-2637.710) * (-2634.830) (-2631.334) [-2630.899] (-2637.306) -- 0:00:46 735000 -- (-2638.930) (-2639.727) [-2630.933] (-2633.392) * (-2636.022) (-2631.950) [-2631.608] (-2636.947) -- 0:00:46 Average standard deviation of split frequencies: 0.000000 735500 -- (-2636.113) [-2633.518] (-2633.309) (-2632.278) * (-2639.130) [-2629.973] (-2634.580) (-2636.141) -- 0:00:47 736000 -- (-2637.821) (-2634.439) (-2632.102) [-2631.370] * [-2638.790] (-2635.031) (-2636.288) (-2639.102) -- 0:00:46 736500 -- [-2638.982] (-2643.727) (-2638.733) (-2631.045) * (-2639.846) (-2638.416) (-2634.112) [-2638.349] -- 0:00:46 737000 -- [-2641.994] (-2640.987) (-2644.916) (-2635.192) * (-2638.635) [-2636.879] (-2636.977) (-2637.051) -- 0:00:46 737500 -- (-2639.652) [-2632.680] (-2637.235) (-2634.596) * (-2629.900) (-2636.336) [-2635.962] (-2638.958) -- 0:00:46 738000 -- (-2632.453) (-2634.762) (-2637.897) [-2631.624] * (-2641.653) [-2638.775] (-2635.500) (-2635.575) -- 0:00:46 738500 -- (-2635.652) (-2643.449) (-2640.986) [-2638.451] * (-2640.186) (-2634.003) [-2630.529] (-2639.614) -- 0:00:46 739000 -- (-2635.183) (-2643.938) (-2640.943) [-2635.980] * [-2634.068] (-2630.475) (-2635.371) (-2645.534) -- 0:00:46 739500 -- [-2629.331] (-2637.799) (-2636.620) (-2631.480) * (-2636.770) [-2637.439] (-2636.599) (-2641.836) -- 0:00:46 740000 -- (-2635.395) (-2646.732) [-2636.605] (-2636.447) * [-2635.451] (-2633.459) (-2630.887) (-2640.379) -- 0:00:46 Average standard deviation of split frequencies: 0.000000 740500 -- (-2633.875) (-2638.468) (-2637.208) [-2632.675] * (-2635.183) [-2631.597] (-2634.847) (-2640.056) -- 0:00:45 741000 -- (-2643.445) (-2644.513) (-2643.800) [-2636.097] * (-2638.228) (-2633.811) (-2637.852) [-2642.440] -- 0:00:46 741500 -- [-2636.604] (-2637.847) (-2637.476) (-2635.633) * (-2646.032) (-2639.965) (-2639.550) [-2633.223] -- 0:00:46 742000 -- (-2639.403) (-2634.893) [-2633.616] (-2640.161) * (-2634.441) [-2631.590] (-2639.140) (-2638.195) -- 0:00:45 742500 -- (-2636.755) (-2638.767) [-2635.898] (-2636.400) * (-2633.322) (-2635.261) [-2634.120] (-2639.081) -- 0:00:45 743000 -- (-2640.007) (-2632.856) (-2639.125) [-2634.790] * (-2639.245) [-2644.502] (-2632.680) (-2632.361) -- 0:00:45 743500 -- (-2635.302) (-2636.130) (-2639.111) [-2633.268] * (-2635.975) [-2641.652] (-2637.767) (-2634.633) -- 0:00:45 744000 -- [-2637.856] (-2634.847) (-2636.470) (-2634.927) * [-2642.188] (-2634.837) (-2638.578) (-2636.460) -- 0:00:45 744500 -- [-2633.574] (-2633.063) (-2639.280) (-2633.046) * (-2638.690) (-2637.883) (-2634.552) [-2632.321] -- 0:00:45 745000 -- (-2632.132) (-2636.981) [-2630.969] (-2630.772) * (-2637.399) (-2636.128) [-2637.488] (-2634.215) -- 0:00:45 Average standard deviation of split frequencies: 0.000000 745500 -- (-2638.429) [-2633.648] (-2641.839) (-2630.690) * (-2637.327) (-2641.870) [-2635.061] (-2631.727) -- 0:00:45 746000 -- (-2632.067) (-2632.776) (-2636.701) [-2637.666] * (-2639.949) [-2637.786] (-2635.922) (-2636.562) -- 0:00:44 746500 -- (-2632.833) (-2635.672) [-2634.751] (-2639.977) * (-2631.018) (-2638.251) (-2636.963) [-2636.929] -- 0:00:44 747000 -- [-2642.294] (-2635.133) (-2634.732) (-2631.057) * (-2635.488) (-2634.959) (-2635.244) [-2638.197] -- 0:00:45 747500 -- (-2633.762) (-2640.428) (-2637.482) [-2631.656] * (-2638.917) (-2633.188) (-2633.805) [-2635.875] -- 0:00:44 748000 -- (-2632.252) (-2636.649) (-2642.718) [-2633.290] * (-2635.555) [-2638.583] (-2637.899) (-2635.753) -- 0:00:44 748500 -- (-2638.358) (-2639.784) [-2631.944] (-2636.131) * (-2635.380) [-2632.433] (-2645.178) (-2635.807) -- 0:00:44 749000 -- (-2636.527) [-2640.366] (-2635.169) (-2635.568) * (-2641.876) (-2641.427) [-2631.812] (-2638.045) -- 0:00:44 749500 -- [-2634.918] (-2639.153) (-2638.086) (-2633.314) * (-2633.441) (-2637.043) [-2629.898] (-2639.106) -- 0:00:44 750000 -- (-2631.899) [-2634.619] (-2635.874) (-2635.961) * (-2634.532) [-2631.071] (-2633.414) (-2638.506) -- 0:00:44 Average standard deviation of split frequencies: 0.000000 750500 -- (-2634.975) (-2637.624) [-2629.789] (-2633.420) * [-2632.346] (-2641.775) (-2630.255) (-2637.950) -- 0:00:44 751000 -- [-2630.425] (-2631.966) (-2643.635) (-2633.612) * (-2636.874) (-2643.369) (-2637.222) [-2636.113] -- 0:00:44 751500 -- (-2639.998) (-2637.419) [-2634.652] (-2637.565) * [-2634.111] (-2635.772) (-2638.607) (-2635.530) -- 0:00:43 752000 -- (-2638.575) (-2637.201) (-2633.970) [-2630.743] * (-2633.445) (-2633.645) [-2633.639] (-2640.129) -- 0:00:43 752500 -- (-2640.144) (-2639.071) [-2634.163] (-2636.464) * [-2633.684] (-2633.348) (-2634.305) (-2636.173) -- 0:00:44 753000 -- (-2631.509) (-2632.974) [-2635.197] (-2634.893) * (-2641.671) (-2644.443) [-2636.109] (-2636.415) -- 0:00:43 753500 -- (-2635.190) (-2633.123) (-2639.048) [-2631.629] * (-2637.804) (-2640.856) [-2640.746] (-2637.500) -- 0:00:43 754000 -- (-2634.468) (-2632.963) (-2635.496) [-2635.144] * (-2635.222) (-2636.869) (-2642.442) [-2632.716] -- 0:00:43 754500 -- (-2636.540) [-2631.808] (-2635.377) (-2630.514) * (-2632.367) (-2642.067) (-2640.433) [-2633.081] -- 0:00:43 755000 -- [-2636.115] (-2637.681) (-2636.019) (-2630.405) * (-2633.422) [-2632.915] (-2641.985) (-2638.917) -- 0:00:43 Average standard deviation of split frequencies: 0.000000 755500 -- (-2636.161) (-2633.654) (-2642.102) [-2631.487] * (-2638.059) [-2633.726] (-2632.968) (-2641.167) -- 0:00:43 756000 -- (-2638.085) [-2632.425] (-2632.106) (-2634.377) * (-2647.387) (-2633.834) [-2634.266] (-2643.893) -- 0:00:43 756500 -- (-2639.935) (-2635.802) [-2632.575] (-2633.359) * [-2635.874] (-2631.326) (-2640.204) (-2636.069) -- 0:00:43 757000 -- (-2636.021) (-2633.631) (-2634.797) [-2635.277] * [-2632.782] (-2637.329) (-2638.862) (-2636.652) -- 0:00:43 757500 -- (-2642.772) (-2637.057) [-2639.363] (-2632.493) * (-2632.497) (-2637.595) [-2637.022] (-2632.881) -- 0:00:42 758000 -- (-2631.240) (-2637.025) [-2634.001] (-2632.261) * (-2634.351) (-2635.096) (-2633.100) [-2633.220] -- 0:00:42 758500 -- (-2642.017) [-2632.734] (-2636.844) (-2636.438) * [-2635.000] (-2637.240) (-2636.710) (-2638.546) -- 0:00:42 759000 -- (-2636.571) (-2632.856) [-2638.389] (-2637.628) * (-2639.018) [-2636.855] (-2634.241) (-2634.173) -- 0:00:42 759500 -- (-2635.563) (-2638.149) (-2641.425) [-2632.608] * (-2635.616) [-2636.549] (-2634.358) (-2636.322) -- 0:00:42 760000 -- (-2635.547) (-2633.402) (-2635.439) [-2631.725] * [-2630.929] (-2635.409) (-2633.228) (-2637.635) -- 0:00:42 Average standard deviation of split frequencies: 0.000000 760500 -- [-2632.290] (-2633.401) (-2636.672) (-2638.220) * (-2635.148) (-2640.058) [-2635.764] (-2634.247) -- 0:00:42 761000 -- (-2635.135) [-2636.532] (-2637.846) (-2635.161) * [-2633.027] (-2631.358) (-2636.545) (-2635.853) -- 0:00:42 761500 -- (-2632.577) (-2633.474) [-2639.137] (-2642.181) * (-2637.675) (-2636.521) [-2634.477] (-2637.977) -- 0:00:42 762000 -- (-2633.848) [-2637.057] (-2645.334) (-2634.800) * (-2636.620) (-2633.515) [-2636.639] (-2641.094) -- 0:00:42 762500 -- (-2639.519) [-2636.706] (-2642.365) (-2632.020) * [-2632.412] (-2636.159) (-2643.808) (-2635.795) -- 0:00:42 763000 -- (-2634.293) (-2645.603) [-2638.276] (-2634.503) * (-2644.293) (-2637.268) [-2633.552] (-2634.339) -- 0:00:41 763500 -- (-2633.470) (-2637.410) [-2638.993] (-2632.726) * (-2635.940) (-2641.652) [-2632.266] (-2635.181) -- 0:00:41 764000 -- (-2636.620) (-2641.186) [-2632.880] (-2637.051) * (-2633.154) (-2637.434) (-2634.077) [-2633.859] -- 0:00:42 764500 -- (-2636.280) [-2635.560] (-2632.221) (-2638.037) * (-2633.179) [-2639.713] (-2638.602) (-2634.155) -- 0:00:41 765000 -- (-2639.093) (-2640.034) [-2634.996] (-2635.432) * (-2633.684) [-2635.548] (-2645.340) (-2639.692) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 765500 -- (-2641.388) [-2637.674] (-2640.225) (-2632.291) * [-2633.093] (-2636.571) (-2643.311) (-2637.172) -- 0:00:41 766000 -- (-2647.462) [-2631.969] (-2634.221) (-2639.992) * (-2636.818) (-2630.186) (-2636.652) [-2638.849] -- 0:00:41 766500 -- [-2638.022] (-2636.705) (-2634.905) (-2634.705) * (-2642.322) (-2634.082) [-2637.493] (-2640.833) -- 0:00:41 767000 -- (-2636.074) (-2642.007) (-2638.827) [-2637.304] * (-2644.227) (-2637.696) [-2638.907] (-2640.420) -- 0:00:41 767500 -- [-2634.232] (-2638.458) (-2634.773) (-2632.983) * (-2635.717) (-2636.776) [-2635.176] (-2647.709) -- 0:00:41 768000 -- (-2638.539) [-2634.110] (-2634.478) (-2639.588) * (-2635.349) [-2631.711] (-2632.717) (-2642.857) -- 0:00:41 768500 -- (-2638.622) [-2631.928] (-2637.437) (-2637.384) * (-2640.138) [-2638.448] (-2637.406) (-2646.543) -- 0:00:40 769000 -- (-2635.150) [-2633.613] (-2637.590) (-2639.358) * [-2637.949] (-2635.612) (-2633.172) (-2638.819) -- 0:00:40 769500 -- (-2635.642) (-2637.995) (-2638.237) [-2631.265] * (-2632.937) (-2635.910) [-2635.697] (-2638.732) -- 0:00:41 770000 -- [-2635.385] (-2639.136) (-2638.041) (-2638.927) * (-2635.222) [-2634.517] (-2638.266) (-2631.439) -- 0:00:40 Average standard deviation of split frequencies: 0.000000 770500 -- (-2640.170) (-2631.940) [-2633.572] (-2638.394) * [-2631.108] (-2637.921) (-2634.743) (-2642.289) -- 0:00:40 771000 -- (-2639.535) (-2634.161) [-2635.814] (-2641.043) * [-2637.864] (-2640.730) (-2634.878) (-2633.814) -- 0:00:40 771500 -- (-2636.556) (-2641.060) [-2633.211] (-2641.319) * (-2637.234) (-2639.210) (-2636.893) [-2636.477] -- 0:00:40 772000 -- (-2636.242) (-2641.971) (-2637.949) [-2633.441] * [-2629.943] (-2637.138) (-2638.869) (-2634.113) -- 0:00:40 772500 -- (-2640.691) [-2638.076] (-2630.837) (-2640.702) * [-2634.080] (-2632.025) (-2641.367) (-2637.049) -- 0:00:40 773000 -- [-2634.010] (-2636.406) (-2635.834) (-2635.796) * (-2636.332) [-2642.330] (-2632.018) (-2634.190) -- 0:00:40 773500 -- [-2633.853] (-2637.999) (-2636.935) (-2637.911) * (-2638.687) (-2634.561) [-2633.624] (-2633.061) -- 0:00:40 774000 -- [-2638.220] (-2639.423) (-2636.114) (-2635.099) * (-2635.585) [-2635.754] (-2637.169) (-2638.202) -- 0:00:40 774500 -- (-2630.805) [-2631.709] (-2637.212) (-2636.422) * [-2633.113] (-2633.514) (-2644.764) (-2636.754) -- 0:00:39 775000 -- [-2632.100] (-2631.346) (-2636.672) (-2639.248) * (-2634.085) [-2633.949] (-2636.754) (-2639.029) -- 0:00:39 Average standard deviation of split frequencies: 0.000000 775500 -- (-2634.836) (-2634.624) [-2634.596] (-2639.680) * [-2634.824] (-2642.038) (-2635.952) (-2638.769) -- 0:00:39 776000 -- (-2645.659) (-2635.255) [-2632.071] (-2636.465) * [-2633.504] (-2633.081) (-2633.114) (-2636.821) -- 0:00:39 776500 -- [-2637.166] (-2639.340) (-2640.129) (-2641.325) * [-2634.337] (-2634.342) (-2637.602) (-2643.907) -- 0:00:39 777000 -- [-2634.153] (-2633.860) (-2635.453) (-2637.505) * (-2641.751) [-2636.571] (-2638.199) (-2638.029) -- 0:00:39 777500 -- [-2638.550] (-2636.510) (-2637.541) (-2635.028) * (-2636.443) [-2636.100] (-2631.802) (-2635.849) -- 0:00:39 778000 -- (-2636.856) (-2634.751) [-2636.743] (-2636.410) * (-2635.115) [-2638.771] (-2636.121) (-2641.188) -- 0:00:39 778500 -- (-2644.677) (-2634.668) [-2634.479] (-2640.517) * (-2638.581) (-2637.777) (-2640.358) [-2636.573] -- 0:00:39 779000 -- [-2636.092] (-2636.164) (-2630.851) (-2643.019) * [-2631.367] (-2631.231) (-2643.681) (-2635.353) -- 0:00:39 779500 -- [-2639.041] (-2633.043) (-2634.060) (-2642.842) * (-2636.888) [-2636.680] (-2636.381) (-2632.798) -- 0:00:39 780000 -- (-2638.975) [-2635.137] (-2636.179) (-2640.715) * (-2633.848) (-2636.628) (-2637.217) [-2631.402] -- 0:00:38 Average standard deviation of split frequencies: 0.000000 780500 -- [-2639.985] (-2638.467) (-2636.508) (-2637.012) * (-2632.513) (-2636.909) (-2636.609) [-2636.612] -- 0:00:38 781000 -- (-2636.574) [-2638.935] (-2635.198) (-2643.366) * (-2639.591) (-2638.835) (-2633.692) [-2639.345] -- 0:00:38 781500 -- (-2630.035) [-2632.564] (-2637.092) (-2642.907) * [-2637.827] (-2642.369) (-2633.029) (-2638.818) -- 0:00:38 782000 -- (-2638.514) (-2631.516) [-2636.230] (-2632.544) * (-2645.138) [-2633.226] (-2636.906) (-2638.529) -- 0:00:38 782500 -- (-2635.343) (-2633.604) [-2637.079] (-2634.219) * (-2636.835) (-2637.937) (-2633.407) [-2641.132] -- 0:00:38 783000 -- (-2637.982) (-2638.201) [-2633.805] (-2638.643) * (-2639.738) (-2632.242) (-2631.708) [-2636.710] -- 0:00:38 783500 -- (-2634.401) [-2641.475] (-2639.720) (-2635.620) * (-2633.033) [-2637.748] (-2639.394) (-2633.376) -- 0:00:38 784000 -- (-2637.368) [-2643.047] (-2642.149) (-2636.604) * [-2632.407] (-2640.335) (-2638.537) (-2638.127) -- 0:00:38 784500 -- (-2644.752) (-2635.845) (-2635.967) [-2638.832] * (-2639.266) (-2634.982) [-2633.832] (-2637.513) -- 0:00:38 785000 -- [-2639.003] (-2637.885) (-2634.673) (-2633.533) * (-2636.316) [-2634.827] (-2638.932) (-2641.330) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 785500 -- [-2631.885] (-2635.489) (-2633.650) (-2638.063) * [-2633.520] (-2643.350) (-2640.174) (-2638.284) -- 0:00:37 786000 -- (-2634.185) (-2636.191) (-2631.513) [-2635.987] * (-2637.977) (-2642.470) (-2633.301) [-2637.095] -- 0:00:37 786500 -- (-2634.308) (-2631.485) (-2636.268) [-2633.712] * (-2639.309) (-2638.386) (-2639.605) [-2640.289] -- 0:00:38 787000 -- (-2634.410) (-2638.013) [-2633.495] (-2633.708) * (-2638.443) (-2637.067) (-2635.431) [-2631.559] -- 0:00:37 787500 -- (-2633.464) [-2630.185] (-2634.605) (-2639.432) * (-2638.148) (-2638.475) (-2636.415) [-2635.644] -- 0:00:37 788000 -- (-2634.948) (-2633.013) [-2633.762] (-2637.592) * (-2636.370) [-2636.423] (-2638.377) (-2635.784) -- 0:00:37 788500 -- (-2632.580) [-2633.501] (-2632.604) (-2636.196) * (-2637.572) (-2634.072) [-2636.734] (-2637.471) -- 0:00:37 789000 -- (-2632.683) (-2637.313) [-2632.666] (-2639.782) * [-2635.774] (-2633.532) (-2634.305) (-2633.331) -- 0:00:37 789500 -- (-2636.709) (-2637.100) [-2641.753] (-2638.952) * [-2634.978] (-2634.070) (-2634.191) (-2633.651) -- 0:00:37 790000 -- (-2636.622) (-2635.604) (-2634.221) [-2633.141] * [-2636.337] (-2635.659) (-2637.593) (-2638.475) -- 0:00:37 Average standard deviation of split frequencies: 0.000000 790500 -- (-2643.129) (-2636.103) [-2641.317] (-2633.807) * (-2637.870) (-2637.618) (-2636.486) [-2634.031] -- 0:00:37 791000 -- [-2633.994] (-2632.518) (-2642.391) (-2637.079) * [-2641.022] (-2639.454) (-2636.817) (-2632.646) -- 0:00:36 791500 -- (-2633.424) (-2637.067) [-2632.809] (-2641.737) * (-2636.030) (-2636.811) [-2634.096] (-2637.144) -- 0:00:36 792000 -- (-2635.074) [-2635.996] (-2635.720) (-2635.734) * (-2637.207) (-2636.915) (-2636.246) [-2633.229] -- 0:00:37 792500 -- (-2638.555) [-2635.683] (-2634.223) (-2633.600) * (-2636.017) [-2634.194] (-2640.302) (-2634.637) -- 0:00:36 793000 -- (-2634.202) (-2640.127) [-2632.286] (-2633.919) * (-2644.568) (-2636.229) [-2633.680] (-2638.636) -- 0:00:36 793500 -- (-2641.239) [-2634.579] (-2635.893) (-2640.813) * (-2636.450) [-2633.463] (-2638.955) (-2634.650) -- 0:00:36 794000 -- [-2637.050] (-2635.286) (-2633.775) (-2631.276) * (-2632.872) (-2631.631) [-2636.046] (-2639.376) -- 0:00:36 794500 -- [-2634.410] (-2635.314) (-2636.698) (-2633.041) * (-2635.591) (-2637.752) [-2636.873] (-2633.643) -- 0:00:36 795000 -- (-2634.773) (-2630.716) [-2631.896] (-2638.754) * (-2636.108) (-2639.656) [-2631.753] (-2629.839) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 795500 -- (-2634.305) (-2636.883) [-2633.681] (-2635.054) * (-2634.151) (-2633.764) (-2634.300) [-2634.919] -- 0:00:36 796000 -- [-2633.412] (-2641.675) (-2633.601) (-2647.882) * [-2633.780] (-2634.868) (-2637.720) (-2636.993) -- 0:00:36 796500 -- [-2632.507] (-2634.651) (-2637.141) (-2632.666) * (-2637.512) [-2639.054] (-2637.019) (-2641.683) -- 0:00:36 797000 -- (-2634.881) (-2636.989) [-2634.463] (-2638.456) * (-2636.006) (-2634.915) (-2637.279) [-2643.798] -- 0:00:35 797500 -- (-2637.198) (-2635.644) [-2636.001] (-2635.677) * (-2635.641) (-2640.108) (-2638.031) [-2639.277] -- 0:00:35 798000 -- (-2638.479) [-2630.353] (-2636.536) (-2633.527) * (-2636.165) (-2631.336) [-2634.785] (-2644.822) -- 0:00:35 798500 -- [-2637.580] (-2638.408) (-2641.154) (-2631.516) * (-2634.415) (-2633.537) (-2631.448) [-2637.260] -- 0:00:35 799000 -- (-2636.596) (-2636.621) [-2638.431] (-2633.518) * (-2634.895) (-2633.834) (-2640.236) [-2635.019] -- 0:00:35 799500 -- (-2648.366) [-2633.718] (-2633.213) (-2638.919) * (-2636.184) (-2635.121) (-2637.404) [-2633.107] -- 0:00:35 800000 -- (-2637.551) (-2638.912) [-2633.039] (-2632.359) * [-2635.549] (-2629.124) (-2641.499) (-2632.940) -- 0:00:35 Average standard deviation of split frequencies: 0.000000 800500 -- (-2636.611) (-2637.278) (-2641.102) [-2640.596] * (-2630.084) [-2630.155] (-2632.643) (-2634.645) -- 0:00:35 801000 -- (-2636.914) [-2631.753] (-2637.882) (-2635.116) * (-2633.563) (-2636.735) (-2632.134) [-2633.920] -- 0:00:35 801500 -- (-2637.893) (-2638.417) (-2633.595) [-2636.721] * [-2636.514] (-2633.649) (-2636.720) (-2641.890) -- 0:00:35 802000 -- (-2633.702) (-2633.423) (-2633.144) [-2632.050] * (-2636.358) [-2636.011] (-2637.752) (-2641.831) -- 0:00:35 802500 -- [-2639.352] (-2633.391) (-2638.018) (-2633.486) * (-2637.977) (-2632.495) (-2639.592) [-2641.326] -- 0:00:34 803000 -- (-2636.078) (-2635.681) [-2636.401] (-2636.079) * (-2642.421) (-2637.234) (-2635.246) [-2635.586] -- 0:00:34 803500 -- (-2635.103) (-2633.071) (-2633.854) [-2637.565] * (-2639.647) (-2633.680) [-2635.715] (-2636.902) -- 0:00:34 804000 -- (-2637.955) [-2631.766] (-2645.566) (-2637.447) * [-2630.602] (-2635.110) (-2640.877) (-2634.209) -- 0:00:34 804500 -- [-2638.294] (-2635.525) (-2635.698) (-2639.186) * (-2633.725) [-2632.360] (-2636.650) (-2636.264) -- 0:00:34 805000 -- (-2636.861) [-2639.523] (-2633.341) (-2640.347) * (-2633.759) [-2634.965] (-2637.345) (-2633.370) -- 0:00:34 Average standard deviation of split frequencies: 0.000000 805500 -- (-2637.127) (-2640.366) (-2637.928) [-2640.651] * (-2636.830) [-2633.527] (-2636.930) (-2636.832) -- 0:00:34 806000 -- [-2638.993] (-2638.662) (-2637.755) (-2636.501) * (-2631.511) [-2642.907] (-2633.323) (-2633.490) -- 0:00:34 806500 -- (-2636.670) (-2644.815) (-2635.456) [-2637.784] * (-2638.858) (-2635.490) [-2640.479] (-2634.383) -- 0:00:34 807000 -- (-2632.361) (-2644.306) (-2636.841) [-2636.949] * [-2637.286] (-2639.748) (-2631.468) (-2638.695) -- 0:00:34 807500 -- [-2639.587] (-2634.200) (-2638.148) (-2642.835) * (-2639.417) [-2632.592] (-2634.677) (-2636.838) -- 0:00:34 808000 -- (-2639.391) (-2633.730) [-2646.173] (-2636.112) * [-2632.781] (-2631.931) (-2635.264) (-2633.246) -- 0:00:33 808500 -- (-2636.221) (-2631.862) [-2639.732] (-2637.962) * (-2638.265) (-2644.501) (-2638.793) [-2633.116] -- 0:00:33 809000 -- (-2638.438) [-2635.959] (-2634.297) (-2634.508) * (-2637.890) (-2642.766) [-2630.301] (-2639.738) -- 0:00:33 809500 -- (-2641.546) [-2637.889] (-2636.659) (-2632.575) * [-2630.524] (-2635.480) (-2631.685) (-2639.379) -- 0:00:33 810000 -- [-2629.466] (-2634.919) (-2635.661) (-2634.129) * (-2635.258) [-2633.162] (-2638.873) (-2637.811) -- 0:00:33 Average standard deviation of split frequencies: 0.000000 810500 -- (-2634.745) (-2633.441) [-2639.803] (-2634.680) * [-2636.191] (-2634.105) (-2636.567) (-2635.151) -- 0:00:33 811000 -- (-2634.623) [-2636.206] (-2645.134) (-2636.868) * (-2632.858) (-2641.934) (-2634.828) [-2631.331] -- 0:00:33 811500 -- (-2636.611) (-2638.841) [-2634.226] (-2634.386) * (-2636.679) (-2644.657) [-2634.848] (-2629.992) -- 0:00:33 812000 -- (-2636.705) [-2637.253] (-2635.633) (-2634.253) * [-2634.794] (-2636.825) (-2632.502) (-2631.605) -- 0:00:33 812500 -- (-2636.329) (-2634.659) [-2632.562] (-2632.371) * [-2640.562] (-2632.396) (-2646.654) (-2631.866) -- 0:00:33 813000 -- (-2638.924) (-2631.183) (-2634.226) [-2638.935] * (-2638.700) [-2633.566] (-2632.246) (-2639.056) -- 0:00:33 813500 -- (-2640.427) [-2639.972] (-2632.749) (-2634.802) * (-2645.597) (-2636.828) [-2630.600] (-2636.245) -- 0:00:33 814000 -- (-2638.787) (-2646.398) [-2637.547] (-2640.077) * (-2648.006) [-2642.137] (-2632.127) (-2639.236) -- 0:00:32 814500 -- (-2636.876) [-2638.429] (-2638.357) (-2642.597) * (-2640.608) (-2635.578) [-2639.140] (-2647.435) -- 0:00:32 815000 -- (-2638.961) (-2634.693) [-2635.461] (-2632.746) * (-2632.827) (-2634.334) [-2630.085] (-2644.269) -- 0:00:32 Average standard deviation of split frequencies: 0.000000 815500 -- (-2644.446) [-2635.597] (-2634.764) (-2642.270) * (-2634.478) (-2633.524) (-2639.076) [-2637.029] -- 0:00:32 816000 -- (-2640.998) [-2639.373] (-2632.342) (-2642.498) * (-2640.397) (-2636.953) [-2636.317] (-2637.110) -- 0:00:32 816500 -- [-2639.717] (-2638.874) (-2637.303) (-2637.721) * (-2642.020) (-2637.928) (-2634.169) [-2634.651] -- 0:00:32 817000 -- [-2632.839] (-2637.365) (-2634.937) (-2635.017) * (-2634.859) (-2633.679) (-2633.337) [-2632.091] -- 0:00:32 817500 -- (-2638.920) (-2631.417) (-2638.362) [-2636.814] * (-2637.685) [-2632.169] (-2635.567) (-2635.643) -- 0:00:32 818000 -- [-2639.097] (-2634.399) (-2642.508) (-2633.269) * (-2638.014) (-2638.038) [-2633.346] (-2636.485) -- 0:00:32 818500 -- (-2634.832) (-2643.757) [-2634.482] (-2647.413) * (-2635.545) (-2631.392) [-2635.630] (-2631.898) -- 0:00:32 819000 -- (-2640.764) (-2634.121) (-2635.141) [-2636.833] * (-2632.376) [-2637.036] (-2634.954) (-2633.999) -- 0:00:32 819500 -- (-2633.901) [-2632.561] (-2638.586) (-2638.428) * [-2636.107] (-2637.354) (-2635.878) (-2633.119) -- 0:00:31 820000 -- (-2632.078) (-2635.465) [-2635.107] (-2637.952) * (-2643.399) [-2636.983] (-2637.405) (-2637.148) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 820500 -- (-2634.209) (-2636.035) [-2636.316] (-2637.612) * (-2644.388) (-2635.082) (-2637.337) [-2631.717] -- 0:00:31 821000 -- [-2637.121] (-2633.487) (-2641.311) (-2637.056) * (-2643.560) (-2639.206) [-2632.920] (-2632.599) -- 0:00:31 821500 -- (-2634.218) (-2633.956) [-2631.707] (-2640.520) * (-2644.587) (-2635.881) [-2635.623] (-2638.963) -- 0:00:31 822000 -- (-2634.842) [-2633.182] (-2635.097) (-2637.082) * [-2641.504] (-2637.104) (-2632.348) (-2636.385) -- 0:00:31 822500 -- (-2633.162) (-2633.924) (-2638.894) [-2633.538] * (-2640.371) (-2638.885) [-2638.698] (-2638.475) -- 0:00:31 823000 -- [-2639.531] (-2635.116) (-2631.797) (-2635.241) * (-2637.590) [-2635.284] (-2637.271) (-2641.890) -- 0:00:31 823500 -- (-2641.586) (-2632.174) [-2633.355] (-2634.301) * (-2638.507) [-2637.432] (-2633.027) (-2636.295) -- 0:00:31 824000 -- (-2636.329) [-2632.861] (-2642.061) (-2635.004) * [-2631.081] (-2642.290) (-2634.889) (-2632.901) -- 0:00:31 824500 -- [-2637.593] (-2635.278) (-2642.186) (-2641.797) * (-2636.734) (-2639.520) (-2633.174) [-2632.869] -- 0:00:31 825000 -- (-2632.452) (-2637.494) (-2648.452) [-2634.492] * (-2642.030) (-2634.021) (-2637.610) [-2633.954] -- 0:00:30 Average standard deviation of split frequencies: 0.000000 825500 -- (-2630.947) [-2635.980] (-2644.611) (-2635.052) * (-2635.529) (-2641.240) [-2630.657] (-2637.753) -- 0:00:30 826000 -- (-2635.928) (-2640.678) [-2635.722] (-2635.218) * (-2641.148) (-2638.942) [-2631.689] (-2632.728) -- 0:00:30 826500 -- [-2636.936] (-2633.647) (-2639.782) (-2634.215) * (-2637.621) (-2636.793) [-2635.711] (-2634.742) -- 0:00:30 827000 -- (-2635.898) (-2634.697) [-2635.662] (-2633.139) * (-2638.121) [-2634.495] (-2637.158) (-2634.997) -- 0:00:30 827500 -- (-2634.194) (-2638.519) (-2635.726) [-2634.670] * (-2641.162) (-2636.938) (-2637.442) [-2637.540] -- 0:00:30 828000 -- (-2633.430) [-2634.698] (-2632.117) (-2642.375) * (-2633.756) (-2632.461) [-2640.366] (-2638.416) -- 0:00:30 828500 -- (-2636.627) [-2634.966] (-2642.441) (-2641.243) * [-2632.851] (-2634.430) (-2637.011) (-2641.171) -- 0:00:30 829000 -- (-2634.009) (-2634.971) (-2638.204) [-2633.080] * [-2635.056] (-2637.837) (-2634.253) (-2635.076) -- 0:00:30 829500 -- (-2639.669) (-2635.921) (-2637.383) [-2638.520] * (-2632.296) (-2643.470) [-2637.796] (-2635.172) -- 0:00:30 830000 -- (-2636.284) (-2639.736) [-2634.282] (-2644.169) * (-2631.893) (-2639.391) (-2636.157) [-2633.728] -- 0:00:30 Average standard deviation of split frequencies: 0.000000 830500 -- [-2633.770] (-2639.568) (-2635.134) (-2637.545) * (-2634.338) (-2639.616) [-2635.569] (-2640.457) -- 0:00:30 831000 -- (-2634.750) (-2641.817) (-2636.268) [-2634.207] * (-2633.743) [-2634.483] (-2635.406) (-2643.519) -- 0:00:29 831500 -- (-2633.415) (-2637.119) (-2637.293) [-2637.488] * (-2631.280) (-2632.611) (-2633.090) [-2635.124] -- 0:00:29 832000 -- (-2636.636) (-2636.669) [-2635.679] (-2638.724) * (-2634.634) (-2636.498) (-2636.126) [-2635.580] -- 0:00:29 832500 -- (-2637.094) (-2635.439) (-2638.151) [-2633.234] * (-2635.858) (-2635.860) (-2638.529) [-2635.952] -- 0:00:29 833000 -- (-2638.434) (-2636.438) (-2635.135) [-2635.372] * (-2635.932) [-2634.916] (-2634.139) (-2637.377) -- 0:00:29 833500 -- [-2638.940] (-2634.102) (-2638.440) (-2639.785) * (-2632.782) (-2634.669) [-2637.678] (-2638.328) -- 0:00:29 834000 -- (-2636.430) (-2635.927) (-2633.772) [-2634.926] * (-2635.939) [-2634.517] (-2636.720) (-2639.131) -- 0:00:29 834500 -- (-2630.465) [-2633.090] (-2634.089) (-2635.489) * (-2636.579) (-2633.333) (-2639.332) [-2641.488] -- 0:00:29 835000 -- [-2634.727] (-2634.656) (-2633.205) (-2634.094) * (-2638.390) (-2632.905) (-2630.808) [-2634.267] -- 0:00:29 Average standard deviation of split frequencies: 0.000000 835500 -- (-2643.830) [-2638.544] (-2632.516) (-2637.022) * (-2634.293) (-2637.475) (-2633.402) [-2634.008] -- 0:00:29 836000 -- (-2640.863) [-2639.772] (-2634.673) (-2632.417) * (-2638.920) (-2641.614) (-2630.847) [-2640.098] -- 0:00:29 836500 -- (-2631.462) (-2636.342) [-2629.693] (-2636.755) * (-2635.718) [-2633.000] (-2629.185) (-2636.591) -- 0:00:28 837000 -- [-2635.162] (-2632.482) (-2631.284) (-2640.143) * (-2637.503) [-2637.001] (-2641.284) (-2638.660) -- 0:00:28 837500 -- (-2637.245) (-2632.716) [-2633.773] (-2637.342) * [-2636.341] (-2637.716) (-2635.887) (-2632.180) -- 0:00:28 838000 -- (-2632.634) (-2636.174) (-2634.484) [-2634.237] * [-2636.464] (-2635.022) (-2635.959) (-2640.110) -- 0:00:28 838500 -- (-2632.710) (-2633.691) (-2632.882) [-2632.745] * (-2638.581) (-2633.677) [-2640.572] (-2637.483) -- 0:00:28 839000 -- [-2642.352] (-2634.535) (-2636.649) (-2637.544) * (-2648.957) (-2633.261) (-2637.201) [-2634.363] -- 0:00:28 839500 -- (-2633.660) (-2637.572) [-2634.229] (-2637.734) * (-2638.555) [-2632.630] (-2636.643) (-2639.873) -- 0:00:28 840000 -- (-2636.723) [-2631.292] (-2638.658) (-2637.455) * (-2637.276) (-2634.640) [-2635.595] (-2636.185) -- 0:00:28 Average standard deviation of split frequencies: 0.000000 840500 -- [-2635.898] (-2634.751) (-2634.886) (-2637.242) * [-2633.708] (-2636.059) (-2638.694) (-2635.429) -- 0:00:28 841000 -- [-2635.725] (-2635.599) (-2636.263) (-2636.064) * (-2638.879) (-2636.044) (-2635.830) [-2633.610] -- 0:00:28 841500 -- (-2634.583) (-2633.390) [-2630.345] (-2640.335) * (-2638.265) [-2634.791] (-2639.028) (-2641.931) -- 0:00:28 842000 -- (-2634.659) (-2636.981) [-2636.616] (-2635.698) * (-2639.780) (-2639.697) (-2632.131) [-2639.366] -- 0:00:27 842500 -- (-2644.836) (-2634.800) [-2641.505] (-2630.582) * [-2634.790] (-2639.699) (-2636.124) (-2634.298) -- 0:00:27 843000 -- [-2638.279] (-2637.863) (-2633.125) (-2640.952) * (-2642.757) (-2635.195) (-2635.622) [-2633.419] -- 0:00:27 843500 -- [-2642.569] (-2638.061) (-2641.783) (-2635.639) * (-2634.746) (-2643.723) [-2634.452] (-2638.180) -- 0:00:27 844000 -- [-2635.725] (-2633.819) (-2638.478) (-2640.133) * (-2634.792) (-2636.458) (-2639.757) [-2634.341] -- 0:00:27 844500 -- (-2639.317) [-2633.889] (-2635.575) (-2635.262) * (-2633.988) (-2637.627) [-2634.634] (-2635.628) -- 0:00:27 845000 -- [-2634.869] (-2636.239) (-2631.992) (-2638.029) * (-2640.514) [-2635.479] (-2635.389) (-2634.856) -- 0:00:27 Average standard deviation of split frequencies: 0.000000 845500 -- (-2632.608) [-2634.449] (-2635.910) (-2634.256) * (-2638.988) (-2632.824) (-2630.784) [-2636.878] -- 0:00:27 846000 -- (-2631.754) [-2636.466] (-2637.390) (-2632.006) * (-2638.334) (-2640.220) (-2638.601) [-2639.817] -- 0:00:27 846500 -- (-2636.076) [-2631.907] (-2637.956) (-2634.268) * (-2636.576) (-2633.980) (-2637.957) [-2634.446] -- 0:00:27 847000 -- [-2631.256] (-2632.729) (-2640.220) (-2637.060) * (-2634.440) (-2636.816) (-2636.551) [-2632.952] -- 0:00:27 847500 -- (-2638.111) [-2641.422] (-2635.469) (-2639.675) * (-2634.464) (-2646.775) (-2633.330) [-2632.231] -- 0:00:26 848000 -- [-2635.376] (-2640.852) (-2647.794) (-2642.682) * (-2630.380) (-2635.765) [-2638.250] (-2634.886) -- 0:00:26 848500 -- [-2638.389] (-2633.470) (-2633.410) (-2642.067) * (-2636.878) (-2640.687) [-2638.697] (-2635.023) -- 0:00:26 849000 -- (-2636.341) (-2630.537) [-2633.111] (-2635.568) * [-2640.476] (-2630.958) (-2634.468) (-2635.927) -- 0:00:26 849500 -- (-2635.012) [-2633.529] (-2634.698) (-2635.275) * (-2637.683) (-2632.606) [-2634.535] (-2635.617) -- 0:00:26 850000 -- (-2637.011) (-2642.420) [-2630.843] (-2633.773) * (-2634.431) (-2639.239) (-2633.662) [-2634.046] -- 0:00:26 Average standard deviation of split frequencies: 0.000000 850500 -- (-2636.339) (-2635.884) [-2636.729] (-2639.396) * (-2631.744) [-2641.261] (-2633.285) (-2631.865) -- 0:00:26 851000 -- [-2630.840] (-2638.495) (-2634.215) (-2636.020) * [-2637.397] (-2641.216) (-2635.134) (-2636.432) -- 0:00:26 851500 -- [-2632.187] (-2642.519) (-2630.590) (-2638.066) * (-2635.563) [-2632.835] (-2638.323) (-2633.382) -- 0:00:26 852000 -- [-2630.449] (-2643.978) (-2642.130) (-2634.053) * (-2635.262) (-2636.754) [-2640.999] (-2637.582) -- 0:00:26 852500 -- (-2632.857) [-2637.516] (-2639.564) (-2633.606) * [-2636.703] (-2645.236) (-2636.653) (-2635.330) -- 0:00:26 853000 -- [-2634.718] (-2630.809) (-2643.763) (-2636.816) * (-2630.024) (-2644.396) [-2636.245] (-2635.056) -- 0:00:26 853500 -- (-2652.339) [-2634.808] (-2637.536) (-2640.059) * [-2632.795] (-2638.660) (-2635.817) (-2636.177) -- 0:00:25 854000 -- (-2637.537) (-2636.747) [-2633.661] (-2635.810) * (-2628.778) (-2640.089) (-2632.652) [-2635.987] -- 0:00:25 854500 -- (-2639.298) (-2641.462) (-2639.373) [-2634.018] * [-2633.402] (-2636.043) (-2634.933) (-2635.615) -- 0:00:25 855000 -- [-2633.734] (-2639.594) (-2636.444) (-2639.033) * (-2635.382) (-2641.543) [-2630.702] (-2636.704) -- 0:00:25 Average standard deviation of split frequencies: 0.000000 855500 -- (-2638.377) [-2632.574] (-2636.276) (-2635.196) * [-2639.255] (-2644.632) (-2632.391) (-2645.411) -- 0:00:25 856000 -- (-2636.227) [-2644.147] (-2631.425) (-2643.739) * (-2641.669) [-2638.790] (-2633.282) (-2636.364) -- 0:00:25 856500 -- (-2631.001) (-2642.928) [-2633.827] (-2638.942) * (-2635.319) [-2638.424] (-2633.065) (-2635.704) -- 0:00:25 857000 -- (-2634.878) (-2638.209) [-2639.080] (-2638.240) * (-2640.116) [-2640.631] (-2635.231) (-2635.990) -- 0:00:25 857500 -- [-2636.467] (-2637.320) (-2634.638) (-2636.024) * [-2634.443] (-2631.427) (-2638.320) (-2637.587) -- 0:00:25 858000 -- (-2635.511) (-2637.171) [-2636.966] (-2641.293) * (-2635.235) [-2636.866] (-2634.432) (-2642.002) -- 0:00:25 858500 -- [-2638.276] (-2634.728) (-2635.680) (-2639.094) * (-2639.050) [-2636.816] (-2639.968) (-2642.577) -- 0:00:25 859000 -- (-2635.825) [-2631.942] (-2633.760) (-2636.640) * (-2638.495) [-2636.579] (-2641.062) (-2639.369) -- 0:00:24 859500 -- (-2636.472) (-2640.627) [-2630.211] (-2639.958) * (-2637.265) (-2634.131) (-2633.000) [-2637.486] -- 0:00:24 860000 -- (-2635.576) [-2643.193] (-2634.959) (-2636.026) * (-2639.769) [-2634.088] (-2639.023) (-2638.729) -- 0:00:24 Average standard deviation of split frequencies: 0.000000 860500 -- (-2636.928) (-2638.079) (-2631.226) [-2636.295] * (-2635.936) (-2639.064) (-2640.143) [-2636.588] -- 0:00:24 861000 -- (-2634.859) (-2636.514) (-2637.168) [-2630.493] * (-2641.037) [-2632.597] (-2637.423) (-2643.335) -- 0:00:24 861500 -- (-2635.621) (-2632.576) (-2632.789) [-2633.940] * (-2640.931) [-2633.743] (-2637.603) (-2640.225) -- 0:00:24 862000 -- (-2631.221) (-2636.476) [-2640.253] (-2631.745) * [-2638.118] (-2634.721) (-2633.165) (-2641.113) -- 0:00:24 862500 -- (-2641.741) (-2638.179) [-2632.322] (-2637.692) * (-2633.186) [-2631.716] (-2638.862) (-2631.943) -- 0:00:24 863000 -- [-2636.250] (-2633.287) (-2633.452) (-2634.643) * [-2635.976] (-2635.907) (-2641.980) (-2635.552) -- 0:00:24 863500 -- [-2632.333] (-2635.776) (-2633.137) (-2636.429) * (-2633.629) (-2647.982) [-2636.106] (-2636.835) -- 0:00:24 864000 -- [-2632.918] (-2637.672) (-2633.308) (-2637.733) * (-2636.442) [-2630.942] (-2639.327) (-2632.726) -- 0:00:24 864500 -- (-2634.490) (-2637.832) (-2634.353) [-2637.845] * (-2629.953) [-2632.115] (-2632.054) (-2636.361) -- 0:00:23 865000 -- [-2633.069] (-2636.609) (-2640.135) (-2637.746) * (-2634.415) [-2632.401] (-2633.481) (-2635.420) -- 0:00:23 Average standard deviation of split frequencies: 0.000000 865500 -- [-2644.701] (-2638.113) (-2642.719) (-2636.916) * [-2632.307] (-2634.013) (-2633.353) (-2641.718) -- 0:00:23 866000 -- [-2637.124] (-2637.766) (-2644.159) (-2637.383) * [-2633.590] (-2634.449) (-2637.024) (-2641.003) -- 0:00:23 866500 -- [-2635.913] (-2640.730) (-2638.870) (-2635.588) * (-2632.825) (-2633.310) (-2644.398) [-2634.939] -- 0:00:23 867000 -- [-2638.600] (-2637.272) (-2634.245) (-2636.084) * (-2645.423) (-2631.029) [-2636.778] (-2631.284) -- 0:00:23 867500 -- (-2634.778) (-2639.184) [-2635.463] (-2633.772) * (-2638.124) (-2637.517) (-2635.208) [-2632.778] -- 0:00:23 868000 -- (-2637.652) [-2637.837] (-2636.114) (-2637.806) * (-2638.548) (-2642.512) [-2639.215] (-2639.285) -- 0:00:23 868500 -- (-2635.527) [-2634.636] (-2634.599) (-2640.605) * [-2635.422] (-2634.531) (-2638.318) (-2634.972) -- 0:00:23 869000 -- [-2632.657] (-2641.785) (-2637.616) (-2636.771) * (-2637.245) (-2630.829) (-2636.924) [-2635.028] -- 0:00:23 869500 -- [-2633.303] (-2645.276) (-2638.917) (-2635.058) * (-2635.738) [-2635.107] (-2635.178) (-2635.992) -- 0:00:23 870000 -- (-2637.948) (-2632.212) [-2631.207] (-2634.904) * (-2634.431) (-2634.550) [-2637.826] (-2632.958) -- 0:00:23 Average standard deviation of split frequencies: 0.000000 870500 -- (-2633.356) (-2632.827) [-2639.550] (-2641.162) * (-2636.980) (-2639.221) (-2644.193) [-2633.435] -- 0:00:22 871000 -- (-2632.023) [-2639.159] (-2642.486) (-2637.125) * [-2635.346] (-2637.105) (-2634.916) (-2642.052) -- 0:00:22 871500 -- [-2638.701] (-2641.362) (-2639.466) (-2633.935) * (-2632.554) (-2640.132) [-2641.459] (-2632.161) -- 0:00:22 872000 -- [-2634.845] (-2632.505) (-2637.238) (-2632.555) * (-2639.494) (-2634.188) (-2640.797) [-2635.552] -- 0:00:22 872500 -- (-2636.828) [-2635.436] (-2633.297) (-2636.194) * (-2635.233) (-2635.806) [-2636.035] (-2639.904) -- 0:00:22 873000 -- [-2634.862] (-2635.650) (-2640.373) (-2638.496) * (-2639.063) [-2650.129] (-2631.635) (-2641.319) -- 0:00:22 873500 -- (-2635.875) [-2636.453] (-2647.529) (-2633.218) * (-2636.702) (-2630.711) [-2635.929] (-2644.896) -- 0:00:22 874000 -- [-2633.611] (-2633.235) (-2643.670) (-2641.061) * (-2633.050) [-2635.243] (-2640.939) (-2638.944) -- 0:00:22 874500 -- (-2633.909) (-2630.789) (-2633.807) [-2637.493] * (-2636.584) (-2638.208) (-2635.077) [-2633.067] -- 0:00:22 875000 -- (-2636.391) (-2640.672) (-2640.653) [-2631.666] * [-2636.648] (-2639.845) (-2635.600) (-2635.080) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 875500 -- [-2636.873] (-2636.218) (-2639.731) (-2635.574) * (-2642.786) (-2637.156) [-2636.646] (-2636.198) -- 0:00:22 876000 -- (-2636.137) (-2635.622) (-2635.971) [-2636.006] * (-2638.516) (-2637.877) [-2635.168] (-2640.132) -- 0:00:21 876500 -- (-2633.518) [-2632.969] (-2639.095) (-2632.794) * (-2640.815) [-2635.966] (-2643.130) (-2634.743) -- 0:00:21 877000 -- (-2633.958) (-2633.794) [-2637.027] (-2636.804) * (-2635.584) (-2638.029) [-2636.539] (-2635.582) -- 0:00:21 877500 -- (-2637.304) (-2638.973) (-2638.990) [-2635.825] * (-2638.742) (-2638.692) (-2635.790) [-2630.887] -- 0:00:21 878000 -- [-2636.481] (-2645.220) (-2638.771) (-2631.707) * (-2635.456) (-2650.302) [-2635.657] (-2639.244) -- 0:00:21 878500 -- [-2635.204] (-2632.393) (-2639.861) (-2633.829) * [-2634.522] (-2644.367) (-2637.751) (-2632.738) -- 0:00:21 879000 -- (-2635.733) [-2633.107] (-2638.060) (-2637.876) * (-2632.532) [-2632.996] (-2632.141) (-2632.478) -- 0:00:21 879500 -- (-2631.313) (-2635.044) (-2636.617) [-2638.057] * [-2632.401] (-2637.317) (-2638.692) (-2638.855) -- 0:00:21 880000 -- [-2630.820] (-2634.664) (-2638.298) (-2634.173) * [-2630.940] (-2639.680) (-2635.826) (-2634.015) -- 0:00:21 Average standard deviation of split frequencies: 0.000000 880500 -- (-2643.638) (-2631.492) [-2635.453] (-2641.132) * (-2639.842) (-2638.800) (-2633.775) [-2634.297] -- 0:00:21 881000 -- (-2638.496) [-2633.870] (-2632.939) (-2633.275) * (-2637.403) (-2640.716) (-2636.187) [-2640.159] -- 0:00:21 881500 -- [-2632.912] (-2637.471) (-2632.430) (-2636.788) * [-2632.456] (-2637.991) (-2641.855) (-2634.201) -- 0:00:20 882000 -- (-2640.023) (-2637.853) (-2637.914) [-2636.359] * (-2634.613) (-2631.102) [-2638.187] (-2635.916) -- 0:00:20 882500 -- [-2637.018] (-2636.534) (-2633.900) (-2635.660) * (-2636.011) (-2630.377) [-2634.914] (-2638.115) -- 0:00:20 883000 -- (-2634.751) (-2635.252) (-2642.167) [-2636.840] * (-2636.962) (-2631.716) [-2632.529] (-2639.400) -- 0:00:20 883500 -- (-2636.376) (-2636.875) (-2639.132) [-2636.294] * (-2636.536) [-2635.849] (-2630.747) (-2637.725) -- 0:00:20 884000 -- (-2634.980) (-2635.701) (-2635.658) [-2634.040] * (-2640.358) (-2633.549) [-2636.020] (-2640.072) -- 0:00:20 884500 -- (-2640.585) (-2639.142) [-2643.960] (-2634.200) * (-2632.917) (-2642.475) [-2640.088] (-2638.133) -- 0:00:20 885000 -- (-2635.473) (-2640.626) [-2639.052] (-2639.017) * (-2639.283) (-2638.156) [-2638.861] (-2638.973) -- 0:00:20 Average standard deviation of split frequencies: 0.000000 885500 -- (-2633.181) [-2640.891] (-2647.107) (-2638.565) * [-2631.750] (-2633.171) (-2635.798) (-2634.034) -- 0:00:20 886000 -- [-2636.664] (-2636.558) (-2639.517) (-2639.057) * (-2632.778) (-2642.656) [-2639.407] (-2632.001) -- 0:00:20 886500 -- (-2631.026) (-2642.056) (-2633.372) [-2636.734] * (-2635.369) (-2639.263) [-2632.901] (-2637.349) -- 0:00:20 887000 -- [-2634.590] (-2635.834) (-2636.389) (-2638.651) * (-2638.785) (-2635.591) (-2639.214) [-2641.200] -- 0:00:20 887500 -- (-2639.137) [-2636.504] (-2640.544) (-2639.141) * (-2639.881) (-2631.341) [-2632.248] (-2633.514) -- 0:00:19 888000 -- [-2632.593] (-2636.952) (-2646.894) (-2641.380) * (-2641.052) [-2635.576] (-2631.350) (-2631.357) -- 0:00:19 888500 -- [-2632.280] (-2635.996) (-2635.257) (-2636.072) * [-2630.734] (-2640.450) (-2634.222) (-2633.885) -- 0:00:19 889000 -- [-2632.449] (-2634.425) (-2633.619) (-2634.357) * (-2634.981) (-2643.573) [-2634.110] (-2637.933) -- 0:00:19 889500 -- (-2634.572) [-2637.880] (-2640.182) (-2637.607) * [-2633.792] (-2634.437) (-2636.507) (-2647.240) -- 0:00:19 890000 -- (-2641.792) (-2639.327) [-2639.327] (-2636.793) * (-2638.368) (-2637.021) (-2637.080) [-2633.334] -- 0:00:19 Average standard deviation of split frequencies: 0.000000 890500 -- (-2640.154) (-2638.476) (-2634.409) [-2636.410] * [-2631.525] (-2640.792) (-2638.830) (-2634.232) -- 0:00:19 891000 -- (-2637.491) (-2639.635) (-2637.924) [-2633.464] * (-2631.697) (-2637.631) [-2638.293] (-2633.129) -- 0:00:19 891500 -- (-2637.366) (-2645.044) [-2638.058] (-2638.908) * (-2638.951) (-2636.783) (-2639.718) [-2632.804] -- 0:00:19 892000 -- [-2635.405] (-2637.724) (-2634.815) (-2634.023) * (-2637.081) (-2636.562) (-2636.234) [-2631.585] -- 0:00:19 892500 -- [-2635.589] (-2635.526) (-2638.472) (-2637.015) * [-2632.752] (-2640.207) (-2639.955) (-2636.609) -- 0:00:19 893000 -- [-2635.438] (-2637.934) (-2631.643) (-2635.500) * (-2636.159) (-2637.611) (-2636.243) [-2634.269] -- 0:00:18 893500 -- (-2638.989) (-2634.831) [-2635.845] (-2633.136) * [-2640.205] (-2638.824) (-2639.001) (-2642.549) -- 0:00:18 894000 -- (-2634.388) (-2636.340) [-2638.179] (-2634.730) * [-2639.503] (-2639.759) (-2634.639) (-2635.214) -- 0:00:18 894500 -- (-2639.131) [-2632.390] (-2638.829) (-2638.789) * (-2638.427) (-2637.733) (-2636.122) [-2637.476] -- 0:00:18 895000 -- (-2639.382) (-2636.444) [-2639.945] (-2631.752) * [-2637.228] (-2637.052) (-2634.038) (-2636.231) -- 0:00:18 Average standard deviation of split frequencies: 0.000000 895500 -- (-2633.368) (-2639.550) (-2630.754) [-2633.744] * (-2635.555) (-2642.546) (-2642.455) [-2639.679] -- 0:00:18 896000 -- [-2632.488] (-2638.456) (-2631.870) (-2634.779) * (-2633.819) (-2638.147) (-2632.115) [-2637.570] -- 0:00:18 896500 -- (-2635.275) [-2637.097] (-2639.977) (-2635.046) * (-2641.462) (-2636.129) (-2631.695) [-2639.977] -- 0:00:18 897000 -- (-2635.855) (-2643.633) [-2637.077] (-2639.892) * [-2638.770] (-2633.584) (-2639.483) (-2637.665) -- 0:00:18 897500 -- (-2636.978) [-2644.079] (-2637.009) (-2643.402) * (-2633.412) (-2636.032) (-2636.930) [-2633.702] -- 0:00:18 898000 -- (-2634.664) (-2634.099) [-2636.952] (-2638.279) * (-2637.391) (-2638.461) [-2640.117] (-2640.426) -- 0:00:18 898500 -- [-2636.524] (-2638.151) (-2630.518) (-2638.377) * (-2636.669) (-2634.465) (-2644.990) [-2638.436] -- 0:00:17 899000 -- (-2633.610) (-2640.451) [-2633.793] (-2641.798) * (-2632.905) (-2638.545) [-2634.567] (-2635.631) -- 0:00:17 899500 -- (-2638.110) [-2640.385] (-2637.953) (-2636.519) * (-2639.700) (-2635.467) (-2633.819) [-2633.351] -- 0:00:17 900000 -- (-2641.989) [-2637.095] (-2635.135) (-2636.335) * (-2634.177) (-2631.180) [-2629.275] (-2642.113) -- 0:00:17 Average standard deviation of split frequencies: 0.000000 900500 -- [-2635.466] (-2637.630) (-2634.428) (-2639.348) * [-2637.581] (-2634.457) (-2634.183) (-2638.508) -- 0:00:17 901000 -- (-2637.447) (-2635.178) (-2633.289) [-2638.405] * [-2637.737] (-2633.943) (-2633.127) (-2636.390) -- 0:00:17 901500 -- [-2637.012] (-2634.034) (-2636.016) (-2639.628) * (-2642.046) (-2631.803) [-2638.660] (-2635.652) -- 0:00:17 902000 -- (-2635.548) (-2635.418) [-2633.935] (-2640.243) * (-2638.546) (-2632.855) (-2633.414) [-2634.238] -- 0:00:17 902500 -- (-2639.119) (-2633.521) [-2637.109] (-2632.876) * (-2637.064) (-2633.943) [-2634.432] (-2636.759) -- 0:00:17 903000 -- (-2633.488) (-2636.600) [-2635.637] (-2637.313) * (-2638.717) (-2632.511) (-2640.656) [-2632.003] -- 0:00:17 903500 -- [-2630.019] (-2633.887) (-2634.745) (-2643.097) * (-2638.453) (-2635.820) [-2632.331] (-2629.285) -- 0:00:17 904000 -- (-2640.964) [-2634.427] (-2633.827) (-2641.077) * (-2643.887) [-2630.161] (-2639.705) (-2631.086) -- 0:00:16 904500 -- (-2634.859) (-2635.220) (-2639.040) [-2637.035] * (-2643.300) [-2634.782] (-2633.378) (-2639.825) -- 0:00:16 905000 -- [-2642.843] (-2637.211) (-2644.811) (-2638.768) * (-2638.683) (-2638.620) (-2637.924) [-2637.092] -- 0:00:16 Average standard deviation of split frequencies: 0.000000 905500 -- [-2636.807] (-2635.478) (-2638.368) (-2633.229) * [-2635.671] (-2639.979) (-2636.994) (-2638.321) -- 0:00:16 906000 -- (-2635.395) (-2633.646) (-2645.154) [-2639.397] * (-2635.981) (-2633.482) (-2633.555) [-2643.574] -- 0:00:16 906500 -- (-2643.754) (-2636.240) (-2634.052) [-2634.087] * (-2636.466) (-2636.539) (-2632.202) [-2649.176] -- 0:00:16 907000 -- (-2635.897) [-2630.248] (-2638.580) (-2637.653) * (-2640.843) [-2634.812] (-2637.843) (-2638.848) -- 0:00:16 907500 -- [-2641.081] (-2633.997) (-2638.052) (-2632.963) * (-2638.072) (-2636.517) (-2633.432) [-2635.588] -- 0:00:16 908000 -- (-2636.603) (-2634.189) (-2636.644) [-2635.453] * (-2638.017) (-2632.188) (-2636.060) [-2639.828] -- 0:00:16 908500 -- (-2636.387) [-2638.267] (-2643.417) (-2636.078) * [-2634.515] (-2631.886) (-2635.174) (-2637.648) -- 0:00:16 909000 -- [-2635.626] (-2631.716) (-2636.298) (-2634.494) * [-2632.097] (-2639.263) (-2641.931) (-2634.665) -- 0:00:16 909500 -- (-2640.734) (-2641.566) (-2637.364) [-2634.251] * [-2636.434] (-2648.553) (-2633.797) (-2642.174) -- 0:00:16 910000 -- (-2637.092) (-2632.822) (-2636.143) [-2633.302] * (-2638.859) (-2633.171) (-2637.192) [-2635.268] -- 0:00:15 Average standard deviation of split frequencies: 0.000000 910500 -- (-2647.570) (-2640.488) [-2632.385] (-2634.806) * (-2633.149) (-2640.387) (-2642.008) [-2637.096] -- 0:00:15 911000 -- (-2637.427) (-2640.641) (-2637.922) [-2632.943] * (-2637.401) (-2638.172) [-2642.005] (-2643.423) -- 0:00:15 911500 -- [-2636.150] (-2641.124) (-2636.488) (-2634.204) * (-2635.750) (-2634.677) [-2635.955] (-2639.966) -- 0:00:15 912000 -- (-2635.804) (-2639.797) [-2638.826] (-2636.902) * [-2632.809] (-2636.262) (-2639.790) (-2635.035) -- 0:00:15 912500 -- (-2638.311) [-2636.911] (-2632.346) (-2635.213) * (-2638.091) (-2638.280) [-2633.841] (-2641.336) -- 0:00:15 913000 -- (-2636.793) (-2635.995) (-2631.342) [-2632.992] * (-2635.801) [-2635.418] (-2634.728) (-2632.918) -- 0:00:15 913500 -- (-2629.349) (-2636.580) [-2634.725] (-2632.753) * (-2631.203) [-2634.936] (-2637.228) (-2636.111) -- 0:00:15 914000 -- [-2632.337] (-2632.547) (-2631.543) (-2635.540) * (-2633.118) [-2630.497] (-2638.420) (-2635.383) -- 0:00:15 914500 -- (-2637.561) (-2636.837) [-2633.148] (-2633.578) * (-2636.018) (-2642.178) [-2637.941] (-2632.463) -- 0:00:15 915000 -- (-2645.997) (-2633.917) [-2632.439] (-2631.403) * (-2636.943) [-2637.258] (-2641.932) (-2631.011) -- 0:00:15 Average standard deviation of split frequencies: 0.000000 915500 -- [-2634.445] (-2637.759) (-2636.020) (-2640.932) * (-2639.441) [-2634.163] (-2637.564) (-2632.367) -- 0:00:14 916000 -- (-2642.549) (-2636.555) [-2641.813] (-2634.833) * (-2633.593) [-2636.698] (-2635.300) (-2637.855) -- 0:00:14 916500 -- (-2644.067) (-2639.597) [-2634.102] (-2638.052) * [-2637.887] (-2640.283) (-2643.979) (-2638.189) -- 0:00:14 917000 -- (-2634.490) [-2634.796] (-2632.345) (-2636.565) * (-2637.489) (-2641.395) [-2633.337] (-2634.825) -- 0:00:14 917500 -- [-2635.073] (-2640.416) (-2630.058) (-2643.238) * (-2629.935) (-2641.175) [-2633.921] (-2633.665) -- 0:00:14 918000 -- (-2629.941) [-2637.938] (-2638.985) (-2633.684) * (-2637.879) (-2644.860) (-2633.709) [-2635.574] -- 0:00:14 918500 -- (-2634.757) [-2632.735] (-2641.009) (-2633.132) * (-2633.564) (-2640.538) (-2635.982) [-2634.416] -- 0:00:14 919000 -- (-2632.567) (-2639.186) (-2636.108) [-2640.398] * (-2635.085) [-2634.303] (-2632.531) (-2635.904) -- 0:00:14 919500 -- (-2631.380) [-2633.645] (-2634.586) (-2630.596) * (-2641.374) [-2633.882] (-2633.318) (-2637.834) -- 0:00:14 920000 -- (-2646.638) (-2638.127) [-2636.512] (-2637.016) * [-2634.745] (-2637.673) (-2639.482) (-2634.412) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 920500 -- [-2641.337] (-2632.581) (-2632.534) (-2634.890) * (-2632.126) (-2634.804) [-2634.721] (-2639.640) -- 0:00:14 921000 -- (-2637.372) (-2638.103) [-2635.810] (-2638.610) * (-2638.714) (-2636.413) [-2635.362] (-2635.981) -- 0:00:13 921500 -- (-2638.439) [-2632.833] (-2636.787) (-2630.322) * (-2638.209) [-2639.487] (-2632.914) (-2630.466) -- 0:00:13 922000 -- (-2632.189) (-2630.930) [-2634.747] (-2636.130) * (-2640.282) (-2636.583) [-2635.429] (-2635.557) -- 0:00:13 922500 -- (-2638.085) (-2636.139) [-2633.829] (-2640.134) * (-2639.158) (-2633.047) [-2631.879] (-2637.984) -- 0:00:13 923000 -- (-2641.218) (-2633.823) (-2637.282) [-2637.174] * [-2635.986] (-2636.729) (-2635.665) (-2638.667) -- 0:00:13 923500 -- (-2632.791) (-2634.952) [-2637.404] (-2633.103) * [-2635.167] (-2638.325) (-2636.715) (-2638.084) -- 0:00:13 924000 -- [-2635.345] (-2631.595) (-2639.808) (-2640.419) * (-2638.000) (-2632.203) (-2636.468) [-2632.124] -- 0:00:13 924500 -- (-2638.245) [-2634.592] (-2640.511) (-2633.141) * (-2641.612) (-2639.003) (-2634.260) [-2635.084] -- 0:00:13 925000 -- (-2633.150) (-2632.051) (-2632.638) [-2634.580] * (-2634.884) (-2633.173) (-2634.431) [-2633.979] -- 0:00:13 Average standard deviation of split frequencies: 0.000000 925500 -- (-2635.062) [-2632.971] (-2631.837) (-2634.361) * [-2634.624] (-2636.406) (-2629.915) (-2631.552) -- 0:00:13 926000 -- (-2638.193) (-2640.360) (-2641.867) [-2641.909] * (-2633.769) (-2643.238) [-2633.112] (-2636.505) -- 0:00:13 926500 -- [-2631.788] (-2638.920) (-2639.537) (-2635.593) * (-2640.805) [-2638.229] (-2631.131) (-2638.245) -- 0:00:13 927000 -- (-2640.271) [-2631.804] (-2628.990) (-2636.562) * (-2636.486) (-2646.397) [-2637.325] (-2639.725) -- 0:00:12 927500 -- (-2643.619) (-2633.774) (-2638.960) [-2634.944] * (-2632.043) (-2633.544) [-2637.051] (-2634.484) -- 0:00:12 928000 -- (-2639.620) [-2632.495] (-2644.944) (-2637.039) * (-2641.060) (-2636.027) [-2641.518] (-2636.612) -- 0:00:12 928500 -- (-2644.246) (-2636.705) (-2635.315) [-2635.688] * [-2635.153] (-2638.371) (-2634.539) (-2635.583) -- 0:00:12 929000 -- (-2635.896) (-2640.585) (-2639.956) [-2632.732] * (-2635.541) (-2637.946) (-2637.975) [-2634.960] -- 0:00:12 929500 -- (-2638.842) [-2646.212] (-2632.054) (-2635.120) * (-2635.627) [-2636.327] (-2635.858) (-2641.131) -- 0:00:12 930000 -- (-2633.102) (-2638.218) (-2635.074) [-2634.040] * (-2640.856) (-2636.162) [-2635.590] (-2653.433) -- 0:00:12 Average standard deviation of split frequencies: 0.000000 930500 -- (-2635.361) (-2639.824) (-2635.661) [-2638.054] * (-2637.449) [-2635.557] (-2635.867) (-2640.885) -- 0:00:12 931000 -- (-2642.474) (-2635.058) [-2634.221] (-2636.729) * (-2633.450) [-2632.591] (-2639.697) (-2633.334) -- 0:00:12 931500 -- (-2636.629) [-2638.678] (-2638.472) (-2635.182) * (-2632.579) [-2629.706] (-2638.405) (-2642.006) -- 0:00:12 932000 -- [-2637.546] (-2634.446) (-2642.473) (-2632.066) * (-2629.393) [-2635.373] (-2631.221) (-2642.083) -- 0:00:12 932500 -- [-2641.978] (-2638.685) (-2634.491) (-2635.286) * (-2633.746) [-2631.305] (-2638.575) (-2633.981) -- 0:00:11 933000 -- (-2636.625) (-2635.598) [-2633.709] (-2637.151) * (-2634.120) [-2635.485] (-2636.246) (-2634.878) -- 0:00:11 933500 -- (-2634.959) [-2637.707] (-2638.039) (-2631.200) * (-2633.662) [-2632.842] (-2639.466) (-2636.649) -- 0:00:11 934000 -- (-2633.124) [-2632.940] (-2639.557) (-2636.346) * [-2635.112] (-2636.789) (-2637.218) (-2634.191) -- 0:00:11 934500 -- (-2637.430) (-2634.275) (-2638.692) [-2631.633] * (-2637.749) [-2634.027] (-2636.379) (-2633.720) -- 0:00:11 935000 -- (-2643.123) (-2633.651) [-2637.411] (-2632.117) * (-2638.655) [-2632.908] (-2638.889) (-2645.061) -- 0:00:11 Average standard deviation of split frequencies: 0.000000 935500 -- [-2634.064] (-2632.776) (-2634.512) (-2632.689) * (-2633.703) (-2633.806) (-2633.307) [-2634.683] -- 0:00:11 936000 -- (-2631.420) (-2638.377) [-2632.412] (-2636.704) * (-2634.129) (-2632.648) [-2636.423] (-2633.624) -- 0:00:11 936500 -- (-2632.789) (-2645.910) [-2637.179] (-2637.749) * [-2634.348] (-2636.093) (-2645.591) (-2633.566) -- 0:00:11 937000 -- (-2637.265) [-2632.700] (-2640.242) (-2636.036) * (-2634.768) [-2637.120] (-2637.125) (-2635.853) -- 0:00:11 937500 -- (-2631.871) [-2637.528] (-2633.809) (-2642.844) * (-2637.110) (-2642.021) (-2637.539) [-2638.665] -- 0:00:11 938000 -- [-2633.229] (-2647.549) (-2635.671) (-2640.036) * (-2635.086) (-2638.237) [-2635.197] (-2634.992) -- 0:00:10 938500 -- (-2633.216) (-2637.770) [-2643.864] (-2643.068) * [-2636.999] (-2634.477) (-2636.880) (-2636.926) -- 0:00:10 939000 -- (-2634.938) [-2634.086] (-2634.587) (-2632.295) * (-2642.896) (-2631.287) (-2635.414) [-2640.653] -- 0:00:10 939500 -- (-2647.115) [-2633.385] (-2637.536) (-2638.608) * (-2639.977) (-2633.922) (-2639.261) [-2638.001] -- 0:00:10 940000 -- (-2635.311) [-2629.748] (-2638.140) (-2635.186) * [-2638.448] (-2633.096) (-2635.453) (-2632.335) -- 0:00:10 Average standard deviation of split frequencies: 0.000000 940500 -- (-2632.153) (-2648.923) (-2634.858) [-2634.880] * (-2634.004) (-2631.270) (-2638.645) [-2636.857] -- 0:00:10 941000 -- (-2637.741) (-2639.135) (-2636.439) [-2634.933] * (-2632.238) (-2644.105) (-2640.956) [-2634.120] -- 0:00:10 941500 -- (-2639.331) (-2637.190) (-2639.276) [-2636.431] * (-2636.935) (-2641.806) (-2633.078) [-2631.868] -- 0:00:10 942000 -- (-2636.512) [-2635.709] (-2630.631) (-2631.198) * (-2635.301) (-2637.250) (-2634.634) [-2633.133] -- 0:00:10 942500 -- (-2635.338) [-2640.774] (-2632.839) (-2634.473) * (-2633.926) (-2639.835) (-2632.875) [-2639.348] -- 0:00:10 943000 -- (-2638.700) [-2633.002] (-2642.970) (-2634.664) * (-2638.738) [-2635.466] (-2636.105) (-2642.697) -- 0:00:10 943500 -- (-2633.974) (-2636.894) [-2637.689] (-2640.465) * [-2637.769] (-2641.540) (-2637.484) (-2638.443) -- 0:00:10 944000 -- (-2631.134) (-2638.988) (-2633.550) [-2633.625] * (-2635.804) (-2636.815) [-2641.642] (-2632.424) -- 0:00:09 944500 -- (-2638.948) [-2634.714] (-2629.596) (-2632.018) * (-2636.501) (-2643.573) (-2642.823) [-2630.218] -- 0:00:09 945000 -- [-2639.783] (-2639.674) (-2634.996) (-2636.280) * (-2629.241) (-2633.814) [-2637.083] (-2631.600) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 945500 -- (-2634.613) [-2634.832] (-2638.314) (-2635.818) * (-2636.399) [-2637.578] (-2639.578) (-2631.980) -- 0:00:09 946000 -- (-2640.261) (-2634.363) (-2634.826) [-2637.686] * (-2638.708) (-2634.673) (-2634.033) [-2632.571] -- 0:00:09 946500 -- (-2637.352) [-2637.180] (-2633.959) (-2637.580) * (-2642.422) (-2641.832) [-2635.980] (-2635.194) -- 0:00:09 947000 -- [-2640.947] (-2639.594) (-2636.061) (-2641.105) * [-2638.390] (-2631.424) (-2636.923) (-2637.536) -- 0:00:09 947500 -- [-2637.239] (-2632.327) (-2642.116) (-2636.434) * (-2633.028) (-2633.966) (-2638.705) [-2634.104] -- 0:00:09 948000 -- (-2637.596) [-2637.858] (-2634.701) (-2637.924) * (-2630.703) [-2637.014] (-2640.807) (-2632.163) -- 0:00:09 948500 -- (-2636.922) (-2634.677) (-2638.620) [-2629.066] * (-2635.132) (-2642.439) [-2634.662] (-2632.235) -- 0:00:09 949000 -- [-2632.076] (-2638.015) (-2642.516) (-2644.065) * (-2635.141) (-2635.269) [-2632.596] (-2632.211) -- 0:00:09 949500 -- (-2632.912) (-2637.658) [-2636.550] (-2637.686) * (-2635.625) [-2641.354] (-2636.284) (-2637.027) -- 0:00:08 950000 -- (-2632.964) (-2639.670) [-2637.364] (-2635.208) * (-2635.810) (-2637.692) (-2637.691) [-2639.623] -- 0:00:08 Average standard deviation of split frequencies: 0.000000 950500 -- (-2635.374) [-2635.014] (-2634.649) (-2639.017) * (-2634.356) (-2640.950) [-2636.361] (-2633.994) -- 0:00:08 951000 -- [-2633.248] (-2631.239) (-2633.394) (-2635.990) * (-2636.234) [-2639.704] (-2636.445) (-2632.958) -- 0:00:08 951500 -- (-2633.048) [-2631.552] (-2636.630) (-2637.542) * [-2634.552] (-2635.328) (-2636.239) (-2636.785) -- 0:00:08 952000 -- (-2635.703) (-2635.968) (-2631.303) [-2639.312] * (-2637.914) [-2633.007] (-2633.328) (-2635.357) -- 0:00:08 952500 -- (-2639.672) (-2633.625) (-2633.414) [-2635.842] * (-2640.063) [-2639.271] (-2638.557) (-2638.149) -- 0:00:08 953000 -- (-2636.335) [-2636.398] (-2633.318) (-2632.482) * (-2630.193) (-2638.856) [-2630.937] (-2640.156) -- 0:00:08 953500 -- (-2637.139) (-2631.452) [-2634.082] (-2630.517) * (-2636.909) (-2631.854) [-2629.976] (-2640.700) -- 0:00:08 954000 -- (-2633.980) [-2631.330] (-2637.966) (-2636.334) * (-2638.806) (-2640.007) [-2635.343] (-2636.211) -- 0:00:08 954500 -- [-2633.338] (-2637.063) (-2631.969) (-2637.506) * (-2638.081) [-2630.166] (-2633.631) (-2635.033) -- 0:00:08 955000 -- [-2630.405] (-2639.342) (-2637.385) (-2632.352) * (-2638.275) (-2638.027) (-2633.624) [-2635.339] -- 0:00:07 Average standard deviation of split frequencies: 0.000000 955500 -- [-2631.830] (-2638.045) (-2638.421) (-2634.281) * (-2644.680) (-2640.988) (-2634.577) [-2638.160] -- 0:00:07 956000 -- (-2642.013) (-2632.457) [-2635.639] (-2634.356) * (-2642.730) [-2634.516] (-2634.967) (-2633.398) -- 0:00:07 956500 -- (-2632.511) (-2638.762) [-2636.199] (-2640.829) * (-2642.969) [-2638.762] (-2636.148) (-2634.347) -- 0:00:07 957000 -- (-2633.306) [-2634.815] (-2636.925) (-2637.359) * (-2637.972) (-2642.031) (-2639.048) [-2633.357] -- 0:00:07 957500 -- [-2633.440] (-2639.472) (-2640.067) (-2643.722) * (-2632.996) (-2635.279) [-2639.175] (-2632.783) -- 0:00:07 958000 -- (-2635.267) [-2642.878] (-2633.721) (-2639.141) * (-2638.895) (-2639.676) [-2632.906] (-2640.983) -- 0:00:07 958500 -- [-2633.774] (-2640.883) (-2635.290) (-2637.698) * (-2637.268) (-2637.816) [-2636.401] (-2639.892) -- 0:00:07 959000 -- [-2635.063] (-2637.945) (-2640.241) (-2636.487) * (-2633.104) [-2634.779] (-2641.330) (-2637.860) -- 0:00:07 959500 -- (-2636.540) [-2635.548] (-2634.112) (-2637.137) * [-2633.883] (-2637.976) (-2634.532) (-2633.936) -- 0:00:07 960000 -- [-2634.325] (-2639.024) (-2641.746) (-2637.606) * (-2633.810) (-2639.518) (-2642.896) [-2631.419] -- 0:00:07 Average standard deviation of split frequencies: 0.000000 960500 -- [-2632.181] (-2631.438) (-2636.154) (-2637.302) * (-2632.864) (-2636.529) [-2632.315] (-2633.663) -- 0:00:06 961000 -- [-2634.879] (-2634.456) (-2642.979) (-2635.562) * (-2639.392) (-2632.607) [-2637.019] (-2636.709) -- 0:00:06 961500 -- (-2640.444) [-2634.248] (-2631.806) (-2635.778) * (-2635.686) (-2637.908) (-2636.053) [-2633.854] -- 0:00:06 962000 -- (-2640.311) [-2631.729] (-2639.987) (-2636.721) * (-2636.006) (-2637.173) (-2635.063) [-2635.754] -- 0:00:06 962500 -- (-2643.039) (-2636.964) [-2643.750] (-2635.569) * (-2632.233) (-2643.658) (-2644.031) [-2635.574] -- 0:00:06 963000 -- (-2636.208) (-2636.310) (-2641.960) [-2631.758] * [-2633.536] (-2638.798) (-2645.707) (-2637.742) -- 0:00:06 963500 -- (-2634.631) (-2645.238) (-2636.222) [-2637.412] * (-2643.517) (-2644.899) (-2630.865) [-2636.269] -- 0:00:06 964000 -- (-2637.368) [-2638.646] (-2634.992) (-2637.804) * (-2636.490) [-2634.370] (-2630.898) (-2641.371) -- 0:00:06 964500 -- (-2638.129) (-2631.275) [-2633.809] (-2636.647) * (-2637.775) [-2638.672] (-2640.711) (-2633.718) -- 0:00:06 965000 -- (-2636.386) (-2633.402) [-2634.048] (-2632.509) * (-2644.658) [-2636.016] (-2641.826) (-2636.046) -- 0:00:06 Average standard deviation of split frequencies: 0.000000 965500 -- (-2638.898) [-2632.108] (-2636.826) (-2635.123) * (-2639.017) (-2636.139) [-2633.087] (-2640.393) -- 0:00:06 966000 -- (-2643.331) (-2636.161) [-2640.454] (-2634.145) * [-2638.597] (-2640.596) (-2632.435) (-2634.421) -- 0:00:06 966500 -- (-2645.696) (-2639.540) (-2634.108) [-2631.327] * (-2641.149) (-2635.090) [-2633.045] (-2632.150) -- 0:00:05 967000 -- (-2638.117) (-2640.286) (-2640.306) [-2638.385] * (-2632.653) (-2641.890) (-2635.236) [-2634.480] -- 0:00:05 967500 -- [-2637.041] (-2633.685) (-2637.861) (-2632.487) * (-2639.026) [-2636.640] (-2641.275) (-2636.641) -- 0:00:05 968000 -- (-2631.999) (-2634.951) (-2638.504) [-2639.029] * (-2637.494) (-2638.221) (-2638.305) [-2634.469] -- 0:00:05 968500 -- [-2632.956] (-2641.039) (-2642.904) (-2639.464) * (-2636.370) (-2633.958) [-2636.267] (-2635.052) -- 0:00:05 969000 -- (-2636.218) [-2639.115] (-2641.735) (-2635.876) * (-2635.296) (-2634.810) [-2632.134] (-2642.574) -- 0:00:05 969500 -- (-2639.227) [-2636.941] (-2632.985) (-2630.884) * (-2636.955) (-2641.763) (-2632.856) [-2630.218] -- 0:00:05 970000 -- (-2637.413) (-2634.780) (-2634.681) [-2637.019] * (-2640.975) [-2633.673] (-2639.009) (-2631.385) -- 0:00:05 Average standard deviation of split frequencies: 0.000000 970500 -- (-2638.756) (-2636.979) (-2637.192) [-2635.787] * (-2640.039) (-2639.084) [-2632.093] (-2633.438) -- 0:00:05 971000 -- (-2636.994) (-2632.142) (-2647.130) [-2638.045] * (-2637.873) (-2637.500) (-2632.838) [-2634.267] -- 0:00:05 971500 -- (-2636.447) [-2632.115] (-2636.331) (-2643.565) * (-2637.245) [-2643.937] (-2636.874) (-2642.743) -- 0:00:05 972000 -- (-2633.126) [-2634.946] (-2645.044) (-2638.393) * (-2636.781) (-2637.686) [-2631.938] (-2637.051) -- 0:00:04 972500 -- (-2633.213) (-2637.933) (-2642.703) [-2633.230] * (-2634.208) [-2637.645] (-2633.017) (-2635.150) -- 0:00:04 973000 -- (-2630.441) (-2635.439) (-2633.716) [-2632.461] * [-2635.000] (-2634.922) (-2635.041) (-2633.372) -- 0:00:04 973500 -- [-2633.743] (-2644.884) (-2636.381) (-2641.621) * (-2633.212) [-2631.976] (-2630.612) (-2638.642) -- 0:00:04 974000 -- (-2635.736) (-2642.353) [-2637.741] (-2643.133) * (-2639.883) [-2636.973] (-2635.473) (-2641.326) -- 0:00:04 974500 -- (-2631.505) [-2634.726] (-2636.363) (-2635.189) * (-2636.196) [-2633.731] (-2633.799) (-2640.154) -- 0:00:04 975000 -- (-2635.585) [-2634.779] (-2641.720) (-2636.518) * (-2631.177) (-2633.533) (-2634.361) [-2644.068] -- 0:00:04 Average standard deviation of split frequencies: 0.000000 975500 -- (-2633.595) [-2632.905] (-2641.393) (-2640.169) * (-2637.562) (-2639.638) (-2632.963) [-2639.313] -- 0:00:04 976000 -- (-2634.343) [-2633.740] (-2638.628) (-2638.358) * (-2634.078) (-2637.588) (-2637.755) [-2633.716] -- 0:00:04 976500 -- (-2633.029) [-2634.311] (-2637.327) (-2643.422) * (-2638.230) (-2642.105) [-2634.552] (-2641.517) -- 0:00:04 977000 -- [-2631.659] (-2636.646) (-2634.888) (-2634.884) * (-2638.251) (-2640.601) (-2633.000) [-2633.987] -- 0:00:04 977500 -- (-2638.857) [-2630.211] (-2632.653) (-2635.592) * (-2637.599) (-2637.059) [-2632.829] (-2634.917) -- 0:00:03 978000 -- (-2633.162) (-2633.486) (-2632.736) [-2633.352] * (-2642.924) [-2631.185] (-2639.664) (-2635.454) -- 0:00:03 978500 -- (-2637.171) [-2636.318] (-2640.057) (-2636.543) * (-2646.125) (-2637.510) (-2634.036) [-2630.592] -- 0:00:03 979000 -- (-2634.396) (-2633.059) (-2636.047) [-2637.901] * [-2637.677] (-2635.490) (-2636.301) (-2637.093) -- 0:00:03 979500 -- (-2637.466) [-2638.865] (-2637.131) (-2634.372) * (-2634.932) [-2636.137] (-2636.547) (-2635.899) -- 0:00:03 980000 -- (-2644.191) [-2634.651] (-2638.579) (-2634.793) * [-2633.497] (-2639.583) (-2633.956) (-2635.781) -- 0:00:03 Average standard deviation of split frequencies: 0.000000 980500 -- (-2635.616) (-2633.924) (-2640.742) [-2636.838] * (-2634.956) [-2637.902] (-2631.788) (-2640.186) -- 0:00:03 981000 -- [-2640.810] (-2635.819) (-2636.353) (-2640.163) * (-2635.829) (-2633.238) (-2637.744) [-2637.525] -- 0:00:03 981500 -- (-2634.506) [-2635.927] (-2635.436) (-2633.745) * (-2638.179) (-2638.582) (-2637.499) [-2634.760] -- 0:00:03 982000 -- [-2640.309] (-2637.606) (-2636.678) (-2638.715) * [-2634.369] (-2639.456) (-2634.703) (-2633.960) -- 0:00:03 982500 -- (-2631.908) (-2637.082) [-2633.418] (-2639.791) * (-2636.818) [-2631.441] (-2633.288) (-2635.326) -- 0:00:03 983000 -- [-2631.283] (-2633.847) (-2635.874) (-2634.794) * [-2639.148] (-2638.480) (-2635.528) (-2635.641) -- 0:00:03 983500 -- (-2644.531) (-2640.125) [-2634.009] (-2639.330) * [-2637.149] (-2631.727) (-2639.640) (-2632.387) -- 0:00:02 984000 -- (-2640.012) (-2637.612) [-2635.115] (-2638.279) * [-2633.147] (-2636.943) (-2638.487) (-2632.127) -- 0:00:02 984500 -- (-2640.962) (-2631.210) [-2633.323] (-2639.965) * [-2635.853] (-2636.807) (-2630.298) (-2634.880) -- 0:00:02 985000 -- (-2640.337) (-2634.281) [-2631.018] (-2634.166) * (-2636.514) (-2637.440) (-2633.392) [-2631.527] -- 0:00:02 Average standard deviation of split frequencies: 0.000000 985500 -- (-2637.320) [-2635.860] (-2638.592) (-2632.479) * (-2637.621) (-2635.236) [-2632.689] (-2638.330) -- 0:00:02 986000 -- (-2632.807) (-2639.856) [-2638.329] (-2638.395) * (-2642.182) (-2645.105) [-2630.724] (-2637.465) -- 0:00:02 986500 -- (-2632.336) (-2639.071) (-2638.700) [-2637.601] * [-2635.919] (-2634.855) (-2644.909) (-2637.146) -- 0:00:02 987000 -- [-2636.083] (-2635.588) (-2635.391) (-2638.112) * (-2634.175) (-2638.332) [-2634.435] (-2638.671) -- 0:00:02 987500 -- (-2639.710) (-2640.880) [-2636.575] (-2632.607) * (-2638.097) [-2633.103] (-2635.815) (-2633.847) -- 0:00:02 988000 -- (-2642.641) (-2638.832) (-2638.426) [-2632.562] * (-2637.459) (-2637.889) [-2632.809] (-2637.452) -- 0:00:02 988500 -- (-2641.298) [-2632.242] (-2640.351) (-2644.411) * (-2634.768) [-2634.658] (-2639.218) (-2637.782) -- 0:00:02 989000 -- (-2638.482) [-2634.183] (-2638.694) (-2632.572) * (-2632.052) [-2641.085] (-2640.356) (-2636.096) -- 0:00:01 989500 -- (-2632.829) (-2636.657) (-2633.488) [-2636.235] * (-2631.170) [-2634.456] (-2633.039) (-2631.911) -- 0:00:01 990000 -- (-2636.677) [-2632.363] (-2641.356) (-2637.559) * (-2631.169) (-2636.071) [-2638.078] (-2637.482) -- 0:00:01 Average standard deviation of split frequencies: 0.000000 990500 -- [-2632.013] (-2641.530) (-2637.674) (-2638.940) * (-2639.430) (-2629.593) [-2635.337] (-2633.248) -- 0:00:01 991000 -- (-2636.010) (-2635.136) (-2630.238) [-2634.711] * [-2631.545] (-2650.552) (-2636.571) (-2635.381) -- 0:00:01 991500 -- (-2643.346) [-2632.733] (-2631.518) (-2633.725) * (-2634.553) [-2634.553] (-2635.429) (-2633.891) -- 0:00:01 992000 -- [-2634.641] (-2639.685) (-2639.158) (-2634.232) * (-2639.013) (-2643.512) [-2634.528] (-2634.254) -- 0:00:01 992500 -- (-2647.795) (-2638.153) (-2632.837) [-2635.928] * (-2637.412) (-2652.688) (-2634.991) [-2630.572] -- 0:00:01 993000 -- (-2637.553) (-2637.611) (-2636.497) [-2632.047] * (-2634.650) (-2635.007) [-2638.289] (-2636.531) -- 0:00:01 993500 -- (-2635.950) (-2637.827) [-2635.651] (-2631.728) * (-2636.856) [-2633.788] (-2635.344) (-2637.428) -- 0:00:01 994000 -- (-2638.110) (-2638.034) [-2634.003] (-2637.796) * [-2635.582] (-2633.175) (-2630.591) (-2639.344) -- 0:00:01 994500 -- (-2637.742) (-2636.402) [-2639.458] (-2634.209) * (-2645.513) (-2644.730) [-2633.484] (-2636.361) -- 0:00:00 995000 -- (-2637.318) [-2635.002] (-2634.514) (-2638.529) * [-2633.163] (-2635.434) (-2640.912) (-2636.325) -- 0:00:00 Average standard deviation of split frequencies: 0.000000 995500 -- (-2636.700) (-2632.372) [-2633.654] (-2636.839) * (-2642.434) (-2642.866) [-2637.464] (-2635.345) -- 0:00:00 996000 -- (-2633.114) (-2632.923) (-2637.132) [-2635.415] * (-2634.101) (-2636.022) (-2638.036) [-2637.014] -- 0:00:00 996500 -- [-2634.244] (-2641.887) (-2634.083) (-2646.001) * (-2637.083) (-2639.903) [-2633.295] (-2635.878) -- 0:00:00 997000 -- (-2632.522) [-2641.403] (-2632.945) (-2638.196) * (-2631.946) (-2641.074) (-2637.082) [-2635.354] -- 0:00:00 997500 -- (-2634.289) (-2638.911) [-2632.120] (-2638.735) * [-2634.181] (-2634.105) (-2636.042) (-2639.564) -- 0:00:00 998000 -- (-2636.923) (-2635.701) [-2635.706] (-2631.854) * [-2629.957] (-2636.634) (-2633.317) (-2635.517) -- 0:00:00 998500 -- (-2632.270) (-2637.142) [-2633.033] (-2634.504) * [-2634.340] (-2634.659) (-2634.759) (-2633.991) -- 0:00:00 999000 -- (-2636.986) (-2634.928) [-2640.998] (-2634.545) * (-2632.560) (-2630.605) [-2635.442] (-2643.283) -- 0:00:00 999500 -- [-2637.217] (-2634.987) (-2634.326) (-2635.924) * (-2633.476) (-2637.710) (-2644.489) [-2636.642] -- 0:00:00 1000000 -- [-2633.858] (-2641.242) (-2633.620) (-2636.485) * (-2633.847) (-2635.962) [-2635.445] (-2634.510) -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2633.858413 -- 10.690940 Chain 1 -- -2633.858413 -- 10.690940 Chain 2 -- -2641.241861 -- 6.866664 Chain 2 -- -2641.241861 -- 6.866664 Chain 3 -- -2633.620142 -- 9.062810 Chain 3 -- -2633.620142 -- 9.062810 Chain 4 -- -2636.484981 -- 13.030743 Chain 4 -- -2636.484981 -- 13.030743 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2633.846868 -- 13.273386 Chain 1 -- -2633.846868 -- 13.273386 Chain 2 -- -2635.962229 -- 12.547649 Chain 2 -- -2635.962229 -- 12.547649 Chain 3 -- -2635.444876 -- 13.736626 Chain 3 -- -2635.444876 -- 13.736626 Chain 4 -- -2634.510140 -- 11.243267 Chain 4 -- -2634.510140 -- 11.243267 Analysis completed in 2 mins 57 seconds Analysis used 177.58 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2627.43 Likelihood of best state for "cold" chain of run 2 was -2627.52 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 47.3 % ( 35 %) Dirichlet(Revmat{all}) 59.3 % ( 40 %) Slider(Revmat{all}) 24.2 % ( 27 %) Dirichlet(Pi{all}) 26.2 % ( 29 %) Slider(Pi{all}) 58.6 % ( 30 %) Multiplier(Alpha{1,2}) 42.9 % ( 29 %) Multiplier(Alpha{3}) 57.6 % ( 36 %) Slider(Pinvar{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 29 %) Multiplier(V{all}) 21.1 % ( 20 %) Nodeslider(V{all}) 25.7 % ( 34 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 45.8 % ( 29 %) Dirichlet(Revmat{all}) 60.3 % ( 39 %) Slider(Revmat{all}) 24.5 % ( 28 %) Dirichlet(Pi{all}) 25.9 % ( 28 %) Slider(Pi{all}) 59.3 % ( 27 %) Multiplier(Alpha{1,2}) 43.3 % ( 23 %) Multiplier(Alpha{3}) 57.1 % ( 29 %) Slider(Pinvar{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.8 % ( 30 %) Multiplier(V{all}) 21.1 % ( 19 %) Nodeslider(V{all}) 25.2 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.85 0.71 0.60 2 | 166343 0.86 0.74 3 | 166340 166918 0.87 4 | 166673 166577 167149 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.85 0.72 0.60 2 | 166401 0.86 0.74 3 | 166544 167250 0.87 4 | 166526 166411 166868 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2634.00 | 1 1 | | | | 2 11 1 2 1 1 | |21* 1 1 2 2| | 2 11 2 1 2 2 1 22 221| | 2 11 1 2 2 2 2 111 1 2 1 | | 2 1 2 * 2122 2 2 1 2 21 | | 22 1 2 2 1 * 2 11 2 21 22 11 | | 2 1 2 11 2 2 2 2 1 2 1 | | 2 1 2 1 1 22 2 2 1 1 1 1 | | 2 2 2 1 2 12 | | 11 2 1 2 | | 1 | |1 1 1 | | 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2637.11 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2632.69 -2642.17 2 -2632.80 -2643.27 -------------------------------------- TOTAL -2632.74 -2642.86 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.292868 0.001361 0.224653 0.367981 0.289951 986.92 1073.57 1.000 r(A<->C){all} 0.050930 0.000446 0.009480 0.091528 0.049243 828.56 962.88 1.000 r(A<->G){all} 0.230984 0.001446 0.160011 0.307104 0.229374 943.49 980.67 1.001 r(A<->T){all} 0.196709 0.001489 0.124742 0.274732 0.194372 960.58 1031.38 1.000 r(C<->G){all} 0.074950 0.000425 0.036467 0.114605 0.072965 1077.02 1146.95 1.000 r(C<->T){all} 0.401968 0.002854 0.293142 0.498728 0.400924 859.86 899.34 1.001 r(G<->T){all} 0.044459 0.000424 0.007163 0.084166 0.041969 956.47 1055.02 1.000 pi(A){all} 0.304265 0.000159 0.280239 0.329815 0.304430 1079.01 1092.81 1.000 pi(C){all} 0.240237 0.000140 0.217410 0.262573 0.240090 1243.29 1305.74 1.000 pi(G){all} 0.268793 0.000150 0.245567 0.293464 0.268783 1224.14 1362.57 1.001 pi(T){all} 0.186705 0.000114 0.167092 0.207413 0.186623 1244.13 1295.38 1.000 alpha{1,2} 0.058569 0.001669 0.000154 0.133288 0.052753 885.29 1193.14 1.000 alpha{3} 2.072164 0.644669 0.758400 3.715849 1.941542 1269.79 1293.13 1.000 pinvar{all} 0.292851 0.009272 0.079044 0.459891 0.302357 1125.25 1200.08 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 Key to taxon bipartitions (saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------- 1 -- .*** 2 -- .*.. 3 -- ..*. 4 -- ...* 5 -- ..** ---------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 5 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.036727 0.000063 0.022244 0.052966 0.036002 1.000 2 length{all}[2] 0.009880 0.000020 0.002004 0.018468 0.009311 1.000 2 length{all}[3] 0.085038 0.000270 0.054510 0.116854 0.083894 1.001 2 length{all}[4] 0.099590 0.000373 0.063106 0.135271 0.097971 1.000 2 length{all}[5] 0.061634 0.000205 0.036049 0.089284 0.060279 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) + | /------------------------------------ C3 (3) \----------------100----------------+ \------------------------------------ C4 (4) Phylogram (based on average branch lengths): /---------------- C1 (1) | |---- C2 (2) + | /--------------------------------------- C3 (3) \--------------------------+ \--------------------------------------------- C4 (4) |--------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 4 ls = 1185 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Sequences read.. Counting site patterns.. 0:00 203 patterns at 395 / 395 sites (100.0%), 0:00 Counting codons.. 48 bytes for distance 198128 bytes for conP 27608 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, (3, 4)); MP score: 197 0.077228 0.026667 0.119308 0.156959 0.168432 0.300000 1.300000 ntime & nrate & np: 5 2 7 Bounds (np=7): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 7 lnL0 = -2729.364924 Iterating by ming2 Initial: fx= 2729.364924 x= 0.07723 0.02667 0.11931 0.15696 0.16843 0.30000 1.30000 1 h-m-p 0.0000 0.0138 275.8542 +++++CCCC 2602.024583 3 0.0092 23 | 0/7 2 h-m-p 0.0003 0.0014 1225.7742 CCYCC 2596.547207 4 0.0001 40 | 0/7 3 h-m-p 0.0002 0.0009 364.3808 YCYCCC 2579.771312 5 0.0005 58 | 0/7 4 h-m-p 0.0002 0.0012 361.1611 CCCCC 2572.244016 4 0.0003 76 | 0/7 5 h-m-p 0.0007 0.0035 117.5533 CCCCC 2567.470296 4 0.0009 94 | 0/7 6 h-m-p 0.0004 0.0021 227.1237 CYCYCC 2556.940039 5 0.0010 113 | 0/7 7 h-m-p 0.0018 0.0089 23.2165 CCC 2556.840320 2 0.0004 127 | 0/7 8 h-m-p 0.0820 8.0000 0.1139 ++CYCC 2553.362638 3 1.0088 144 | 0/7 9 h-m-p 1.4316 7.1578 0.0775 YYCC 2552.864885 3 0.9541 165 | 0/7 10 h-m-p 0.5881 4.7785 0.1257 YCCC 2552.132554 3 1.3568 187 | 0/7 11 h-m-p 1.1281 8.0000 0.1512 YCCC 2550.748012 3 2.8472 209 | 0/7 12 h-m-p 1.5946 8.0000 0.2700 YYYC 2549.510164 3 1.4970 229 | 0/7 13 h-m-p 1.6000 8.0000 0.0919 YC 2549.405412 1 0.7714 247 | 0/7 14 h-m-p 1.6000 8.0000 0.0281 YC 2549.397642 1 1.0272 265 | 0/7 15 h-m-p 1.6000 8.0000 0.0028 YC 2549.397184 1 1.0138 283 | 0/7 16 h-m-p 1.6000 8.0000 0.0002 Y 2549.397152 0 1.0080 300 | 0/7 17 h-m-p 1.6000 8.0000 0.0000 Y 2549.397152 0 1.2473 317 | 0/7 18 h-m-p 1.6000 8.0000 0.0000 Y 2549.397152 0 1.0624 334 | 0/7 19 h-m-p 1.6000 8.0000 0.0000 Y 2549.397152 0 2.8402 351 | 0/7 20 h-m-p 1.5643 8.0000 0.0000 Y 2549.397152 0 1.5643 368 | 0/7 21 h-m-p 1.6000 8.0000 0.0000 -Y 2549.397152 0 0.1000 386 Out.. lnL = -2549.397152 387 lfun, 387 eigenQcodon, 1935 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, (3, 4)); MP score: 197 0.077228 0.026667 0.119308 0.156959 0.168432 1.862929 0.755520 0.234606 ntime & nrate & np: 5 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.068921 np = 8 lnL0 = -2555.678169 Iterating by ming2 Initial: fx= 2555.678169 x= 0.07723 0.02667 0.11931 0.15696 0.16843 1.86293 0.75552 0.23461 1 h-m-p 0.0000 0.0034 95.5578 +++YCYCCC 2547.788264 5 0.0015 24 | 0/8 2 h-m-p 0.0001 0.0005 353.2352 YCYC 2546.917606 3 0.0001 39 | 0/8 3 h-m-p 0.0004 0.0025 63.8298 YYC 2546.447230 2 0.0003 52 | 0/8 4 h-m-p 0.0011 0.0112 18.8074 YCC 2546.327188 2 0.0008 66 | 0/8 5 h-m-p 0.0009 0.0095 16.6349 YCCC 2546.169990 3 0.0018 82 | 0/8 6 h-m-p 0.0042 0.0218 6.9912 YC 2546.159108 1 0.0006 94 | 0/8 7 h-m-p 0.0054 2.6855 1.1484 ++CCC 2545.951925 2 0.1314 111 | 0/8 8 h-m-p 0.0064 0.0346 23.7112 YC 2545.924563 1 0.0008 123 | 0/8 9 h-m-p 0.0447 4.6403 0.4431 +YCCC 2545.598261 3 0.3891 140 | 0/8 10 h-m-p 1.6000 8.0000 0.0027 YC 2545.585598 1 1.0769 160 | 0/8 11 h-m-p 0.9105 8.0000 0.0032 C 2545.585257 0 0.9520 179 | 0/8 12 h-m-p 1.6000 8.0000 0.0007 Y 2545.585252 0 1.0678 198 | 0/8 13 h-m-p 1.6000 8.0000 0.0001 Y 2545.585251 0 1.0866 217 | 0/8 14 h-m-p 1.6000 8.0000 0.0000 Y 2545.585251 0 0.9724 236 | 0/8 15 h-m-p 1.6000 8.0000 0.0000 C 2545.585251 0 0.4000 255 | 0/8 16 h-m-p 0.8487 8.0000 0.0000 ----C 2545.585251 0 0.0009 278 Out.. lnL = -2545.585251 279 lfun, 837 eigenQcodon, 2790 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, (3, 4)); MP score: 197 initial w for M2:NSpselection reset. 0.077228 0.026667 0.119308 0.156959 0.168432 1.878477 1.079469 0.409056 0.257593 2.430889 ntime & nrate & np: 5 3 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.941483 np = 10 lnL0 = -2583.574909 Iterating by ming2 Initial: fx= 2583.574909 x= 0.07723 0.02667 0.11931 0.15696 0.16843 1.87848 1.07947 0.40906 0.25759 2.43089 1 h-m-p 0.0000 0.0054 99.2368 +++CYCCC 2580.086022 4 0.0008 25 | 0/10 2 h-m-p 0.0001 0.0007 175.3472 YCYCCC 2577.500655 5 0.0003 46 | 0/10 3 h-m-p 0.0002 0.0008 252.9561 +CYC 2570.323645 2 0.0007 63 | 0/10 4 h-m-p 0.0000 0.0002 188.6013 ++ 2569.047716 m 0.0002 76 | 1/10 5 h-m-p 0.0008 0.0455 21.7639 +YCCC 2568.596010 3 0.0023 95 | 1/10 6 h-m-p 0.0017 0.0661 29.7357 ++YYCCC 2563.741274 4 0.0214 116 | 0/10 7 h-m-p 0.0014 0.0070 197.3446 CYCC 2562.214522 3 0.0012 134 | 0/10 8 h-m-p 0.0018 0.0090 64.3295 YCCC 2560.858333 3 0.0033 152 | 0/10 9 h-m-p 0.0017 0.0083 100.4689 ++ 2554.494031 m 0.0083 165 | 1/10 10 h-m-p 0.3822 2.0201 1.4080 CCCCC 2551.448595 4 0.5003 186 | 1/10 11 h-m-p 0.5525 4.0810 1.2750 CCC 2549.949901 2 0.5741 203 | 1/10 12 h-m-p 0.7699 3.8494 0.9280 YYCCC 2548.294299 4 0.6016 222 | 1/10 13 h-m-p 1.0698 7.2747 0.5218 CCC 2547.286465 2 0.9522 248 | 1/10 14 h-m-p 1.6000 8.0000 0.1880 CCC 2546.110280 2 2.2314 274 | 1/10 15 h-m-p 1.6000 8.0000 0.2496 YCCC 2545.694640 3 1.0334 301 | 1/10 16 h-m-p 1.6000 8.0000 0.1472 YCC 2545.607867 2 0.7117 326 | 1/10 17 h-m-p 1.6000 8.0000 0.0565 YC 2545.587559 1 1.2331 349 | 1/10 18 h-m-p 1.6000 8.0000 0.0226 YC 2545.585485 1 0.9667 372 | 1/10 19 h-m-p 1.6000 8.0000 0.0054 YC 2545.585275 1 0.7318 395 | 1/10 20 h-m-p 1.6000 8.0000 0.0008 Y 2545.585252 0 1.2056 417 | 1/10 21 h-m-p 1.6000 8.0000 0.0002 Y 2545.585251 0 1.0134 439 | 1/10 22 h-m-p 1.6000 8.0000 0.0000 Y 2545.585251 0 0.7547 461 | 1/10 23 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/10 24 h-m-p 0.0160 8.0000 0.0002 --C 2545.585251 0 0.0003 521 | 1/10 25 h-m-p 0.0160 8.0000 0.0002 -------C 2545.585251 0 0.0000 550 Out.. lnL = -2545.585251 551 lfun, 2204 eigenQcodon, 8265 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2554.333274 S = -2395.461241 -150.369103 Calculating f(w|X), posterior probabilities of site classes. did 10 / 203 patterns 0:06 did 20 / 203 patterns 0:06 did 30 / 203 patterns 0:06 did 40 / 203 patterns 0:06 did 50 / 203 patterns 0:06 did 60 / 203 patterns 0:06 did 70 / 203 patterns 0:06 did 80 / 203 patterns 0:06 did 90 / 203 patterns 0:06 did 100 / 203 patterns 0:06 did 110 / 203 patterns 0:06 did 120 / 203 patterns 0:07 did 130 / 203 patterns 0:07 did 140 / 203 patterns 0:07 did 150 / 203 patterns 0:07 did 160 / 203 patterns 0:07 did 170 / 203 patterns 0:07 did 180 / 203 patterns 0:07 did 190 / 203 patterns 0:07 did 200 / 203 patterns 0:07 did 203 / 203 patterns 0:07 Time used: 0:07 Model 3: discrete TREE # 1 (1, 2, (3, 4)); MP score: 197 0.077228 0.026667 0.119308 0.156959 0.168432 1.878477 0.408838 0.998206 0.106470 0.231382 0.350049 ntime & nrate & np: 5 4 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 11.309075 np = 11 lnL0 = -2548.618930 Iterating by ming2 Initial: fx= 2548.618930 x= 0.07723 0.02667 0.11931 0.15696 0.16843 1.87848 0.40884 0.99821 0.10647 0.23138 0.35005 1 h-m-p 0.0000 0.0014 40.7017 ++CCCC 2548.405719 3 0.0002 24 | 0/11 2 h-m-p 0.0001 0.0038 71.1165 YCCC 2548.169100 3 0.0002 43 | 0/11 3 h-m-p 0.0009 0.0063 17.1523 ++ 2547.363527 m 0.0063 57 | 1/11 4 h-m-p 0.0007 0.0119 67.0517 YCCC 2547.072717 3 0.0015 76 | 1/11 5 h-m-p 0.0006 0.0043 166.0186 CCCC 2546.692525 3 0.0008 96 | 1/11 6 h-m-p 0.0180 0.1218 7.0072 -YC 2546.684190 1 0.0006 112 | 0/11 7 h-m-p 0.0014 0.6980 12.2887 YCCC 2546.479292 3 0.0029 131 | 0/11 8 h-m-p 0.0019 0.0138 19.2548 CYC 2546.286172 2 0.0023 148 | 0/11 9 h-m-p 0.0431 1.1640 1.0225 +CCCC 2545.778292 3 0.2941 169 | 0/11 10 h-m-p 1.4928 7.4642 0.1129 YCCC 2545.595948 3 0.6388 188 | 0/11 11 h-m-p 0.1718 6.0473 0.4199 YC 2545.580957 1 0.1302 214 | 0/11 12 h-m-p 0.3155 8.0000 0.1732 YC 2545.576822 1 0.1958 240 | 0/11 13 h-m-p 1.6000 8.0000 0.0210 YC 2545.574341 1 0.7859 266 | 0/11 14 h-m-p 0.9853 8.0000 0.0168 YC 2545.573872 1 0.4444 292 | 0/11 15 h-m-p 0.5668 8.0000 0.0131 ++ 2545.571228 m 8.0000 317 | 0/11 16 h-m-p 0.8395 8.0000 0.1253 +YCC 2545.564670 2 2.6233 346 | 0/11 17 h-m-p 1.6000 8.0000 0.0261 YC 2545.563769 1 1.0939 372 | 0/11 18 h-m-p 1.1308 8.0000 0.0252 C 2545.563667 0 0.9378 397 | 0/11 19 h-m-p 1.6000 8.0000 0.0071 C 2545.563630 0 1.7381 422 | 0/11 20 h-m-p 1.6000 8.0000 0.0010 ++ 2545.563545 m 8.0000 447 | 0/11 21 h-m-p 1.2185 8.0000 0.0067 YC 2545.563271 1 3.0006 473 | 0/11 22 h-m-p 1.6000 8.0000 0.0107 Y 2545.563094 0 1.6000 498 | 0/11 23 h-m-p 1.6000 8.0000 0.0028 C 2545.563059 0 0.6202 523 | 0/11 24 h-m-p 0.1605 8.0000 0.0109 +Y 2545.563037 0 1.3834 549 | 0/11 25 h-m-p 1.6000 8.0000 0.0068 C 2545.563026 0 1.6615 574 | 0/11 26 h-m-p 1.6000 8.0000 0.0005 Y 2545.563025 0 1.0884 599 | 0/11 27 h-m-p 1.0173 8.0000 0.0005 C 2545.563025 0 0.8891 624 | 0/11 28 h-m-p 1.6000 8.0000 0.0001 Y 2545.563025 0 1.0888 649 | 0/11 29 h-m-p 1.6000 8.0000 0.0000 Y 2545.563025 0 0.7723 674 | 0/11 30 h-m-p 1.6000 8.0000 0.0000 Y 2545.563025 0 1.6000 699 | 0/11 31 h-m-p 1.6000 8.0000 0.0000 ------Y 2545.563025 0 0.0001 730 Out.. lnL = -2545.563025 731 lfun, 2924 eigenQcodon, 10965 P(t) Time used: 0:12 Model 7: beta TREE # 1 (1, 2, (3, 4)); MP score: 197 0.077228 0.026667 0.119308 0.156959 0.168432 1.875153 0.996708 1.805788 ntime & nrate & np: 5 1 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 8.895768 np = 8 lnL0 = -2551.916653 Iterating by ming2 Initial: fx= 2551.916653 x= 0.07723 0.02667 0.11931 0.15696 0.16843 1.87515 0.99671 1.80579 1 h-m-p 0.0000 0.0022 41.7682 +++YCC 2551.538494 2 0.0004 19 | 0/8 2 h-m-p 0.0002 0.0174 94.2755 CYC 2551.310947 2 0.0002 33 | 0/8 3 h-m-p 0.0004 0.0087 31.7112 +YYCC 2550.845970 3 0.0014 49 | 0/8 4 h-m-p 0.0003 0.0065 164.7164 +YCYCCC 2546.175186 5 0.0024 69 | 0/8 5 h-m-p 0.0026 0.0130 58.4856 YCC 2545.943441 2 0.0005 83 | 0/8 6 h-m-p 0.0039 0.0242 7.3749 YC 2545.930847 1 0.0005 95 | 0/8 7 h-m-p 0.0054 2.7151 0.7634 ++YCC 2545.851060 2 0.1686 111 | 0/8 8 h-m-p 0.3021 8.0000 0.4259 YCC 2545.794884 2 0.1839 133 | 0/8 9 h-m-p 0.3378 8.0000 0.2318 YC 2545.715015 1 0.6876 153 | 0/8 10 h-m-p 1.2285 8.0000 0.1298 +YYCC 2545.622581 3 4.0135 177 | 0/8 11 h-m-p 1.6000 8.0000 0.0174 YC 2545.617912 1 0.9233 197 | 0/8 12 h-m-p 1.6000 8.0000 0.0080 CC 2545.617537 1 0.6148 218 | 0/8 13 h-m-p 1.6000 8.0000 0.0027 Y 2545.617533 0 0.8317 237 | 0/8 14 h-m-p 1.6000 8.0000 0.0008 Y 2545.617532 0 0.7758 256 | 0/8 15 h-m-p 1.6000 8.0000 0.0000 Y 2545.617532 0 1.0388 275 | 0/8 16 h-m-p 1.6000 8.0000 0.0000 Y 2545.617532 0 1.6000 294 | 0/8 17 h-m-p 1.6000 8.0000 0.0000 ------Y 2545.617532 0 0.0001 319 Out.. lnL = -2545.617532 320 lfun, 3520 eigenQcodon, 16000 P(t) Time used: 0:19 Model 8: beta&w>1 TREE # 1 (1, 2, (3, 4)); MP score: 197 initial w for M8:NSbetaw>1 reset. 0.077228 0.026667 0.119308 0.156959 0.168432 1.876023 0.900000 0.709770 1.329016 2.821721 ntime & nrate & np: 5 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.453605 np = 10 lnL0 = -2564.160143 Iterating by ming2 Initial: fx= 2564.160143 x= 0.07723 0.02667 0.11931 0.15696 0.16843 1.87602 0.90000 0.70977 1.32902 2.82172 1 h-m-p 0.0000 0.0006 185.2515 +++ 2552.621908 m 0.0006 16 | 1/10 2 h-m-p 0.0002 0.0009 69.0957 CCCCC 2552.163021 4 0.0002 37 | 1/10 3 h-m-p 0.0004 0.0060 47.2633 +YCCC 2551.491135 3 0.0009 56 | 1/10 4 h-m-p 0.0006 0.0102 74.1770 +YYCC 2549.437718 3 0.0021 74 | 1/10 5 h-m-p 0.0007 0.0034 174.1463 YYYC 2548.062402 3 0.0006 90 | 1/10 6 h-m-p 0.0115 0.0574 7.9852 -YC 2548.022694 1 0.0013 105 | 0/10 7 h-m-p 0.0002 0.0189 53.7201 CYC 2547.736353 2 0.0002 121 | 0/10 8 h-m-p 0.0024 0.2354 4.8798 +++YCCC 2546.653835 3 0.1105 142 | 0/10 9 h-m-p 0.0718 0.3590 2.7128 +CCC 2545.765593 2 0.2641 160 | 0/10 10 h-m-p 0.1598 0.7992 0.5793 YCCC 2545.664521 3 0.3477 178 | 0/10 11 h-m-p 1.6000 8.0000 0.0992 YC 2545.622438 1 0.6609 202 | 0/10 12 h-m-p 1.6000 8.0000 0.0151 CY 2545.612052 1 1.7185 227 | 0/10 13 h-m-p 1.2091 8.0000 0.0214 CC 2545.611128 1 0.9810 252 | 0/10 14 h-m-p 1.6000 8.0000 0.0061 C 2545.610992 0 1.7630 275 | 0/10 15 h-m-p 1.2914 8.0000 0.0083 ++ 2545.610152 m 8.0000 298 | 0/10 16 h-m-p 0.6226 5.9960 0.1069 +CCC 2545.606832 2 2.6944 326 | 0/10 17 h-m-p 0.9630 4.8149 0.0723 CC 2545.605530 1 1.2337 351 | 0/10 18 h-m-p 0.9706 8.0000 0.0919 YC 2545.605214 1 0.4734 375 | 0/10 19 h-m-p 1.6000 8.0000 0.0152 ++ 2545.604013 m 8.0000 398 | 0/10 20 h-m-p 1.6000 8.0000 0.0321 YC 2545.603060 1 2.8607 422 | 0/10 21 h-m-p 0.3503 1.7514 0.0965 YC 2545.602584 1 0.7574 446 | 0/10 22 h-m-p 0.6804 3.4021 0.0915 CC 2545.601621 1 1.0045 471 | 0/10 23 h-m-p 0.4269 2.1347 0.0699 ++ 2545.600001 m 2.1347 494 | 0/10 24 h-m-p 0.8097 8.0000 0.1842 YC 2545.598924 1 0.5468 518 | 0/10 25 h-m-p 0.0259 0.1295 0.2836 ++ 2545.598572 m 0.1295 541 | 1/10 26 h-m-p 0.0811 1.7845 0.4356 YC 2545.598513 1 0.0489 565 | 1/10 27 h-m-p 0.1355 8.0000 0.1572 +YC 2545.596803 1 1.3070 589 | 1/10 28 h-m-p 1.4782 8.0000 0.1390 CCC 2545.593327 2 2.4523 615 | 1/10 29 h-m-p 1.6000 8.0000 0.1364 CC 2545.590078 1 1.3783 639 | 1/10 30 h-m-p 0.4590 8.0000 0.4095 YCC 2545.587779 2 0.9181 664 | 1/10 31 h-m-p 1.6000 8.0000 0.1667 CC 2545.585537 1 2.3168 688 | 1/10 32 h-m-p 1.6000 8.0000 0.1060 YC 2545.583746 1 3.2714 711 | 1/10 33 h-m-p 0.6916 8.0000 0.5014 YY 2545.582962 1 0.6484 734 | 1/10 34 h-m-p 0.9953 8.0000 0.3267 YC 2545.581300 1 1.6209 757 | 1/10 35 h-m-p 1.6000 8.0000 0.1225 YC 2545.580147 1 2.4442 780 | 1/10 36 h-m-p 0.3648 8.0000 0.8207 CC 2545.579429 1 0.6334 804 | 1/10 37 h-m-p 1.6000 8.0000 0.3103 C 2545.579078 0 1.6000 826 | 1/10 38 h-m-p 1.6000 8.0000 0.1447 C 2545.578747 0 1.6000 848 | 1/10 39 h-m-p 0.4374 8.0000 0.5292 +Y 2545.578411 0 1.2692 871 | 1/10 40 h-m-p 1.6000 8.0000 0.4170 C 2545.578225 0 1.6320 893 | 1/10 41 h-m-p 1.6000 8.0000 0.1696 C 2545.578135 0 1.3366 915 | 1/10 42 h-m-p 0.4872 8.0000 0.4654 Y 2545.578088 0 0.8421 937 | 1/10 43 h-m-p 1.6000 8.0000 0.1497 C 2545.578082 0 1.5672 959 | 1/10 44 h-m-p 1.6000 8.0000 0.0177 C 2545.578080 0 1.4978 981 | 1/10 45 h-m-p 0.7654 8.0000 0.0347 +C 2545.578078 0 3.1312 1004 | 1/10 46 h-m-p 1.6000 8.0000 0.0043 C 2545.578077 0 1.4742 1026 | 1/10 47 h-m-p 1.3911 8.0000 0.0045 Y 2545.578077 0 1.0692 1048 | 1/10 48 h-m-p 1.6000 8.0000 0.0013 Y 2545.578077 0 1.1429 1070 | 1/10 49 h-m-p 1.6000 8.0000 0.0002 Y 2545.578077 0 0.8902 1092 | 1/10 50 h-m-p 1.0382 8.0000 0.0001 --------C 2545.578077 0 0.0000 1122 Out.. lnL = -2545.578077 1123 lfun, 13476 eigenQcodon, 61765 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2553.688950 S = -2395.572257 -150.608563 Calculating f(w|X), posterior probabilities of site classes. did 10 / 203 patterns 0:45 did 20 / 203 patterns 0:45 did 30 / 203 patterns 0:46 did 40 / 203 patterns 0:46 did 50 / 203 patterns 0:46 did 60 / 203 patterns 0:46 did 70 / 203 patterns 0:46 did 80 / 203 patterns 0:47 did 90 / 203 patterns 0:47 did 100 / 203 patterns 0:47 did 110 / 203 patterns 0:47 did 120 / 203 patterns 0:47 did 130 / 203 patterns 0:48 did 140 / 203 patterns 0:48 did 150 / 203 patterns 0:48 did 160 / 203 patterns 0:48 did 170 / 203 patterns 0:48 did 180 / 203 patterns 0:49 did 190 / 203 patterns 0:49 did 200 / 203 patterns 0:49 did 203 / 203 patterns 0:49 Time used: 0:49 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=395 D_melanogaster_Nuf2-PA MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR D_simulans_Nuf2-PA MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR D_yakuba_Nuf2-PA MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR D_erecta_Nuf2-PA MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR **:*.******:*************.********:**********.:*** D_melanogaster_Nuf2-PA LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP D_simulans_Nuf2-PA LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP D_yakuba_Nuf2-PA LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP D_erecta_Nuf2-PA MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP :*******:**.*******:**********************:*:***** D_melanogaster_Nuf2-PA AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ D_simulans_Nuf2-PA AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ D_yakuba_Nuf2-PA TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ D_erecta_Nuf2-PA AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ :*******************:*****:******:***:**::*:*:**** D_melanogaster_Nuf2-PA LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ D_simulans_Nuf2-PA LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ D_yakuba_Nuf2-PA LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ D_erecta_Nuf2-PA LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH *:****:**:******:*********************:*.:***: *: D_melanogaster_Nuf2-PA GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE D_simulans_Nuf2-PA SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE D_yakuba_Nuf2-PA TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE D_erecta_Nuf2-PA NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE * :******:*****:*********************:******* *:* D_melanogaster_Nuf2-PA HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN D_simulans_Nuf2-PA HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN D_yakuba_Nuf2-PA HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN D_erecta_Nuf2-PA HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN ***:*******.::****** :* **:****** ****::****** *** D_melanogaster_Nuf2-PA YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR D_simulans_Nuf2-PA YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR D_yakuba_Nuf2-PA YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR D_erecta_Nuf2-PA YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR *** ****:***:**.* :*****.*********: .**::******** D_melanogaster_Nuf2-PA KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST D_simulans_Nuf2-PA KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST D_yakuba_Nuf2-PA KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST D_erecta_Nuf2-PA KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST *******.: *:****:** ***** :*.*****.*****: ***
>D_melanogaster_Nuf2-PA ATGGCGTTATCAGTCGAAATTGAAAGGGTAATGGACCAGGGCAACTGCCT GATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACCGAGC CCATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA GGCGCGCGTCTTTCTTATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC AGATCAGCTTTCCCAACAAGACGTACACCTATATGGACATAATTAAACCA GCTGTTAAAAAAACGCTCGCCACGCTGAGCTACCTTTTCAACCATCTGGC CTACTACAAGGTGTTCAAAAAGAAGGTGCTGGGACCTGTAGAGGAGGCCA TTAAGCTAAAGGATTCGCTGACCGCCGAGGTGAAGGCCAAAAGTCAACAG CTGGAGCAATGCAGCCAGAAGACGAAGGATTGCGAAGTGGCCATAAACAA ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATTGAGCAGCAGCAG GGTGAGCTGGACAAACGCATCGGTCACTGGGAACAGCTAGTGGTGGAGGA CAGTCAAGTGACAGAGCTGCGAGAGAAAATTAAGAGCGCATCGTCGCATG TCGAGAGCTGCAAGACGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA GGCCACGGCTGTGCTTTCGCTGTGCAAGGTGGATGATTACAAAGAGAGCT TCAAGCAGCTGGAGGCAGTGGAAAAGCAGTTGCCCACCTGTAAAGTTAAT TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT TTGTGCACATCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC ACAAGGTGCAAAATGAACTCAAAAAGCTGCAGGTCGATGTTGAGGATCGC AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCA AAATTTGGAGCAAGATCAGCTATATGCCATATTAAATGAGCAAATCCATG AGGTTCTCGGACAAAACTGGCAGATGAATTCCACT >D_simulans_Nuf2-PA ATGGCGTTATCAGTCGAAATTGAGAGGGTAATGGACCAGGGCAACTGCCT AATGCCCGACATCAATATCTGCCAAAGCGACTTGGCCAATCCCACGGAGC CGATTGTCACCAAGATCATGGTGCACTATCTGCGGAGTTTCGGCTTTCGC CTGGAGCCGCCCTATAAGATTGGCACCGAACTCGGTCACTCGTCGCGGGA GGCGCGCGTCTTTCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATCGTCC AGATCAGCTTTCCCAACAAGACCTACACCTATATGGACATAATTAAACCA GCTGTTAAAAAAACGCTCGCCACTCTGAGCTACCTTTTCAACCACCTGGC CTACTACAAGGTGTTTAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA TTAAGCTAAAGGATTCGCTGACAGCCGAGGTGAAGGCCAAGAGTCAACAG CTGGAGCAATGCAGTCAGAAGACGAAGGATTGCGAAGTGGCCATCAACAA ACTCAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA AGTCCTGTAGCGAGCATGAAAACACTCTGGAACTCATCGAGCAGCAGCAG AGTGAGCTGGACAAACGCATCGGTCACTGGGAGCAGCTAGTGGTGGAGGA CAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCGTCGCATG TCGAGAGCTGCAAGGCGGAGCTGGCCAGTAAAAAACAGGTGACGAATGAA CATCGCCGGATGATCGAAAACAGTCAACATATAGCCACCGCTTTGGAGAA GGCCACGGCTGTGCTTTCGCAGTGCAAAGTGGATGATTACAAAGAGAGCT TGAAGCAGCTGGAGGCAGTGGAGAAGCAGTTGCCCACCTGGAAGGTTAAT TATCAGAAGCTCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT TTGTGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAATC ACAAGCTGCAAAACGAACTCAAACAGCTGCAGGTTGATGTTGAGGATCGC AAGAAACGTCTGGAGGATCTGAATAATCACTTGATCGAGCTAGACCAGCG AAATTTGGAGCAAGATCAGTTATATGCCATATTAAGTGAGCAAATCCATG AGGCTCTCGGCCAAAACTGGCAGACGAATTCCACT >D_yakuba_Nuf2-PA ATGGCGTTTTCAGCCGAAATTGAGAGGGTGATGGACCAGGGCAACTGTCT GATGCCAGACATCAACATTTGCCAGAGCGACTTGGCCAATCCCACCGAAC CATTTGTCACCAAGATCATGGTGCACTATTTGCGGTGTTACGGTTTCCGC CTGGAGCCGCCATATAAGATTGGCTCCGAACTCGGCCACTCGTCGCGGGA GGCGCGCGTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC AGATCAGCTTTCCCAACAAGACCTACTCCTATGTGGATATTATAAAACCA ACTGTTAAAAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC CTACTACAAAATGTTCAAAAAGAAGGTGCTGGGACCAGTAGAGGAGGCCA TTAAGCTTAAAGAATCGCTGACAACCGAGGTGAAGGCCAAGAGTCAACAG CTGGATCAATGCAGTCAGAAGACCAAGGATTGCGAAGTGGCCATCAACCA ACTCAAAAAGGATTTGCAGGATACTCAAGCAAAGCTTCTACCTTTGAAGA AGTCCTGCAGCGAGCATGAAAGCACTCTGGAACTTCTCGCACAGCAGCAA ACTGAGCAGGAGAAACGTATCGGTCACTGGAAGCAGCTAGTGGTAGAGGA CAGCCAAGTGACTGAGCTGCGAGAGAAGATTAAGAGTGCATCCTCGCATG TGGAGAGCTGCAAGGCGGAGCTGGCCAGCAAAAAACAGGAGACGAATGAA CACCGCCGGATAATTGAAAACAGTCAACATATAGCCACCGCTTTAGAGAA GGCCACGGCTATGATTTCGCTGTGCAAACTGGATGACTACAAGGAGAGCT GCAAGCAGCTGGAGACGATGGAGAAGCAGTTGCCCACCTGCAAGGTAAAT TATCAGAAGCGCCTTCAGGATGCAGAGGCCAAGAAGCAGGAACTCGCTCT TCGAGAACAGCGGTACGAGGAAAGAAACCAGGAAAACGATGCCGAGAACC ACAAGCTGCATAGCGAACTCAATCAGCTGCAGGTCGACGTTGAGGATCGC AAGAAACGCCTGGAGGATCTAAGTAATACCTTGATCGAGCTTGACCAGCA AAATTTGGAGCAAGATCAGCTGTACGACATATTAAGTGAGCAAATCCACG AGGCTCTCGGTCAAAACTGGCAGATAAATTCCACT >D_erecta_Nuf2-PA ATGGCGCTTTCAGCCGAAATAGAGAGGGTTATGAACCAGGGCAACTGCCT GATGCCCGACATCAACATTTGCCAGAACGACTTGGCCAATCCCACCGAGC CCCTTGTCACCAAGATCATGGTGCACTATCTGCGTAGTTTCGGTTTCCGC ATGGAGCCGCCCTATAAGATTGGCACCGAACTCGCCCACTCATCGCGCGA GGCGCGCCTCTTCCTCATCCGAGTGTGCCGCCAAGTGGAGCGCATTGTCC AGATCAGCTTTCCCAACAAGACCTACACCTATGTGGATATCATAAAGCCA GCTGTTAAGAAAACGCTGGCTACCCTGAGCTACCTTTTCAACCACCTGGC CTACTACAAAGTGTTCAAAAAGAAGGTGGTGGGGCCTGTAGAGGAGGCCC TTAAGCTGAAGGACTCGCTGGCTGCCGAGCTGAAGACCAAGAGTCAACAG CTGGAGCAGTGCAGTCAGAACACCAAGGAATGCGAAGTGGCCATCAACCA ACTTAAGAAAGATTTGCAGGATACTCAAGCAAAGCTTCTACCATTGAAAA AGTCCTGCAGCGAGCAGGAAAACGCTCTGGAACTTCTCGAGCTGCAGCAT AATGAGTTGGACAAACGTATAGGACACTGGGAGCAGCTAGTGGTGGAGGA GAGTCAAGTGACTGAACTGCGAGAGAAGATTAAGAGCGCATCCTCGCATG TCGAGAGCTGCAAGACGGAGCTGGCCAGCAAAAAACAGGAGACGAAAGAA CATCGCCGGATAATCGAAAACAGCCAACACATAGTCGCCTCCTTGGAGAA AGCCACGGCTGCGCTTTCGCTGTGCAAAGTGGATGACTACAAGGAGAGCT TCAAGCAGCTGGAGGCGGTGGAGAAGCAGTTGCCCACCTGGAAGGTCAAT TATCAGAAGCGCCTTCAGGATGCAAAGGCCAAGAAGGAGGAACTCGGTCT TTGTGATCAGCGGTACGAGGAAAGAAGCCAGGAAAACGATGCCGAGAATC ACAAGCTGCTTAACGAACTCAAACAGCTGCAGGTCGATGTTGAGGATCGC AAGAAACGCCTAGAGGATCTGAGTAAAAACTTGGTCGAGCTTGACCAGCG AAATTTGGGGCAAGATCAGCTGTATGCCATGTTAAATGAGCAAATCCATG AGGCTCTTGGCCAAAACTGGCATATGAATTCCACT
>D_melanogaster_Nuf2-PA MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ GELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKTELASKKQVTNE HRRMIENSQHIATALEKATAVLSLCKVDDYKESFKQLEAVEKQLPTCKVN YQKLLQDAEAKKQELALCAHRYEERNQENDAENHKVQNELKKLQVDVEDR KKRLEDLNNHLIELDQQNLEQDQLYAILNEQIHEVLGQNWQMNST >D_simulans_Nuf2-PA MALSVEIERVMDQGNCLMPDINICQSDLANPTEPIVTKIMVHYLRSFGFR LEPPYKIGTELGHSSREARVFLIRVCRQVERIVQISFPNKTYTYMDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVLGPVEEAIKLKDSLTAEVKAKSQQ LEQCSQKTKDCEVAINKLKKDLQDTQAKLLPLKKSCSEHENTLELIEQQQ SELDKRIGHWEQLVVEDSQVTELREKIKSASSHVESCKAELASKKQVTNE HRRMIENSQHIATALEKATAVLSQCKVDDYKESLKQLEAVEKQLPTWKVN YQKLLQDAEAKKQELALCEQRYEERNQENDAENHKLQNELKQLQVDVEDR KKRLEDLNNHLIELDQRNLEQDQLYAILSEQIHEALGQNWQTNST >D_yakuba_Nuf2-PA MAFSAEIERVMDQGNCLMPDINICQSDLANPTEPFVTKIMVHYLRCYGFR LEPPYKIGSELGHSSREARVFLIRVCRQVERIVQISFPNKTYSYVDIIKP TVKKTLATLSYLFNHLAYYKMFKKKVLGPVEEAIKLKESLTTEVKAKSQQ LDQCSQKTKDCEVAINQLKKDLQDTQAKLLPLKKSCSEHESTLELLAQQQ TEQEKRIGHWKQLVVEDSQVTELREKIKSASSHVESCKAELASKKQETNE HRRIIENSQHIATALEKATAMISLCKLDDYKESCKQLETMEKQLPTCKVN YQKRLQDAEAKKQELALREQRYEERNQENDAENHKLHSELNQLQVDVEDR KKRLEDLSNTLIELDQQNLEQDQLYDILSEQIHEALGQNWQINST >D_erecta_Nuf2-PA MALSAEIERVMNQGNCLMPDINICQNDLANPTEPLVTKIMVHYLRSFGFR MEPPYKIGTELAHSSREARLFLIRVCRQVERIVQISFPNKTYTYVDIIKP AVKKTLATLSYLFNHLAYYKVFKKKVVGPVEEALKLKDSLAAELKTKSQQ LEQCSQNTKECEVAINQLKKDLQDTQAKLLPLKKSCSEQENALELLELQH NELDKRIGHWEQLVVEESQVTELREKIKSASSHVESCKTELASKKQETKE HRRIIENSQHIVASLEKATAALSLCKVDDYKESFKQLEAVEKQLPTWKVN YQKRLQDAKAKKEELGLCDQRYEERSQENDAENHKLLNELKQLQVDVEDR KKRLEDLSKNLVELDQRNLGQDQLYAMLNEQIHEALGQNWHMNST
#NEXUS [ID: 0013591831] begin taxa; dimensions ntax=4; taxlabels D_melanogaster_Nuf2-PA D_simulans_Nuf2-PA D_yakuba_Nuf2-PA D_erecta_Nuf2-PA ; end; begin trees; translate 1 D_melanogaster_Nuf2-PA, 2 D_simulans_Nuf2-PA, 3 D_yakuba_Nuf2-PA, 4 D_erecta_Nuf2-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03600163,2:0.009311102,(3:0.08389407,4:0.09797077)1.000:0.06027853); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03600163,2:0.009311102,(3:0.08389407,4:0.09797077):0.06027853); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2632.69 -2642.17 2 -2632.80 -2643.27 -------------------------------------- TOTAL -2632.74 -2642.86 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/330/Nuf2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.292868 0.001361 0.224653 0.367981 0.289951 986.92 1073.57 1.000 r(A<->C){all} 0.050930 0.000446 0.009480 0.091528 0.049243 828.56 962.88 1.000 r(A<->G){all} 0.230984 0.001446 0.160011 0.307104 0.229374 943.49 980.67 1.001 r(A<->T){all} 0.196709 0.001489 0.124742 0.274732 0.194372 960.58 1031.38 1.000 r(C<->G){all} 0.074950 0.000425 0.036467 0.114605 0.072965 1077.02 1146.95 1.000 r(C<->T){all} 0.401968 0.002854 0.293142 0.498728 0.400924 859.86 899.34 1.001 r(G<->T){all} 0.044459 0.000424 0.007163 0.084166 0.041969 956.47 1055.02 1.000 pi(A){all} 0.304265 0.000159 0.280239 0.329815 0.304430 1079.01 1092.81 1.000 pi(C){all} 0.240237 0.000140 0.217410 0.262573 0.240090 1243.29 1305.74 1.000 pi(G){all} 0.268793 0.000150 0.245567 0.293464 0.268783 1224.14 1362.57 1.001 pi(T){all} 0.186705 0.000114 0.167092 0.207413 0.186623 1244.13 1295.38 1.000 alpha{1,2} 0.058569 0.001669 0.000154 0.133288 0.052753 885.29 1193.14 1.000 alpha{3} 2.072164 0.644669 0.758400 3.715849 1.941542 1269.79 1293.13 1.000 pinvar{all} 0.292851 0.009272 0.079044 0.459891 0.302357 1125.25 1200.08 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/330/Nuf2-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 4 ls = 395 Codon usage in sequences ------------------------------------------------------------------------------------------------------ Phe TTT 3 4 3 1 | Ser TCT 0 0 0 0 | Tyr TAT 5 5 4 5 | Cys TGT 3 2 2 1 TTC 4 2 4 6 | TCC 2 2 5 4 | TAC 6 6 8 6 | TGC 7 7 9 8 Leu TTA 2 3 2 1 | TCA 1 1 1 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 7 8 7 8 | TCG 6 6 5 4 | TAG 0 0 0 0 | Trp TGG 2 3 2 3 ------------------------------------------------------------------------------------------------------ Leu CTT 6 5 7 13 | Pro CCT 2 1 1 1 | His CAT 7 5 4 5 | Arg CGT 1 1 1 2 CTC 8 9 7 6 | CCC 6 5 3 6 | CAC 5 6 7 6 | CGC 7 7 8 9 CTA 5 5 3 3 | CCA 1 2 5 2 | Gln CAA 12 11 12 9 | CGA 2 3 3 3 CTG 17 16 18 19 | CCG 1 2 1 1 | CAG 20 23 23 21 | CGG 4 4 4 2 ------------------------------------------------------------------------------------------------------ Ile ATT 7 6 9 4 | Thr ACT 3 5 6 3 | Asn AAT 11 9 7 7 | Ser AGT 5 8 6 5 ATC 10 12 8 8 | ACC 7 6 9 9 | AAC 9 10 10 14 | AGC 8 7 10 9 ATA 4 3 5 5 | ACA 1 1 1 0 | Lys AAA 15 13 12 14 | Arg AGA 1 1 1 1 Met ATG 7 6 7 7 | ACG 7 6 4 4 | AAG 27 28 28 28 | AGG 1 1 1 1 ------------------------------------------------------------------------------------------------------ Val GTT 4 4 2 3 | Ala GCT 4 5 5 6 | Asp GAT 12 12 11 11 | Gly GGT 3 2 3 2 GTC 6 5 4 7 | GCC 13 13 11 13 | GAC 7 7 8 6 | GGC 3 4 3 3 GTA 2 2 3 1 | GCA 5 4 4 3 | Glu GAA 14 13 14 13 | GGA 2 1 1 1 GTG 15 14 11 13 | GCG 2 3 3 4 | GAG 28 30 29 31 | GGG 0 0 0 2 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Nuf2-PA position 1: T:0.12152 C:0.26329 A:0.31139 G:0.30380 position 2: T:0.27089 C:0.15443 A:0.45063 G:0.12405 position 3: T:0.19241 C:0.27342 A:0.16962 G:0.36456 Average T:0.19494 C:0.23038 A:0.31055 G:0.26414 #2: D_simulans_Nuf2-PA position 1: T:0.12405 C:0.26582 A:0.30886 G:0.30127 position 2: T:0.26329 C:0.15696 A:0.45063 G:0.12911 position 3: T:0.18734 C:0.27342 A:0.15949 G:0.37975 Average T:0.19156 C:0.23207 A:0.30633 G:0.27004 #3: D_yakuba_Nuf2-PA position 1: T:0.13165 C:0.27089 A:0.31392 G:0.28354 position 2: T:0.25316 C:0.16203 A:0.44810 G:0.13671 position 3: T:0.17975 C:0.28861 A:0.16962 G:0.36203 Average T:0.18819 C:0.24051 A:0.31055 G:0.26076 #4: D_erecta_Nuf2-PA position 1: T:0.12405 C:0.27342 A:0.30127 G:0.30127 position 2: T:0.26582 C:0.15696 A:0.44557 G:0.13165 position 3: T:0.17468 C:0.30380 A:0.14684 G:0.37468 Average T:0.18819 C:0.24473 A:0.29789 G:0.26920 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 11 | Ser S TCT 0 | Tyr Y TAT 19 | Cys C TGT 8 TTC 16 | TCC 13 | TAC 26 | TGC 31 Leu L TTA 8 | TCA 5 | *** * TAA 0 | *** * TGA 0 TTG 30 | TCG 21 | TAG 0 | Trp W TGG 10 ------------------------------------------------------------------------------ Leu L CTT 31 | Pro P CCT 5 | His H CAT 21 | Arg R CGT 5 CTC 30 | CCC 20 | CAC 24 | CGC 31 CTA 16 | CCA 10 | Gln Q CAA 44 | CGA 11 CTG 70 | CCG 5 | CAG 87 | CGG 14 ------------------------------------------------------------------------------ Ile I ATT 26 | Thr T ACT 17 | Asn N AAT 34 | Ser S AGT 24 ATC 38 | ACC 31 | AAC 43 | AGC 34 ATA 17 | ACA 3 | Lys K AAA 54 | Arg R AGA 4 Met M ATG 27 | ACG 21 | AAG 111 | AGG 4 ------------------------------------------------------------------------------ Val V GTT 13 | Ala A GCT 20 | Asp D GAT 46 | Gly G GGT 10 GTC 22 | GCC 50 | GAC 28 | GGC 13 GTA 8 | GCA 16 | Glu E GAA 54 | GGA 5 GTG 53 | GCG 12 | GAG 118 | GGG 2 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.12532 C:0.26835 A:0.30886 G:0.29747 position 2: T:0.26329 C:0.15759 A:0.44873 G:0.13038 position 3: T:0.18354 C:0.28481 A:0.16139 G:0.37025 Average T:0.19072 C:0.23692 A:0.30633 G:0.26603 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Nuf2-PA D_simulans_Nuf2-PA 0.1313 (0.0142 0.1079) D_yakuba_Nuf2-PA 0.1476 (0.0525 0.3557) 0.1685 (0.0484 0.2874) D_erecta_Nuf2-PA 0.1750 (0.0596 0.3403) 0.2028 (0.0566 0.2794) 0.3268 (0.0748 0.2290) Model 0: one-ratio TREE # 1: (1, 2, (3, 4)); MP score: 197 lnL(ntime: 5 np: 7): -2549.397152 +0.000000 5..1 5..2 5..6 6..3 6..4 0.077212 0.024962 0.113253 0.165131 0.183463 1.862929 0.212939 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.56402 (1: 0.077212, 2: 0.024962, (3: 0.165131, 4: 0.183463): 0.113253); (D_melanogaster_Nuf2-PA: 0.077212, D_simulans_Nuf2-PA: 0.024962, (D_yakuba_Nuf2-PA: 0.165131, D_erecta_Nuf2-PA: 0.183463): 0.113253); Detailed output identifying parameters kappa (ts/tv) = 1.86293 omega (dN/dS) = 0.21294 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.077 925.5 259.5 0.2129 0.0142 0.0668 13.2 17.3 5..2 0.025 925.5 259.5 0.2129 0.0046 0.0216 4.3 5.6 5..6 0.113 925.5 259.5 0.2129 0.0209 0.0980 19.3 25.4 6..3 0.165 925.5 259.5 0.2129 0.0304 0.1429 28.2 37.1 6..4 0.183 925.5 259.5 0.2129 0.0338 0.1587 31.3 41.2 tree length for dN: 0.1039 tree length for dS: 0.4879 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, (3, 4)); MP score: 197 lnL(ntime: 5 np: 8): -2545.585251 +0.000000 5..1 5..2 5..6 6..3 6..4 0.079749 0.024968 0.118731 0.170779 0.190193 1.878477 0.881290 0.130367 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58442 (1: 0.079749, 2: 0.024968, (3: 0.170779, 4: 0.190193): 0.118731); (D_melanogaster_Nuf2-PA: 0.079749, D_simulans_Nuf2-PA: 0.024968, (D_yakuba_Nuf2-PA: 0.170779, D_erecta_Nuf2-PA: 0.190193): 0.118731); Detailed output identifying parameters kappa (ts/tv) = 1.87848 dN/dS (w) for site classes (K=2) p: 0.88129 0.11871 w: 0.13037 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.080 924.9 260.1 0.2336 0.0155 0.0662 14.3 17.2 5..2 0.025 924.9 260.1 0.2336 0.0048 0.0207 4.5 5.4 5..6 0.119 924.9 260.1 0.2336 0.0230 0.0985 21.3 25.6 6..3 0.171 924.9 260.1 0.2336 0.0331 0.1417 30.6 36.9 6..4 0.190 924.9 260.1 0.2336 0.0369 0.1578 34.1 41.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, (3, 4)); MP score: 197 lnL(ntime: 5 np: 10): -2545.585251 +0.000000 5..1 5..2 5..6 6..3 6..4 0.079749 0.024968 0.118731 0.170779 0.190193 1.878477 0.881291 0.044243 0.130367 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58442 (1: 0.079749, 2: 0.024968, (3: 0.170779, 4: 0.190193): 0.118731); (D_melanogaster_Nuf2-PA: 0.079749, D_simulans_Nuf2-PA: 0.024968, (D_yakuba_Nuf2-PA: 0.170779, D_erecta_Nuf2-PA: 0.190193): 0.118731); Detailed output identifying parameters kappa (ts/tv) = 1.87848 dN/dS (w) for site classes (K=3) p: 0.88129 0.04424 0.07447 w: 0.13037 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.080 924.9 260.1 0.2336 0.0155 0.0662 14.3 17.2 5..2 0.025 924.9 260.1 0.2336 0.0048 0.0207 4.5 5.4 5..6 0.119 924.9 260.1 0.2336 0.0230 0.0985 21.3 25.6 6..3 0.171 924.9 260.1 0.2336 0.0331 0.1417 30.6 36.9 6..4 0.190 924.9 260.1 0.2336 0.0369 0.1578 34.1 41.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Nuf2-PA) Pr(w>1) post mean +- SE for w 3 L 0.503 1.318 +- 0.939 201 G 0.708 1.690 +- 0.824 297 C 0.508 1.331 +- 0.922 367 Q 0.521 1.358 +- 0.928 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.016 0.982 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.657 0.267 0.059 0.012 0.003 0.001 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.059 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.109 0.818 sum of density on p0-p1 = 1.000000 Time used: 0:07 Model 3: discrete (3 categories) TREE # 1: (1, 2, (3, 4)); MP score: 197 lnL(ntime: 5 np: 11): -2545.563025 +0.000000 5..1 5..2 5..6 6..3 6..4 0.079482 0.024978 0.118411 0.170372 0.189700 1.875153 0.346264 0.485729 0.112996 0.112997 0.815374 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58294 (1: 0.079482, 2: 0.024978, (3: 0.170372, 4: 0.189700): 0.118411); (D_melanogaster_Nuf2-PA: 0.079482, D_simulans_Nuf2-PA: 0.024978, (D_yakuba_Nuf2-PA: 0.170372, D_erecta_Nuf2-PA: 0.189700): 0.118411); Detailed output identifying parameters kappa (ts/tv) = 1.87515 dN/dS (w) for site classes (K=3) p: 0.34626 0.48573 0.16801 w: 0.11300 0.11300 0.81537 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.079 925.0 260.0 0.2310 0.0153 0.0663 14.2 17.2 5..2 0.025 925.0 260.0 0.2310 0.0048 0.0208 4.5 5.4 5..6 0.118 925.0 260.0 0.2310 0.0228 0.0987 21.1 25.7 6..3 0.170 925.0 260.0 0.2310 0.0328 0.1421 30.4 36.9 6..4 0.190 925.0 260.0 0.2310 0.0365 0.1582 33.8 41.1 Naive Empirical Bayes (NEB) analysis Time used: 0:12 Model 7: beta (10 categories) TREE # 1: (1, 2, (3, 4)); MP score: 197 lnL(ntime: 5 np: 8): -2545.617532 +0.000000 5..1 5..2 5..6 6..3 6..4 0.079111 0.025023 0.118015 0.169850 0.189057 1.876023 0.435282 1.445746 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58106 (1: 0.079111, 2: 0.025023, (3: 0.169850, 4: 0.189057): 0.118015); (D_melanogaster_Nuf2-PA: 0.079111, D_simulans_Nuf2-PA: 0.025023, (D_yakuba_Nuf2-PA: 0.169850, D_erecta_Nuf2-PA: 0.189057): 0.118015); Detailed output identifying parameters kappa (ts/tv) = 1.87602 Parameters in M7 (beta): p = 0.43528 q = 1.44575 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00065 0.00816 0.02655 0.05808 0.10505 0.17021 0.25750 0.37322 0.52969 0.76275 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.079 924.9 260.1 0.2292 0.0152 0.0662 14.0 17.2 5..2 0.025 924.9 260.1 0.2292 0.0048 0.0209 4.4 5.4 5..6 0.118 924.9 260.1 0.2292 0.0226 0.0988 20.9 25.7 6..3 0.170 924.9 260.1 0.2292 0.0326 0.1421 30.1 37.0 6..4 0.189 924.9 260.1 0.2292 0.0363 0.1582 33.5 41.1 Time used: 0:19 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, (3, 4)); MP score: 197 lnL(ntime: 5 np: 10): -2545.578077 +0.000000 5..1 5..2 5..6 6..3 6..4 0.079545 0.025001 0.118493 0.170510 0.189858 1.876587 0.902186 1.555669 8.767687 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58341 (1: 0.079545, 2: 0.025001, (3: 0.170510, 4: 0.189858): 0.118493); (D_melanogaster_Nuf2-PA: 0.079545, D_simulans_Nuf2-PA: 0.025001, (D_yakuba_Nuf2-PA: 0.170510, D_erecta_Nuf2-PA: 0.189858): 0.118493); Detailed output identifying parameters kappa (ts/tv) = 1.87659 Parameters in M8 (beta&w>1): p0 = 0.90219 p = 1.55567 q = 8.76769 (p1 = 0.09781) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.09022 0.09022 0.09022 0.09022 0.09022 0.09022 0.09022 0.09022 0.09022 0.09022 0.09781 w: 0.02119 0.04632 0.06882 0.09138 0.11525 0.14161 0.17211 0.20974 0.26166 0.35816 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.080 924.9 260.1 0.2319 0.0154 0.0662 14.2 17.2 5..2 0.025 924.9 260.1 0.2319 0.0048 0.0208 4.5 5.4 5..6 0.118 924.9 260.1 0.2319 0.0229 0.0986 21.2 25.7 6..3 0.171 924.9 260.1 0.2319 0.0329 0.1419 30.4 36.9 6..4 0.190 924.9 260.1 0.2319 0.0366 0.1580 33.9 41.1 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Nuf2-PA) Pr(w>1) post mean +- SE for w 201 G 0.678 1.322 +- 0.550 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.991 p : 0.115 0.724 0.159 0.002 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.004 0.065 0.031 0.015 0.065 0.160 0.212 0.217 0.232 ws: 0.904 0.089 0.007 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 0:49
Model 1: NearlyNeutral -2545.585251 Model 2: PositiveSelection -2545.585251 Model 0: one-ratio -2549.397152 Model 3: discrete -2545.563025 Model 7: beta -2545.617532 Model 8: beta&w>1 -2545.578077 Model 0 vs 1 7.623802000000069 Model 2 vs 1 0.0 Model 8 vs 7 0.07891000000017812