--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Nov 19 02:54:18 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/28/bun-PO/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1785.88 -1805.10
2 -1786.22 -1800.54
--------------------------------------
TOTAL -1786.04 -1804.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.530088 0.004835 0.403199 0.667286 0.524719 1367.97 1434.48 1.000
r(A<->C){all} 0.109125 0.000744 0.060501 0.165976 0.107008 907.22 928.42 1.000
r(A<->G){all} 0.298140 0.002371 0.202032 0.391325 0.295551 672.20 865.96 1.000
r(A<->T){all} 0.149480 0.001422 0.084352 0.231199 0.147057 813.86 887.90 1.001
r(C<->G){all} 0.041833 0.000257 0.013233 0.073625 0.040456 1011.97 1127.27 1.000
r(C<->T){all} 0.315283 0.002761 0.217455 0.419486 0.314308 785.07 788.13 1.000
r(G<->T){all} 0.086139 0.000715 0.037154 0.139213 0.083836 782.68 868.13 1.000
pi(A){all} 0.245665 0.000261 0.215420 0.278346 0.245287 1261.20 1314.32 1.000
pi(C){all} 0.268605 0.000270 0.236705 0.300437 0.268575 1244.16 1291.45 1.000
pi(G){all} 0.323025 0.000312 0.289214 0.356867 0.323014 1122.66 1162.57 1.000
pi(T){all} 0.162705 0.000187 0.136799 0.188804 0.162380 1166.64 1182.10 1.000
alpha{1,2} 0.283340 0.016542 0.069697 0.538693 0.262590 982.88 1061.26 1.000
alpha{3} 1.512922 0.641747 0.297740 3.105311 1.363477 947.97 1029.31 1.000
pinvar{all} 0.374348 0.017496 0.079813 0.580735 0.400021 625.82 713.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1376.565131
Model 2: PositiveSelection -1374.735666
Model 0: one-ratio -1395.998041
Model 3: discrete -1374.735666
Model 7: beta -1377.776196
Model 8: beta&w>1 -1374.75013
Model 0 vs 1 38.865819999999985
Model 2 vs 1 3.658930000000055
Model 8 vs 7 6.052132000000256
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
94 L 0.915 1.783
110 Q 0.880 1.717
117 V 0.913 1.778
120 Q 0.848 1.658
121 A 1.000** 1.940
136 V 0.832 1.628
139 S 0.994** 1.929
154 S 0.995** 1.929
157 S 0.854 1.669
164 A 0.997** 1.934
166 V 0.907 1.767
167 V 0.993** 1.927
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
117 V 0.543 1.692 +- 1.235
121 A 0.982* 2.761 +- 1.007
139 S 0.774 2.255 +- 1.146
154 S 0.898 2.593 +- 1.128
164 A 0.870 2.517 +- 1.133
166 V 0.516 1.616 +- 1.208
167 V 0.751 2.205 +- 1.165
>C1
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPN
GSAENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMSooooo
>C2
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAPAVQSVVAPAAAGQAVQQQSAGAVAVTGVATSPASAVVPTSIPN
GSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGPMS
>C3
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAPAVQSVVAPAAAGQAVQQQSAGAVAVTGVATSPASAVVPTSIPN
GSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGPMS
>C4
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAAVQSAVAPAAAGQAVQQQAAGAVAVAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVESAVSVEQQVQQVTSAAAAAAAAAVTANGPMS
>C5
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAVQSAVAPAAAGQAVQQQQAAGGAVAVTGVATSPASAAVPTSI
PNGSAENGSSAVESAVSVEQQVQQVTSAAAAAVVTANGPMSoooooo
>C6
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAVQSAVAPAAAGQAVQGGQQQTAGAVAVTGVATSPASAVIPTI
IPNGSAENGGSAVESAAVSVEQQQQQQVTSAAATAVTTTNGPMSooo
>C7
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAV
VPTIIPNGSAENGGSAVELSAAAAEQQQVASAAAGAATTTNGPMSoo
>C8
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAATTAAGQAVQGGQQQTAGTVAVTGLATSPASAVVPTSIPNGS
AENGGSAVESVVVSVEQQQQQQQVTSAAATAVTTTNGPMSooooooo
>C9
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAPAVQSAVAAAAGQAAQGGQVAAGAVTGVATSPASAVAPTTIPNG
SAENGGSAVKSAVAVEQQQVTSAAAVPTANGPMSooooooooooooo
>C10
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAPAVQSAVAAAAGQAGQGGQVAAGAVTGVATSPASAVAPTTIPNG
SAENGGSAVESAVAVEQQHVAAATAAAAVPTANGPMSoooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=218
C1 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C2 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C3 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C4 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C5 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C6 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C7 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C8 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C9 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
C10 MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
**************************************************
C1 EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
C2 EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
C3 EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
C4 EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
C5 EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
C6 EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
C7 EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
C8 EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
C9 EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
C10 EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
*************:*********.***************:***:******
C1 PAIQAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASA
C2 PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
C3 PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
C4 PAIQAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASA
C5 PAIQAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASA
C6 PAIQAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASA
C7 PAIQAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASA
C8 PAIQAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASA
C9 PAIQAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASA
C10 PAIQAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASA
******* *. :***** * * * **:*:*******
C1 VVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTA
C2 VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
C3 VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
C4 VVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTA
C5 AVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTA
C6 VIPTIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTT
C7 VVPTIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTT
C8 VVPTSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTT
C9 VAPTTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTA
C10 VAPTTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTA
. ** *********.***: ..:.** ::* :. *:
C1 NGPMSooooo--------
C2 NGPMS-------------
C3 NGPMS-------------
C4 NGPMS-------------
C5 NGPMSoooooo-------
C6 NGPMSooo----------
C7 NGPMSoo-----------
C8 NGPMSooooooo------
C9 NGPMSooooooooooooo
C10 NGPMSoooooooooo---
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 197 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 197 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26524]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [26524]--->[24325]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/28/bun-PO/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.548 Mb, Max= 31.172 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASA
VVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTA
NGPMSooooo--------
>C2
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
NGPMS-------------
>C3
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
NGPMS-------------
>C4
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASA
VVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTA
NGPMS-------------
>C5
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASA
AVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTA
NGPMSoooooo-------
>C6
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASA
VIPTIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTT
NGPMSooo----------
>C7
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASA
VVPTIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTT
NGPMSoo-----------
>C8
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASA
VVPTSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTT
NGPMSooooooo------
>C9
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASA
VAPTTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTA
NGPMSooooooooooooo
>C10
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASA
VAPTTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTA
NGPMSoooooooooo---
FORMAT of file /tmp/tmp1644635749324349388aln Not Supported[FATAL:T-COFFEE]
>C1
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASA
VVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTA
NGPMSooooo--------
>C2
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
NGPMS-------------
>C3
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
NGPMS-------------
>C4
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASA
VVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTA
NGPMS-------------
>C5
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASA
AVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTA
NGPMSoooooo-------
>C6
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASA
VIPTIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTT
NGPMSooo----------
>C7
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASA
VVPTIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTT
NGPMSoo-----------
>C8
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASA
VVPTSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTT
NGPMSooooooo------
>C9
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASA
VAPTTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTA
NGPMSooooooooooooo
>C10
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASA
VAPTTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTA
NGPMSoooooooooo---
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:218 S:89 BS:218
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 98.96 C1 C2 98.96
TOP 1 0 98.96 C2 C1 98.96
BOT 0 2 98.96 C1 C3 98.96
TOP 2 0 98.96 C3 C1 98.96
BOT 0 3 96.86 C1 C4 96.86
TOP 3 0 96.86 C4 C1 96.86
BOT 0 4 96.37 C1 C5 96.37
TOP 4 0 96.37 C5 C1 96.37
BOT 0 5 91.71 C1 C6 91.71
TOP 5 0 91.71 C6 C1 91.71
BOT 0 6 89.42 C1 C7 89.42
TOP 6 0 89.42 C7 C1 89.42
BOT 0 7 88.48 C1 C8 88.48
TOP 7 0 88.48 C8 C1 88.48
BOT 0 8 91.98 C1 C9 91.98
TOP 8 0 91.98 C9 C1 91.98
BOT 0 9 91.53 C1 C10 91.53
TOP 9 0 91.53 C10 C1 91.53
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 95.83 C2 C4 95.83
TOP 3 1 95.83 C4 C2 95.83
BOT 1 4 95.74 C2 C5 95.74
TOP 4 1 95.74 C5 C2 95.74
BOT 1 5 90.58 C2 C6 90.58
TOP 5 1 90.58 C6 C2 90.58
BOT 1 6 88.30 C2 C7 88.30
TOP 6 1 88.30 C7 C2 88.30
BOT 1 7 87.17 C2 C8 87.17
TOP 7 1 87.17 C8 C2 87.17
BOT 1 8 90.66 C2 C9 90.66
TOP 8 1 90.66 C9 C2 90.66
BOT 1 9 90.27 C2 C10 90.27
TOP 9 1 90.27 C10 C2 90.27
BOT 2 3 95.83 C3 C4 95.83
TOP 3 2 95.83 C4 C3 95.83
BOT 2 4 95.74 C3 C5 95.74
TOP 4 2 95.74 C5 C3 95.74
BOT 2 5 90.58 C3 C6 90.58
TOP 5 2 90.58 C6 C3 90.58
BOT 2 6 88.30 C3 C7 88.30
TOP 6 2 88.30 C7 C3 88.30
BOT 2 7 87.17 C3 C8 87.17
TOP 7 2 87.17 C8 C3 87.17
BOT 2 8 90.66 C3 C9 90.66
TOP 8 2 90.66 C9 C3 90.66
BOT 2 9 90.27 C3 C10 90.27
TOP 9 2 90.27 C10 C3 90.27
BOT 3 4 96.86 C4 C5 96.86
TOP 4 3 96.86 C5 C4 96.86
BOT 3 5 93.65 C4 C6 93.65
TOP 5 3 93.65 C6 C4 93.65
BOT 3 6 93.16 C4 C7 93.16
TOP 6 3 93.16 C7 C4 93.16
BOT 3 7 90.27 C4 C8 90.27
TOP 7 3 90.27 C8 C4 90.27
BOT 3 8 93.41 C4 C9 93.41
TOP 8 3 93.41 C9 C4 93.41
BOT 3 9 92.97 C4 C10 92.97
TOP 9 3 92.97 C10 C4 92.97
BOT 4 5 94.71 C5 C6 94.71
TOP 5 4 94.71 C6 C5 94.71
BOT 4 6 90.43 C5 C7 90.43
TOP 6 4 90.43 C7 C5 90.43
BOT 4 7 91.49 C5 C8 91.49
TOP 7 4 91.49 C8 C5 91.49
BOT 4 8 93.05 C5 C9 93.05
TOP 8 4 93.05 C9 C5 93.05
BOT 4 9 92.59 C5 C10 92.59
TOP 9 4 92.59 C10 C5 92.59
BOT 5 6 93.26 C6 C7 93.26
TOP 6 5 93.26 C7 C6 93.26
BOT 5 7 94.79 C6 C8 94.79
TOP 7 5 94.79 C8 C6 94.79
BOT 5 8 92.51 C6 C9 92.51
TOP 8 5 92.51 C9 C6 92.51
BOT 5 9 93.05 C6 C10 93.05
TOP 9 5 93.05 C10 C6 93.05
BOT 6 7 89.89 C7 C8 89.89
TOP 7 6 89.89 C8 C7 89.89
BOT 6 8 90.71 C7 C9 90.71
TOP 8 6 90.71 C9 C7 90.71
BOT 6 9 91.80 C7 C10 91.80
TOP 9 6 91.80 C10 C7 91.80
BOT 7 8 89.30 C8 C9 89.30
TOP 8 7 89.30 C9 C8 89.30
BOT 7 9 89.36 C8 C10 89.36
TOP 9 7 89.36 C10 C8 89.36
BOT 8 9 97.94 C9 C10 97.94
TOP 9 8 97.94 C10 C9 97.94
AVG 0 C1 * 93.81
AVG 1 C2 * 93.06
AVG 2 C3 * 93.06
AVG 3 C4 * 94.32
AVG 4 C5 * 94.11
AVG 5 C6 * 92.76
AVG 6 C7 * 90.59
AVG 7 C8 * 89.77
AVG 8 C9 * 92.25
AVG 9 C10 * 92.20
TOT TOT * 92.59
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C2 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C3 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C4 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C5 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C6 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C7 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C8 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C9 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
C10 ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
**************************************************
C1 TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG
C2 TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG
C3 TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG
C4 TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
C5 TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
C6 TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
C7 CATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
C8 TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
C9 TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCG
C10 TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCG
********************:***************** **********
C1 AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C2 AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C3 AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C4 AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C5 AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C6 AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C7 AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C8 AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C9 AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
C10 AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
*.************************************************
C1 GAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA
C2 GAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA
C3 GAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA
C4 GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
C5 GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
C6 GAGGTGGAAGTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAA
C7 GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
C8 GAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAA
C9 GAGGTGGAAGTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAA
C10 GAGGTGGAAGTTCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
*********** **.**.********.**************.********
C1 CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA
C2 CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA
C3 CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA
C4 CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGA
C5 CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
C6 CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
C7 CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
C8 CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
C9 CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
C10 CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
************ *******.******************.**********
C1 CACTGCAGCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACG
C2 CGCTGCAGCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACG
C3 CGCTGCAGCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACG
C4 CACTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACG
C5 CACTGCAGCAGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACG
C6 CGCTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACG
C7 CGCTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACG
C8 CGCTGCAGCAGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACG
C9 CGCTGCAGCAGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACG
C10 CGCTGCAGCAGTTGCAGATGCAGCTCCAAGTGGCCGCTCCCCCGGCCACG
*.********* *****:******* **. * ***** ** *********
C1 CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC
C2 CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC
C3 CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC
C4 CCCGCCATTCAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGC
C5 CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGC
C6 CCCGCCATCCAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGC
C7 CCCGCCATCCAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGC
C8 CCAGCCATTCAAGCGGCGCCG---GCGGCAACG---------------AC
C9 CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GC
C10 CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GC
**.***** **.*****.*** **** .... .*
C1 TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGA----
C2 TGCCGCGGGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA----
C3 TGCCGCGGGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA----
C4 TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGG
C5 TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGCAGGCC------G
C6 TGCCGCGGGTCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT----
C7 TGCCGCGGGTCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGG
C8 TGCCGCGGGTCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA----
C9 TGCCGCGGGTCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA----
C10 TGCCGCGGGTCAGGCAGGGCAGGGTGGT---CAGGTGGCCGCCGGT----
***************** **. *** :* . **
C1 --------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
C2 --------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
C3 --------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
C4 TTGCGGTAGCGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
C5 CTGGAGGAGCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
C6 --------GCGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCG
C7 TGGCGGTGGCGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCG
C8 --------ACGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCG
C9 --------------GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCA
C10 --------------GCGGTGACGGGAGTTGCCACCAGTCCAGCGTCCGCA
*****..*.** * ******** **.** **.**.
C1 GTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC
C2 GTGGTACCCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGC
C3 GTGGTACCCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGC
C4 GTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC
C5 GCGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC
C6 GTGATCCCAACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGC
C7 GTGGTCCCCACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC
C8 GTGGTCCCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGC
C9 GTGGCGCCCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC
C10 GTGGCGCCCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC
* *. **.**** ********* ***** *********** .*******
C1 AGTCGAGTCAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
C2 AGTCGAGACAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
C3 AGTCGAGACAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
C4 AGTCGAGTCA---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACTT
C5 AGTCGAGTCA---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
C6 TGTCGAGTCAGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG----
C7 AGTCGAGCTGTCAGCGGCAGCGGCGGAGCAGCAGCAG-------------
C8 AGTCGAGTCAGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAG-
C9 AGTCAAGTCA---GCGGTGGCGGTGGAGCAG------CAGCAGGTG----
C10 AGTCGAGTCA---GCGGTAGCGGTGGAGCAG------CAGCATGTGGCGG
:***.** . * ** . *** .******
C1 CA---------------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCC
C2 CAGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCC
C3 CAGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCC
C4 CAGCA------------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCA
C5 CA---------------------GCAGCGGCGGCAGCAGTGGTCACAGCC
C6 --------------GTGACGTCAGCAGCGGCAACAGCGGTAACCACGACC
C7 --------------GTGGCGTCGGCAGCGGCTGGAGCGGCAACCACGACC
C8 --------------GTGACGTCAGCAGCGGCAACAGCGGTAACCACAACC
C9 -----------------------ACGTCAGCAGCAGCGGTACCCACAGCA
C10 CAGCA------------------ACAGCAGCAGCAGCGGTACCCACAGCC
.*. *.** . * *.* . *** .*.
C1 AATGGTCCCATGTCC-----------------------------------
C2 AATGGTCCCATGTCC-----------------------------------
C3 AATGGTCCCATGTCC-----------------------------------
C4 AACGGTCCCATGTCC-----------------------------------
C5 AATGGTCCCATGTCC-----------------------------------
C6 AACGGTCCCATGTCC-----------------------------------
C7 AACGGCCCCATGTCC-----------------------------------
C8 AATGGTCCCATGTCC-----------------------------------
C9 AACGGTCCCATGTCC-----------------------------------
C10 AACGGACCTATGTCC-----------------------------------
** ** ** ******
C1 ----
C2 ----
C3 ----
C4 ----
C5 ----
C6 ----
C7 ----
C8 ----
C9 ----
C10 ----
>C1
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG
AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA
CACTGCAGCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACG
CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC
TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGA----
--------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
GTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC
AGTCGAGTCAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
CA---------------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCC
AATGGTCCCATGTCC-----------------------------------
----
>C2
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG
AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACG
CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC
TGCCGCGGGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA----
--------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
GTGGTACCCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGC
AGTCGAGACAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
CAGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCC
AATGGTCCCATGTCC-----------------------------------
----
>C3
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG
AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACG
CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC
TGCCGCGGGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA----
--------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
GTGGTACCCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGC
AGTCGAGACAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
CAGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCC
AATGGTCCCATGTCC-----------------------------------
----
>C4
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGA
CACTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACG
CCCGCCATTCAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGC
TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGG
TTGCGGTAGCGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
GTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC
AGTCGAGTCA---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACTT
CAGCA------------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCA
AACGGTCCCATGTCC-----------------------------------
----
>C5
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
CACTGCAGCAGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACG
CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGC
TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGCAGGCC------G
CTGGAGGAGCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG
GCGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC
AGTCGAGTCA---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT
CA---------------------GCAGCGGCGGCAGCAGTGGTCACAGCC
AATGGTCCCATGTCC-----------------------------------
----
>C6
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACG
CCCGCCATCCAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGC
TGCCGCGGGTCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT----
--------GCGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCG
GTGATCCCAACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGC
TGTCGAGTCAGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG----
--------------GTGACGTCAGCAGCGGCAACAGCGGTAACCACGACC
AACGGTCCCATGTCC-----------------------------------
----
>C7
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
CATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACG
CCCGCCATCCAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGC
TGCCGCGGGTCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGG
TGGCGGTGGCGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCG
GTGGTCCCCACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC
AGTCGAGCTGTCAGCGGCAGCGGCGGAGCAGCAGCAG-------------
--------------GTGGCGTCGGCAGCGGCTGGAGCGGCAACCACGACC
AACGGCCCCATGTCC-----------------------------------
----
>C8
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG
AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAA
CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACG
CCAGCCATTCAAGCGGCGCCG---GCGGCAACG---------------AC
TGCCGCGGGTCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA----
--------ACGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCG
GTGGTCCCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGC
AGTCGAGTCAGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAG-
--------------GTGACGTCAGCAGCGGCAACAGCGGTAACCACAACC
AATGGTCCCATGTCC-----------------------------------
----
>C9
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCG
AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACG
CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GC
TGCCGCGGGTCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA----
--------------GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCA
GTGGCGCCCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC
AGTCAAGTCA---GCGGTGGCGGTGGAGCAG------CAGCAGGTG----
-----------------------ACGTCAGCAGCAGCGGTACCCACAGCA
AACGGTCCCATGTCC-----------------------------------
----
>C10
ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT
TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCG
AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG
GAGGTGGAAGTTCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA
CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA
CGCTGCAGCAGTTGCAGATGCAGCTCCAAGTGGCCGCTCCCCCGGCCACG
CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GC
TGCCGCGGGTCAGGCAGGGCAGGGTGGT---CAGGTGGCCGCCGGT----
--------------GCGGTGACGGGAGTTGCCACCAGTCCAGCGTCCGCA
GTGGCGCCCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC
AGTCGAGTCA---GCGGTAGCGGTGGAGCAG------CAGCATGTGGCGG
CAGCA------------------ACAGCAGCAGCAGCGGTACCCACAGCC
AACGGACCTATGTCC-----------------------------------
----
>C1
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAPoAVQSVVAPAAAGQAVQoooQQAAGooooAVAVTGVATSPASA
VVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTSoooooAAAAAASVVTA
NGPMS
>C2
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAPoAVQSVVAPAAAGQAVQoooQQSAGooooAVAVTGVATSPASA
VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
NGPMS
>C3
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
PAIQAAPoAVQSVVAPAAAGQAVQoooQQSAGooooAVAVTGVATSPASA
VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
NGPMS
>C4
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPAAVQSAVAPAAAGQAVQoooQQAAGAVAVAVAVTGVATSPASA
VVPTSIPNGSAENGSSAVESoAVSVEQQVQQVTSAooooAAAAAAAAVTA
NGPMS
>C5
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPoAVQSAVAPAAAGQAVQoooQQQAooAGGAVAVTGVATSPASA
AVPTSIPNGSAENGSSAVESoAVSVEQQVQQVTSoooooooAAAAAVVTA
NGPMS
>C6
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPoAVQSAVAPAAAGQAVQGGQQQTAGooooAVAVTGVATSPASA
VIPTIIPNGSAENGGSAVESAAVSVEQQQQQQooooooVTSAAATAVTTT
NGPMS
>C7
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPoAVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASA
VVPTIIPNGSAENGGSAVELSAAAAEQQQoooooooooVASAAAGAATTT
NGPMS
>C8
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
PAIQAAPoAAToooooTAAGQAVQGGQQQTAGooooTVAVTGLATSPASA
VVPTSIPNGSAENGGSAVESVVVSVEQQQQQQQoooooVTSAAATAVTTT
NGPMS
>C9
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAPoAVQSAVAoAAAGQAAQGGoQVAAGooooooAVTGVATSPASA
VAPTTIPNGSAENGGSAVKSoAVAVEQooQQVoooooooooTSAAAVPTA
NGPMS
>C10
MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
PAIQAAPoAVQSAVAoAAAGQAGQGGoQVAAGooooooAVTGVATSPASA
VAPTTIPNGSAENGGSAVESoAVAVEQooQHVAAAooooooTAAAAVPTA
NGPMS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 654 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479523257
Setting output file names to "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1015043005
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2730358986
Seed = 456592835
Swapseed = 1479523257
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 48 unique site patterns
Division 2 has 47 unique site patterns
Division 3 has 85 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2542.834623 -- -24.412588
Chain 2 -- -2506.135184 -- -24.412588
Chain 3 -- -2644.861973 -- -24.412588
Chain 4 -- -2568.886776 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2614.646639 -- -24.412588
Chain 2 -- -2639.212679 -- -24.412588
Chain 3 -- -2587.949695 -- -24.412588
Chain 4 -- -2555.150312 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2542.835] (-2506.135) (-2644.862) (-2568.887) * [-2614.647] (-2639.213) (-2587.950) (-2555.150)
500 -- [-1841.341] (-1852.446) (-1853.565) (-1847.172) * (-1863.560) [-1838.553] (-1849.680) (-1839.423) -- 0:00:00
1000 -- (-1835.488) [-1822.502] (-1839.761) (-1818.827) * (-1834.736) [-1814.376] (-1825.557) (-1827.386) -- 0:00:00
1500 -- (-1800.324) [-1804.305] (-1824.033) (-1811.536) * [-1797.609] (-1797.844) (-1820.459) (-1817.350) -- 0:11:05
2000 -- (-1801.211) [-1801.717] (-1808.601) (-1795.628) * (-1793.550) (-1807.985) [-1795.423] (-1803.644) -- 0:08:19
2500 -- (-1796.293) [-1801.520] (-1808.813) (-1798.758) * (-1797.952) (-1800.601) (-1792.399) [-1801.216] -- 0:06:39
3000 -- (-1797.132) [-1786.367] (-1799.819) (-1793.531) * (-1804.559) [-1807.844] (-1790.272) (-1798.312) -- 0:05:32
3500 -- (-1796.146) [-1788.509] (-1788.797) (-1786.994) * [-1796.842] (-1805.942) (-1794.394) (-1787.572) -- 0:09:29
4000 -- [-1789.689] (-1793.457) (-1791.940) (-1790.506) * (-1799.965) (-1802.394) [-1794.266] (-1791.044) -- 0:08:18
4500 -- [-1799.898] (-1792.844) (-1788.426) (-1790.443) * [-1795.726] (-1808.416) (-1801.335) (-1790.185) -- 0:07:22
5000 -- (-1798.944) (-1800.026) [-1781.623] (-1795.908) * (-1795.331) [-1792.880] (-1800.639) (-1798.139) -- 0:06:38
Average standard deviation of split frequencies: 0.085710
5500 -- (-1802.770) [-1794.311] (-1788.371) (-1801.573) * (-1787.834) (-1808.135) [-1800.141] (-1796.487) -- 0:06:01
6000 -- (-1797.294) [-1787.530] (-1791.680) (-1786.720) * (-1794.639) (-1801.241) (-1795.415) [-1791.478] -- 0:08:17
6500 -- (-1793.096) [-1789.932] (-1796.243) (-1792.244) * (-1793.653) [-1790.109] (-1798.822) (-1795.395) -- 0:07:38
7000 -- (-1796.590) (-1787.690) (-1789.359) [-1794.184] * (-1792.248) (-1798.614) (-1799.090) [-1793.093] -- 0:07:05
7500 -- (-1801.000) [-1788.525] (-1792.614) (-1786.068) * (-1794.039) [-1786.824] (-1794.919) (-1785.958) -- 0:06:37
8000 -- (-1796.458) (-1786.400) (-1797.567) [-1785.606] * (-1794.342) (-1791.323) [-1788.745] (-1793.083) -- 0:06:12
8500 -- (-1796.480) (-1788.312) (-1795.847) [-1788.982] * [-1792.209] (-1797.199) (-1789.793) (-1800.921) -- 0:07:46
9000 -- (-1803.979) (-1804.135) [-1790.065] (-1791.920) * (-1798.784) [-1787.389] (-1787.007) (-1787.245) -- 0:07:20
9500 -- (-1798.125) (-1791.076) [-1791.565] (-1795.331) * [-1785.876] (-1798.469) (-1789.356) (-1791.196) -- 0:06:57
10000 -- (-1795.158) [-1790.695] (-1795.120) (-1791.567) * (-1789.320) (-1793.778) [-1791.828] (-1818.089) -- 0:06:36
Average standard deviation of split frequencies: 0.051560
10500 -- (-1797.068) [-1786.869] (-1802.374) (-1792.205) * [-1802.012] (-1794.508) (-1790.597) (-1796.748) -- 0:07:51
11000 -- (-1792.941) [-1787.971] (-1791.573) (-1792.430) * (-1795.593) (-1790.117) [-1788.294] (-1789.889) -- 0:07:29
11500 -- [-1793.394] (-1782.703) (-1791.898) (-1800.314) * (-1789.352) (-1792.201) [-1792.370] (-1785.688) -- 0:07:09
12000 -- (-1795.904) (-1792.442) (-1796.424) [-1785.798] * (-1791.814) [-1794.219] (-1791.057) (-1785.470) -- 0:06:51
12500 -- (-1795.650) (-1806.109) [-1791.745] (-1798.748) * (-1797.836) (-1814.679) [-1791.260] (-1788.983) -- 0:07:54
13000 -- [-1790.424] (-1806.069) (-1791.486) (-1788.205) * (-1794.027) (-1794.678) [-1794.109] (-1795.329) -- 0:07:35
13500 -- [-1785.746] (-1791.148) (-1788.945) (-1796.302) * (-1798.543) (-1789.667) [-1794.155] (-1787.116) -- 0:07:18
14000 -- [-1793.843] (-1802.313) (-1794.976) (-1796.129) * (-1793.450) [-1785.788] (-1797.710) (-1804.971) -- 0:07:02
14500 -- (-1790.343) (-1799.704) [-1787.233] (-1792.240) * [-1797.728] (-1801.487) (-1795.285) (-1792.070) -- 0:07:55
15000 -- (-1788.215) (-1796.546) [-1798.160] (-1803.784) * (-1795.720) (-1790.945) (-1784.377) [-1789.328] -- 0:07:39
Average standard deviation of split frequencies: 0.050890
15500 -- [-1783.814] (-1789.979) (-1807.117) (-1796.973) * (-1791.315) [-1789.563] (-1790.394) (-1801.596) -- 0:07:24
16000 -- (-1791.718) [-1788.638] (-1786.575) (-1798.495) * (-1800.731) (-1791.988) (-1797.041) [-1794.038] -- 0:07:10
16500 -- (-1792.769) (-1794.951) [-1788.966] (-1801.170) * (-1801.129) (-1792.016) (-1792.572) [-1794.854] -- 0:07:56
17000 -- (-1788.995) (-1790.715) [-1793.149] (-1794.423) * (-1795.015) (-1796.949) [-1791.160] (-1791.734) -- 0:07:42
17500 -- (-1790.083) [-1802.184] (-1790.162) (-1790.540) * [-1798.246] (-1788.825) (-1800.925) (-1791.178) -- 0:07:29
18000 -- [-1790.189] (-1804.876) (-1789.697) (-1798.558) * [-1798.447] (-1794.384) (-1791.642) (-1784.087) -- 0:07:16
18500 -- [-1785.274] (-1800.050) (-1788.659) (-1792.985) * (-1803.265) (-1796.591) [-1791.133] (-1798.344) -- 0:07:04
19000 -- (-1790.548) (-1798.554) [-1787.315] (-1797.854) * [-1790.342] (-1801.976) (-1797.429) (-1789.106) -- 0:07:44
19500 -- (-1798.739) (-1789.302) [-1789.458] (-1789.770) * (-1790.685) (-1788.680) [-1787.125] (-1792.227) -- 0:07:32
20000 -- (-1798.568) (-1801.884) (-1788.800) [-1785.127] * (-1787.585) (-1794.115) [-1789.149] (-1792.409) -- 0:07:21
Average standard deviation of split frequencies: 0.022810
20500 -- (-1791.074) (-1796.255) [-1786.760] (-1796.483) * [-1790.037] (-1789.423) (-1788.549) (-1795.811) -- 0:07:10
21000 -- (-1793.761) (-1793.923) [-1791.042] (-1797.785) * (-1788.420) [-1784.997] (-1786.409) (-1795.092) -- 0:07:46
21500 -- [-1795.209] (-1796.973) (-1796.772) (-1793.099) * (-1799.765) (-1795.708) [-1790.572] (-1787.562) -- 0:07:35
22000 -- (-1797.801) (-1797.203) [-1788.206] (-1794.244) * [-1794.456] (-1786.210) (-1793.624) (-1788.552) -- 0:07:24
22500 -- [-1791.442] (-1807.709) (-1798.881) (-1792.190) * [-1786.189] (-1790.799) (-1799.304) (-1805.722) -- 0:07:14
23000 -- (-1791.095) [-1788.000] (-1797.679) (-1794.210) * [-1789.475] (-1798.808) (-1792.248) (-1795.654) -- 0:07:47
23500 -- (-1790.257) [-1788.557] (-1788.816) (-1786.141) * (-1792.100) [-1793.748] (-1791.008) (-1797.719) -- 0:07:37
24000 -- (-1800.827) (-1790.404) [-1788.665] (-1792.130) * (-1785.910) (-1798.906) [-1788.617] (-1794.122) -- 0:07:27
24500 -- [-1785.892] (-1796.693) (-1792.071) (-1788.563) * [-1788.952] (-1792.229) (-1792.273) (-1795.343) -- 0:07:57
25000 -- [-1790.005] (-1793.418) (-1795.262) (-1792.945) * (-1805.366) (-1788.036) (-1791.591) [-1792.651] -- 0:07:48
Average standard deviation of split frequencies: 0.019642
25500 -- (-1792.519) [-1790.581] (-1806.238) (-1793.048) * [-1790.600] (-1796.508) (-1797.182) (-1798.027) -- 0:07:38
26000 -- (-1788.898) (-1797.343) (-1791.171) [-1791.906] * (-1791.840) [-1790.156] (-1790.138) (-1795.214) -- 0:07:29
26500 -- (-1787.107) (-1786.665) (-1811.847) [-1787.442] * [-1789.852] (-1792.315) (-1788.514) (-1786.889) -- 0:07:20
27000 -- (-1797.550) [-1790.717] (-1791.114) (-1796.440) * (-1789.479) (-1798.758) (-1790.173) [-1785.382] -- 0:07:48
27500 -- (-1793.353) [-1792.113] (-1790.935) (-1791.706) * (-1792.912) (-1796.300) (-1789.996) [-1789.596] -- 0:07:39
28000 -- [-1790.379] (-1795.394) (-1794.127) (-1792.458) * [-1787.092] (-1785.655) (-1795.539) (-1789.406) -- 0:07:31
28500 -- (-1788.704) [-1797.074] (-1804.213) (-1798.875) * (-1791.546) (-1791.482) [-1794.608] (-1798.639) -- 0:07:23
29000 -- (-1789.810) [-1789.938] (-1795.095) (-1788.998) * (-1789.495) (-1789.815) [-1799.042] (-1794.667) -- 0:07:48
29500 -- (-1789.606) [-1788.534] (-1795.220) (-1794.159) * (-1795.147) [-1786.167] (-1790.209) (-1798.738) -- 0:07:40
30000 -- [-1790.985] (-1792.434) (-1792.352) (-1791.958) * (-1790.040) [-1786.444] (-1794.634) (-1792.475) -- 0:07:32
Average standard deviation of split frequencies: 0.019215
30500 -- (-1788.442) (-1805.241) [-1792.976] (-1807.649) * (-1791.568) (-1797.494) [-1786.705] (-1803.137) -- 0:07:25
31000 -- (-1790.266) (-1788.359) [-1795.585] (-1789.675) * [-1791.726] (-1798.378) (-1791.925) (-1790.349) -- 0:07:48
31500 -- (-1804.244) [-1787.897] (-1795.254) (-1792.017) * [-1786.865] (-1806.220) (-1790.648) (-1787.434) -- 0:07:41
32000 -- (-1791.300) (-1794.630) [-1787.559] (-1791.331) * [-1787.278] (-1789.917) (-1788.617) (-1800.559) -- 0:07:33
32500 -- (-1794.430) (-1785.585) [-1785.776] (-1792.227) * (-1795.938) (-1801.307) (-1794.661) [-1793.196] -- 0:07:26
33000 -- [-1788.403] (-1790.392) (-1800.092) (-1790.704) * [-1794.333] (-1788.773) (-1801.914) (-1798.043) -- 0:07:48
33500 -- (-1790.607) (-1788.655) [-1790.658] (-1793.968) * (-1799.810) (-1793.461) [-1793.135] (-1794.254) -- 0:07:41
34000 -- (-1793.144) (-1785.738) [-1785.407] (-1792.738) * (-1786.958) [-1792.482] (-1795.974) (-1793.244) -- 0:07:34
34500 -- [-1783.630] (-1789.253) (-1795.476) (-1801.924) * (-1798.847) [-1794.166] (-1806.942) (-1794.794) -- 0:07:27
35000 -- [-1792.337] (-1800.095) (-1795.388) (-1793.426) * [-1785.475] (-1796.082) (-1797.757) (-1792.263) -- 0:07:48
Average standard deviation of split frequencies: 0.031645
35500 -- [-1788.644] (-1792.221) (-1796.287) (-1796.066) * [-1788.909] (-1790.066) (-1798.816) (-1795.288) -- 0:07:41
36000 -- (-1796.416) (-1799.437) [-1804.446] (-1796.380) * [-1788.014] (-1793.696) (-1793.366) (-1787.965) -- 0:07:35
36500 -- (-1791.132) (-1794.395) [-1790.831] (-1791.089) * (-1792.020) (-1799.194) (-1792.330) [-1790.358] -- 0:07:55
37000 -- (-1791.713) (-1790.498) (-1785.334) [-1791.019] * (-1793.406) (-1791.398) [-1784.748] (-1788.492) -- 0:07:48
37500 -- [-1785.614] (-1792.150) (-1794.876) (-1794.911) * [-1792.104] (-1804.811) (-1797.215) (-1791.775) -- 0:07:42
38000 -- [-1787.951] (-1796.516) (-1791.391) (-1796.447) * (-1797.017) (-1795.947) (-1798.637) [-1790.805] -- 0:07:35
38500 -- (-1789.480) (-1790.076) [-1789.258] (-1796.588) * (-1792.037) (-1787.225) [-1789.610] (-1792.096) -- 0:07:29
39000 -- [-1791.846] (-1799.733) (-1792.595) (-1791.479) * (-1797.766) (-1796.008) (-1798.038) [-1786.395] -- 0:07:48
39500 -- (-1800.887) (-1797.991) (-1793.966) [-1792.419] * (-1794.120) [-1793.914] (-1804.151) (-1790.822) -- 0:07:42
40000 -- (-1794.247) [-1789.553] (-1792.076) (-1794.667) * [-1789.868] (-1785.869) (-1788.581) (-1796.181) -- 0:07:36
Average standard deviation of split frequencies: 0.032844
40500 -- (-1792.085) (-1786.571) [-1786.801] (-1800.101) * [-1788.157] (-1791.959) (-1793.601) (-1811.761) -- 0:07:53
41000 -- [-1792.069] (-1800.460) (-1802.492) (-1796.126) * (-1786.628) (-1801.125) [-1788.215] (-1796.695) -- 0:07:47
41500 -- (-1792.790) (-1793.768) [-1790.198] (-1797.147) * [-1783.252] (-1798.106) (-1783.807) (-1793.259) -- 0:07:41
42000 -- (-1793.454) (-1795.320) (-1800.482) [-1789.144] * (-1787.702) (-1805.987) (-1795.602) [-1798.252] -- 0:07:36
42500 -- (-1803.392) (-1801.481) [-1793.573] (-1807.205) * (-1805.717) (-1799.524) [-1791.577] (-1796.112) -- 0:07:30
43000 -- (-1793.782) (-1790.226) (-1804.786) [-1794.147] * [-1791.458] (-1804.947) (-1793.419) (-1789.395) -- 0:07:47
43500 -- (-1785.142) (-1790.150) [-1789.438] (-1800.419) * [-1794.502] (-1794.769) (-1787.657) (-1789.471) -- 0:07:41
44000 -- (-1792.328) [-1790.296] (-1791.224) (-1803.277) * [-1788.048] (-1790.090) (-1790.738) (-1803.945) -- 0:07:36
44500 -- (-1802.256) [-1788.748] (-1794.267) (-1797.770) * (-1790.267) [-1793.742] (-1793.767) (-1793.565) -- 0:07:30
45000 -- [-1785.704] (-1801.149) (-1782.963) (-1789.354) * [-1788.164] (-1795.063) (-1791.809) (-1793.529) -- 0:07:46
Average standard deviation of split frequencies: 0.039284
45500 -- [-1788.348] (-1795.910) (-1788.581) (-1794.540) * (-1795.613) (-1791.977) (-1800.313) [-1796.196] -- 0:07:41
46000 -- [-1795.699] (-1796.311) (-1794.612) (-1792.606) * (-1793.057) [-1790.609] (-1799.035) (-1795.746) -- 0:07:36
46500 -- [-1788.835] (-1791.224) (-1796.130) (-1801.903) * (-1794.589) (-1792.113) (-1788.659) [-1791.514] -- 0:07:31
47000 -- (-1794.221) (-1790.562) [-1788.829] (-1797.253) * (-1792.651) (-1785.688) [-1786.688] (-1789.718) -- 0:07:46
47500 -- (-1790.318) (-1791.664) [-1786.024] (-1796.701) * (-1798.831) [-1791.709] (-1793.668) (-1794.226) -- 0:07:41
48000 -- (-1791.116) [-1792.204] (-1794.109) (-1807.907) * [-1789.061] (-1788.382) (-1794.889) (-1799.055) -- 0:07:36
48500 -- (-1794.116) [-1791.679] (-1793.780) (-1796.871) * (-1794.273) (-1789.826) [-1790.716] (-1790.322) -- 0:07:31
49000 -- (-1787.875) (-1791.209) (-1791.708) [-1788.282] * (-1793.675) [-1790.986] (-1793.127) (-1801.285) -- 0:07:26
49500 -- (-1787.430) (-1793.408) (-1800.800) [-1785.971] * (-1793.197) [-1789.601] (-1793.205) (-1787.613) -- 0:07:40
50000 -- (-1788.263) (-1795.640) (-1805.168) [-1788.528] * (-1788.907) (-1800.431) [-1789.061] (-1798.160) -- 0:07:36
Average standard deviation of split frequencies: 0.031013
50500 -- (-1788.312) (-1795.165) (-1790.943) [-1793.653] * [-1791.437] (-1805.064) (-1796.942) (-1795.710) -- 0:07:31
51000 -- (-1791.565) [-1792.227] (-1801.389) (-1790.482) * [-1795.046] (-1800.574) (-1805.918) (-1801.693) -- 0:07:26
51500 -- [-1789.788] (-1793.892) (-1790.895) (-1794.363) * (-1790.798) (-1799.566) [-1793.649] (-1796.463) -- 0:07:40
52000 -- (-1790.814) (-1789.752) (-1792.735) [-1790.100] * (-1783.304) (-1789.676) [-1798.067] (-1787.698) -- 0:07:35
52500 -- (-1794.045) [-1792.590] (-1793.378) (-1803.540) * (-1794.191) [-1787.012] (-1794.479) (-1792.061) -- 0:07:31
53000 -- (-1798.112) (-1789.477) [-1790.128] (-1801.242) * (-1799.243) (-1790.082) [-1788.085] (-1787.489) -- 0:07:26
53500 -- (-1787.713) (-1794.582) (-1794.884) [-1793.351] * (-1795.011) [-1788.170] (-1796.992) (-1788.240) -- 0:07:39
54000 -- (-1791.896) (-1796.894) [-1786.860] (-1796.864) * (-1789.884) (-1792.246) (-1789.731) [-1794.269] -- 0:07:35
54500 -- (-1790.563) (-1797.135) [-1790.897] (-1794.480) * [-1797.297] (-1791.405) (-1797.307) (-1798.231) -- 0:07:31
55000 -- (-1789.471) (-1804.331) (-1791.736) [-1796.757] * (-1801.860) (-1790.020) [-1793.539] (-1799.209) -- 0:07:26
Average standard deviation of split frequencies: 0.026657
55500 -- (-1794.678) (-1797.813) (-1798.969) [-1790.742] * [-1791.500] (-1790.464) (-1795.575) (-1795.036) -- 0:07:39
56000 -- [-1787.040] (-1790.711) (-1806.885) (-1796.801) * (-1794.709) [-1785.462] (-1787.386) (-1805.262) -- 0:07:35
56500 -- (-1796.408) (-1798.236) [-1795.479] (-1789.048) * [-1793.266] (-1791.260) (-1802.448) (-1802.400) -- 0:07:30
57000 -- (-1795.332) (-1795.367) (-1791.549) [-1792.646] * (-1790.888) (-1796.609) [-1790.503] (-1792.759) -- 0:07:26
57500 -- [-1791.235] (-1800.553) (-1796.201) (-1800.024) * [-1789.908] (-1794.646) (-1796.011) (-1801.044) -- 0:07:38
58000 -- (-1797.635) (-1807.399) [-1787.737] (-1788.632) * (-1796.237) [-1789.872] (-1796.535) (-1800.510) -- 0:07:34
58500 -- (-1788.237) (-1792.181) (-1791.402) [-1792.362] * (-1799.588) (-1794.983) [-1788.312] (-1808.668) -- 0:07:30
59000 -- (-1792.378) [-1797.312] (-1800.950) (-1799.073) * (-1796.849) (-1796.837) [-1785.051] (-1797.542) -- 0:07:26
59500 -- (-1790.034) (-1788.394) (-1789.200) [-1797.873] * [-1793.027] (-1788.260) (-1796.426) (-1789.530) -- 0:07:22
60000 -- (-1792.353) [-1798.182] (-1788.073) (-1797.472) * (-1792.571) (-1801.478) (-1803.459) [-1791.528] -- 0:07:34
Average standard deviation of split frequencies: 0.028491
60500 -- (-1802.893) [-1797.848] (-1792.670) (-1791.362) * (-1790.316) (-1791.597) (-1792.002) [-1789.052] -- 0:07:30
61000 -- (-1802.724) [-1797.247] (-1790.533) (-1793.558) * (-1783.615) (-1800.049) [-1792.463] (-1802.469) -- 0:07:26
61500 -- (-1794.627) (-1796.536) [-1802.156] (-1801.931) * (-1787.041) (-1785.540) (-1793.250) [-1789.713] -- 0:07:22
62000 -- (-1790.660) (-1792.952) [-1801.630] (-1789.964) * (-1783.954) [-1785.906] (-1803.335) (-1796.077) -- 0:07:33
62500 -- (-1799.180) (-1797.227) (-1796.423) [-1794.303] * (-1785.258) (-1802.793) [-1796.959] (-1788.672) -- 0:07:30
63000 -- (-1796.820) (-1793.743) [-1790.070] (-1795.789) * (-1792.600) (-1812.449) (-1800.961) [-1792.430] -- 0:07:26
63500 -- (-1788.802) (-1798.048) (-1799.393) [-1790.701] * (-1795.043) (-1793.618) (-1799.599) [-1792.318] -- 0:07:22
64000 -- (-1800.751) [-1790.888] (-1796.183) (-1800.415) * (-1791.079) [-1782.567] (-1800.544) (-1791.092) -- 0:07:33
64500 -- [-1794.439] (-1788.835) (-1800.575) (-1797.077) * [-1786.584] (-1786.036) (-1792.770) (-1786.563) -- 0:07:29
65000 -- (-1792.109) (-1797.489) (-1796.793) [-1787.178] * (-1795.074) (-1791.232) (-1794.177) [-1784.294] -- 0:07:25
Average standard deviation of split frequencies: 0.025594
65500 -- (-1796.408) [-1794.804] (-1790.143) (-1807.310) * (-1791.140) (-1800.084) (-1794.399) [-1794.004] -- 0:07:22
66000 -- (-1792.139) [-1791.128] (-1793.112) (-1787.361) * [-1788.153] (-1791.495) (-1794.096) (-1791.407) -- 0:07:32
66500 -- [-1790.314] (-1788.033) (-1794.757) (-1789.081) * (-1793.946) [-1792.008] (-1787.291) (-1787.167) -- 0:07:29
67000 -- [-1798.195] (-1790.044) (-1793.365) (-1797.351) * [-1794.820] (-1799.299) (-1787.065) (-1792.975) -- 0:07:25
67500 -- [-1794.502] (-1794.628) (-1789.818) (-1804.821) * (-1800.615) [-1786.912] (-1797.821) (-1789.473) -- 0:07:22
68000 -- (-1787.457) [-1789.180] (-1799.008) (-1801.114) * (-1797.384) (-1793.944) (-1798.181) [-1794.124] -- 0:07:32
68500 -- [-1794.638] (-1790.656) (-1798.227) (-1792.950) * (-1793.746) (-1794.236) [-1786.828] (-1796.604) -- 0:07:28
69000 -- [-1795.996] (-1797.182) (-1788.774) (-1793.079) * (-1795.400) (-1793.216) [-1786.103] (-1789.277) -- 0:07:25
69500 -- [-1789.871] (-1793.147) (-1801.173) (-1791.986) * (-1797.192) (-1792.952) [-1788.750] (-1791.557) -- 0:07:21
70000 -- (-1795.615) (-1797.463) (-1791.068) [-1798.347] * (-1786.709) [-1802.637] (-1796.256) (-1796.085) -- 0:07:31
Average standard deviation of split frequencies: 0.024258
70500 -- (-1790.155) (-1798.110) [-1792.253] (-1791.986) * (-1793.989) (-1795.012) [-1795.693] (-1794.206) -- 0:07:28
71000 -- [-1793.835] (-1804.567) (-1786.770) (-1794.402) * (-1787.312) (-1794.296) [-1798.635] (-1793.029) -- 0:07:24
71500 -- (-1792.564) (-1795.085) (-1791.649) [-1788.562] * (-1791.351) (-1789.900) [-1789.808] (-1788.726) -- 0:07:21
72000 -- [-1786.234] (-1793.412) (-1797.718) (-1796.800) * (-1790.104) [-1794.241] (-1799.483) (-1790.715) -- 0:07:31
72500 -- (-1799.249) [-1804.100] (-1806.084) (-1798.577) * [-1785.795] (-1791.975) (-1802.694) (-1793.186) -- 0:07:27
73000 -- [-1795.624] (-1797.330) (-1791.876) (-1804.057) * (-1794.310) (-1792.477) (-1808.036) [-1791.069] -- 0:07:24
73500 -- (-1791.865) [-1790.243] (-1798.014) (-1799.559) * (-1796.910) [-1789.556] (-1801.891) (-1796.918) -- 0:07:21
74000 -- [-1793.734] (-1794.041) (-1799.487) (-1793.496) * (-1796.211) (-1794.556) [-1796.450] (-1809.729) -- 0:07:17
74500 -- (-1793.606) (-1790.272) (-1796.075) [-1792.836] * [-1789.069] (-1798.408) (-1789.585) (-1800.693) -- 0:07:27
75000 -- [-1792.293] (-1808.256) (-1801.684) (-1801.627) * (-1791.203) (-1793.644) (-1797.600) [-1795.489] -- 0:07:24
Average standard deviation of split frequencies: 0.028194
75500 -- (-1790.565) (-1799.946) (-1798.160) [-1789.368] * [-1785.230] (-1806.906) (-1801.312) (-1794.197) -- 0:07:20
76000 -- (-1790.548) (-1798.539) (-1791.518) [-1793.316] * (-1798.425) (-1805.159) (-1790.569) [-1784.882] -- 0:07:17
76500 -- (-1794.947) [-1797.477] (-1796.969) (-1802.809) * [-1794.891] (-1812.139) (-1799.565) (-1793.594) -- 0:07:26
77000 -- (-1794.334) [-1791.283] (-1798.324) (-1791.942) * (-1794.257) (-1797.960) [-1792.571] (-1790.915) -- 0:07:23
77500 -- (-1793.405) [-1789.922] (-1796.476) (-1797.172) * (-1798.431) [-1794.881] (-1792.565) (-1790.602) -- 0:07:20
78000 -- (-1797.454) [-1790.909] (-1794.177) (-1799.218) * (-1791.249) (-1793.035) [-1784.476] (-1801.086) -- 0:07:17
78500 -- [-1794.786] (-1787.358) (-1793.854) (-1794.897) * (-1786.767) (-1794.706) (-1792.995) [-1790.716] -- 0:07:26
79000 -- (-1798.248) [-1790.038] (-1797.369) (-1791.621) * (-1789.780) (-1794.899) (-1796.413) [-1796.305] -- 0:07:23
79500 -- (-1794.967) (-1795.297) [-1785.961] (-1792.434) * (-1792.967) (-1795.616) (-1792.503) [-1790.559] -- 0:07:19
80000 -- [-1795.205] (-1786.003) (-1797.364) (-1788.966) * (-1797.413) (-1798.574) [-1793.487] (-1787.928) -- 0:07:17
Average standard deviation of split frequencies: 0.030282
80500 -- (-1809.120) [-1788.937] (-1796.655) (-1798.865) * (-1802.140) [-1788.023] (-1797.034) (-1799.692) -- 0:07:25
81000 -- (-1793.051) (-1799.730) (-1805.163) [-1793.183] * (-1796.396) (-1789.804) (-1787.347) [-1792.567] -- 0:07:22
81500 -- (-1793.532) (-1795.103) [-1786.595] (-1793.641) * (-1791.191) [-1785.702] (-1789.276) (-1796.194) -- 0:07:19
82000 -- (-1790.735) [-1786.254] (-1790.848) (-1794.684) * (-1789.422) [-1786.440] (-1792.990) (-1799.513) -- 0:07:16
82500 -- (-1788.683) [-1786.240] (-1800.552) (-1803.233) * (-1784.788) (-1796.353) [-1800.037] (-1794.182) -- 0:07:24
83000 -- [-1787.079] (-1788.115) (-1788.456) (-1796.696) * (-1792.717) (-1806.248) [-1792.274] (-1791.904) -- 0:07:21
83500 -- (-1793.744) (-1792.245) [-1796.774] (-1798.282) * (-1795.767) [-1798.847] (-1793.293) (-1794.517) -- 0:07:19
84000 -- [-1785.311] (-1793.347) (-1794.220) (-1793.548) * [-1794.283] (-1805.849) (-1794.561) (-1787.465) -- 0:07:16
84500 -- (-1786.807) (-1790.883) (-1796.666) [-1792.029] * (-1792.999) [-1790.179] (-1789.440) (-1789.099) -- 0:07:13
85000 -- [-1788.693] (-1793.425) (-1801.011) (-1806.790) * (-1796.907) (-1796.376) [-1792.571] (-1793.983) -- 0:07:21
Average standard deviation of split frequencies: 0.032889
85500 -- [-1786.551] (-1796.288) (-1792.378) (-1795.222) * (-1791.896) (-1796.237) [-1787.212] (-1789.137) -- 0:07:18
86000 -- (-1797.397) (-1792.420) [-1789.147] (-1797.935) * [-1787.734] (-1790.770) (-1793.278) (-1799.619) -- 0:07:15
86500 -- (-1789.052) (-1789.354) [-1789.514] (-1798.836) * (-1790.645) [-1794.394] (-1794.585) (-1802.668) -- 0:07:12
87000 -- [-1786.173] (-1807.776) (-1788.237) (-1794.406) * (-1789.546) (-1789.643) [-1789.968] (-1797.545) -- 0:07:20
87500 -- (-1783.880) (-1787.444) [-1786.756] (-1805.051) * (-1791.737) (-1792.209) (-1791.355) [-1791.564] -- 0:07:18
88000 -- [-1784.766] (-1795.705) (-1803.665) (-1793.103) * (-1799.853) (-1795.963) [-1787.833] (-1793.531) -- 0:07:15
88500 -- (-1786.566) (-1788.723) [-1795.202] (-1796.934) * (-1798.180) (-1789.016) (-1794.040) [-1792.389] -- 0:07:12
89000 -- [-1791.733] (-1787.957) (-1800.099) (-1792.285) * (-1795.377) (-1799.912) [-1788.713] (-1786.120) -- 0:07:09
89500 -- (-1793.730) [-1797.360] (-1791.769) (-1798.139) * [-1786.956] (-1799.972) (-1792.744) (-1789.213) -- 0:07:17
90000 -- (-1791.013) (-1799.476) [-1794.862] (-1797.553) * (-1791.443) (-1790.476) (-1793.318) [-1788.807] -- 0:07:14
Average standard deviation of split frequencies: 0.029778
90500 -- (-1794.321) (-1794.663) (-1796.076) [-1786.039] * (-1797.055) (-1799.473) (-1799.737) [-1788.251] -- 0:07:12
91000 -- (-1788.931) (-1796.630) (-1798.504) [-1787.120] * (-1797.592) (-1804.108) [-1794.466] (-1790.215) -- 0:07:09
91500 -- (-1797.086) [-1797.152] (-1792.098) (-1790.513) * (-1789.925) [-1785.203] (-1792.943) (-1792.804) -- 0:07:16
92000 -- (-1787.869) [-1788.680] (-1791.727) (-1790.796) * (-1794.989) (-1794.199) (-1788.788) [-1792.449] -- 0:07:14
92500 -- (-1796.005) [-1787.132] (-1791.640) (-1803.222) * (-1794.548) (-1787.021) [-1787.036] (-1784.345) -- 0:07:11
93000 -- (-1801.413) [-1791.411] (-1793.356) (-1801.941) * (-1796.415) (-1794.821) [-1789.480] (-1798.778) -- 0:07:09
93500 -- [-1799.943] (-1792.971) (-1794.041) (-1786.708) * [-1788.725] (-1789.414) (-1790.921) (-1794.082) -- 0:07:06
94000 -- (-1791.863) (-1791.904) [-1791.095] (-1798.272) * (-1789.238) (-1795.682) (-1795.824) [-1796.237] -- 0:07:13
94500 -- (-1790.070) [-1802.597] (-1799.294) (-1795.051) * [-1790.370] (-1793.564) (-1798.327) (-1789.525) -- 0:07:11
95000 -- (-1789.966) (-1790.716) (-1785.466) [-1790.516] * [-1789.429] (-1792.984) (-1787.782) (-1798.333) -- 0:07:08
Average standard deviation of split frequencies: 0.030802
95500 -- [-1788.295] (-1790.670) (-1807.160) (-1791.806) * [-1789.952] (-1798.268) (-1790.944) (-1798.030) -- 0:07:06
96000 -- (-1790.419) [-1790.041] (-1788.824) (-1793.824) * (-1795.527) (-1793.538) [-1789.903] (-1797.776) -- 0:07:13
96500 -- (-1797.891) [-1789.851] (-1801.242) (-1789.354) * [-1794.501] (-1792.773) (-1795.404) (-1794.602) -- 0:07:10
97000 -- (-1791.661) [-1784.408] (-1792.838) (-1807.924) * (-1797.024) (-1789.238) [-1792.661] (-1795.835) -- 0:07:08
97500 -- [-1787.919] (-1797.131) (-1798.695) (-1795.926) * (-1793.431) [-1789.037] (-1793.209) (-1803.078) -- 0:07:05
98000 -- (-1792.702) (-1792.797) (-1793.134) [-1797.935] * (-1791.061) (-1802.581) [-1797.091] (-1798.347) -- 0:07:03
98500 -- (-1803.948) (-1793.486) (-1789.568) [-1789.577] * [-1784.989] (-1808.108) (-1799.046) (-1800.483) -- 0:07:10
99000 -- (-1802.896) (-1803.388) (-1794.281) [-1791.235] * [-1790.038] (-1799.886) (-1793.803) (-1793.649) -- 0:07:07
99500 -- (-1806.209) (-1813.994) [-1798.219] (-1789.632) * (-1793.682) (-1791.169) (-1790.526) [-1797.593] -- 0:07:05
100000 -- (-1795.044) (-1794.274) (-1795.733) [-1789.573] * (-1790.382) (-1788.355) (-1799.170) [-1793.568] -- 0:07:03
Average standard deviation of split frequencies: 0.032312
100500 -- [-1788.063] (-1803.066) (-1790.037) (-1787.292) * (-1786.797) (-1787.066) [-1783.530] (-1798.474) -- 0:07:00
101000 -- (-1796.561) (-1790.202) [-1791.176] (-1791.743) * [-1787.855] (-1791.186) (-1792.678) (-1787.014) -- 0:07:07
101500 -- [-1793.846] (-1798.142) (-1793.742) (-1789.376) * (-1791.700) (-1791.781) [-1786.402] (-1788.758) -- 0:07:04
102000 -- (-1799.473) [-1783.694] (-1790.499) (-1793.120) * (-1788.746) (-1796.473) [-1789.133] (-1788.950) -- 0:07:02
102500 -- (-1797.717) (-1790.927) [-1788.984] (-1800.479) * (-1793.330) [-1787.586] (-1814.476) (-1791.752) -- 0:07:00
103000 -- (-1791.665) (-1789.830) [-1788.892] (-1798.207) * (-1795.504) [-1786.717] (-1804.918) (-1798.360) -- 0:07:06
103500 -- [-1791.067] (-1794.331) (-1788.722) (-1804.150) * (-1785.800) (-1799.248) [-1789.152] (-1796.527) -- 0:07:04
104000 -- (-1799.830) (-1792.833) [-1789.692] (-1800.351) * (-1790.434) (-1792.632) (-1785.972) [-1789.996] -- 0:07:02
104500 -- (-1787.792) (-1786.393) [-1791.873] (-1806.689) * (-1794.496) (-1796.161) (-1783.547) [-1790.880] -- 0:06:59
105000 -- [-1788.530] (-1784.812) (-1790.971) (-1806.762) * (-1795.450) [-1791.056] (-1801.831) (-1792.013) -- 0:07:06
Average standard deviation of split frequencies: 0.029918
105500 -- (-1791.861) (-1788.595) (-1794.280) [-1797.560] * (-1792.273) (-1789.706) (-1798.867) [-1793.594] -- 0:07:03
106000 -- (-1792.761) [-1792.555] (-1795.630) (-1804.679) * (-1796.792) (-1791.190) [-1796.428] (-1790.188) -- 0:07:01
106500 -- (-1795.386) (-1798.162) (-1799.449) [-1793.752] * (-1807.047) (-1806.029) [-1792.505] (-1795.660) -- 0:06:59
107000 -- (-1804.553) [-1791.895] (-1798.154) (-1790.425) * (-1790.970) (-1794.559) (-1795.879) [-1794.039] -- 0:07:05
107500 -- (-1800.772) [-1784.790] (-1796.651) (-1795.701) * (-1794.957) (-1793.897) (-1785.514) [-1791.227] -- 0:07:03
108000 -- [-1790.960] (-1802.067) (-1790.574) (-1791.190) * (-1792.414) (-1800.847) (-1787.434) [-1791.934] -- 0:07:01
108500 -- [-1800.524] (-1793.674) (-1803.791) (-1805.677) * [-1794.819] (-1791.378) (-1795.804) (-1793.130) -- 0:06:59
109000 -- (-1793.607) (-1790.776) [-1783.693] (-1802.006) * (-1793.662) [-1792.073] (-1794.635) (-1799.644) -- 0:07:05
109500 -- (-1793.389) (-1785.016) [-1795.134] (-1793.642) * (-1797.992) (-1790.889) [-1783.787] (-1792.418) -- 0:07:02
110000 -- (-1799.932) [-1794.955] (-1799.450) (-1793.902) * (-1794.265) (-1797.997) (-1791.074) [-1791.850] -- 0:07:00
Average standard deviation of split frequencies: 0.027494
110500 -- [-1783.112] (-1799.776) (-1794.493) (-1785.290) * (-1790.629) [-1791.553] (-1792.822) (-1798.763) -- 0:06:58
111000 -- [-1785.752] (-1800.509) (-1789.676) (-1799.170) * [-1800.019] (-1795.193) (-1793.179) (-1812.531) -- 0:07:04
111500 -- [-1791.517] (-1793.639) (-1794.967) (-1792.920) * (-1802.795) [-1791.994] (-1801.754) (-1801.294) -- 0:07:02
112000 -- (-1793.584) (-1791.351) [-1793.484] (-1796.205) * (-1796.927) (-1787.949) [-1791.299] (-1791.366) -- 0:07:00
112500 -- (-1802.257) (-1792.269) (-1793.090) [-1794.833] * (-1799.343) [-1801.060] (-1793.456) (-1787.460) -- 0:06:58
113000 -- [-1792.685] (-1798.197) (-1806.113) (-1803.736) * (-1800.244) (-1799.995) [-1790.646] (-1794.964) -- 0:06:56
113500 -- (-1790.865) [-1796.346] (-1789.838) (-1792.069) * (-1806.258) (-1791.094) (-1788.299) [-1794.374] -- 0:07:01
114000 -- (-1786.306) (-1797.004) [-1798.102] (-1791.838) * [-1790.655] (-1812.913) (-1798.840) (-1803.322) -- 0:06:59
114500 -- (-1798.371) (-1796.588) [-1789.893] (-1806.569) * (-1793.509) (-1789.930) [-1791.361] (-1791.199) -- 0:06:57
115000 -- (-1784.647) (-1797.117) [-1794.295] (-1792.898) * (-1797.313) (-1800.673) (-1789.388) [-1787.737] -- 0:06:55
Average standard deviation of split frequencies: 0.022905
115500 -- (-1796.585) (-1798.936) (-1801.705) [-1793.174] * (-1793.565) (-1792.691) [-1788.030] (-1801.021) -- 0:07:01
116000 -- (-1792.188) (-1789.867) (-1798.914) [-1791.667] * (-1790.581) (-1792.407) [-1793.866] (-1790.996) -- 0:06:59
116500 -- [-1787.293] (-1791.210) (-1798.724) (-1796.552) * (-1786.629) (-1792.039) (-1795.892) [-1801.631] -- 0:06:57
117000 -- (-1786.547) [-1793.899] (-1792.731) (-1790.996) * (-1793.458) (-1797.819) (-1788.480) [-1783.125] -- 0:06:55
117500 -- (-1789.307) (-1812.016) [-1789.873] (-1802.674) * [-1788.431] (-1789.267) (-1793.440) (-1792.718) -- 0:06:53
118000 -- (-1798.095) (-1784.463) [-1796.299] (-1793.046) * [-1799.076] (-1790.640) (-1794.258) (-1786.034) -- 0:06:58
118500 -- (-1799.307) (-1795.949) [-1797.059] (-1799.261) * [-1793.925] (-1792.731) (-1793.785) (-1797.926) -- 0:06:56
119000 -- [-1787.644] (-1801.770) (-1801.366) (-1810.345) * [-1789.357] (-1793.786) (-1801.401) (-1796.318) -- 0:06:54
119500 -- (-1795.980) [-1789.918] (-1796.965) (-1797.416) * [-1789.461] (-1797.295) (-1788.937) (-1796.778) -- 0:06:52
120000 -- (-1789.436) (-1802.170) (-1796.325) [-1792.318] * (-1791.316) (-1791.157) (-1786.058) [-1804.330] -- 0:06:50
Average standard deviation of split frequencies: 0.024505
120500 -- (-1800.126) (-1791.928) [-1793.618] (-1791.386) * (-1792.681) (-1798.506) (-1794.249) [-1793.455] -- 0:06:56
121000 -- (-1792.464) (-1796.934) [-1790.402] (-1785.231) * [-1795.493] (-1792.422) (-1788.241) (-1791.364) -- 0:06:54
121500 -- (-1792.503) (-1787.030) [-1789.513] (-1791.164) * (-1792.082) [-1792.893] (-1796.810) (-1790.726) -- 0:06:52
122000 -- (-1793.325) (-1787.527) (-1792.927) [-1792.133] * (-1793.581) [-1785.628] (-1797.132) (-1793.600) -- 0:06:50
122500 -- (-1791.413) (-1792.050) (-1790.505) [-1785.933] * (-1803.169) [-1786.375] (-1788.379) (-1787.784) -- 0:06:55
123000 -- (-1793.718) (-1790.227) (-1796.290) [-1798.523] * (-1790.913) (-1798.608) [-1790.793] (-1792.663) -- 0:06:53
123500 -- [-1786.050] (-1787.942) (-1799.580) (-1795.331) * (-1788.704) [-1797.263] (-1792.913) (-1796.058) -- 0:06:51
124000 -- (-1789.758) (-1796.381) (-1797.824) [-1793.910] * (-1796.774) (-1790.987) (-1797.802) [-1803.806] -- 0:06:49
124500 -- [-1789.801] (-1804.230) (-1802.091) (-1791.232) * (-1792.390) [-1789.612] (-1788.068) (-1787.045) -- 0:06:54
125000 -- (-1786.725) (-1799.279) (-1803.201) [-1790.422] * [-1789.874] (-1798.355) (-1789.450) (-1790.090) -- 0:06:53
Average standard deviation of split frequencies: 0.021768
125500 -- (-1788.975) [-1784.052] (-1795.248) (-1800.107) * (-1793.355) [-1791.165] (-1789.349) (-1794.523) -- 0:06:51
126000 -- (-1797.517) (-1797.841) (-1793.218) [-1792.820] * (-1785.679) [-1787.249] (-1793.065) (-1801.393) -- 0:06:49
126500 -- [-1796.221] (-1807.820) (-1786.966) (-1797.398) * (-1798.898) (-1788.538) (-1793.487) [-1799.004] -- 0:06:54
127000 -- [-1790.896] (-1790.436) (-1787.534) (-1789.195) * (-1794.092) [-1789.191] (-1796.088) (-1789.005) -- 0:06:52
127500 -- [-1792.282] (-1787.608) (-1789.244) (-1800.104) * (-1803.901) (-1792.620) [-1794.432] (-1791.249) -- 0:06:50
128000 -- (-1795.966) (-1787.049) [-1792.086] (-1788.644) * (-1792.407) (-1802.601) [-1783.413] (-1790.415) -- 0:06:48
128500 -- (-1799.438) [-1792.261] (-1796.668) (-1791.807) * (-1799.159) (-1792.935) (-1792.706) [-1784.995] -- 0:06:53
129000 -- (-1797.150) (-1789.735) (-1802.360) [-1789.895] * (-1791.568) (-1794.171) (-1791.679) [-1781.307] -- 0:06:51
129500 -- (-1797.882) (-1801.081) (-1795.553) [-1793.188] * (-1797.691) (-1788.961) (-1783.408) [-1782.483] -- 0:06:50
130000 -- (-1792.192) (-1803.673) (-1789.665) [-1794.756] * [-1784.468] (-1796.014) (-1789.531) (-1790.562) -- 0:06:48
Average standard deviation of split frequencies: 0.018366
130500 -- (-1792.110) (-1806.119) [-1790.997] (-1803.547) * (-1789.785) (-1793.419) (-1796.130) [-1790.121] -- 0:06:53
131000 -- (-1799.573) (-1786.184) [-1784.577] (-1798.118) * (-1807.569) (-1797.415) (-1794.781) [-1791.718] -- 0:06:51
131500 -- (-1805.281) [-1791.258] (-1787.224) (-1808.111) * (-1795.467) [-1789.426] (-1801.119) (-1790.350) -- 0:06:49
132000 -- [-1791.604] (-1789.566) (-1798.483) (-1804.678) * (-1785.851) [-1792.432] (-1807.125) (-1784.345) -- 0:06:54
132500 -- [-1791.339] (-1788.925) (-1803.205) (-1795.707) * (-1795.214) (-1795.569) (-1791.477) [-1788.304] -- 0:06:52
133000 -- (-1799.000) (-1784.835) [-1786.731] (-1797.883) * (-1790.346) (-1800.395) (-1787.088) [-1794.378] -- 0:06:50
133500 -- (-1792.641) (-1799.770) (-1790.724) [-1795.509] * (-1793.604) [-1789.232] (-1800.816) (-1780.515) -- 0:06:48
134000 -- [-1784.976] (-1797.405) (-1788.197) (-1794.326) * (-1790.036) [-1798.503] (-1791.903) (-1787.416) -- 0:06:53
134500 -- (-1784.105) [-1796.444] (-1796.058) (-1791.760) * (-1794.022) (-1797.607) (-1802.088) [-1791.921] -- 0:06:51
135000 -- [-1786.549] (-1797.739) (-1800.550) (-1786.357) * (-1788.226) (-1799.302) (-1803.412) [-1793.442] -- 0:06:50
Average standard deviation of split frequencies: 0.016386
135500 -- (-1789.684) [-1790.593] (-1800.269) (-1785.565) * [-1790.801] (-1788.949) (-1783.062) (-1799.485) -- 0:06:48
136000 -- (-1789.199) (-1792.411) [-1793.539] (-1802.199) * (-1799.915) (-1795.126) (-1791.612) [-1795.068] -- 0:06:46
136500 -- (-1791.550) (-1796.053) [-1797.516] (-1801.863) * (-1794.078) [-1792.765] (-1788.658) (-1794.921) -- 0:06:51
137000 -- (-1798.742) (-1793.905) (-1789.110) [-1783.086] * [-1789.880] (-1794.080) (-1789.235) (-1795.919) -- 0:06:49
137500 -- (-1785.036) (-1797.983) [-1791.207] (-1789.622) * (-1789.442) (-1793.261) (-1790.014) [-1787.441] -- 0:06:47
138000 -- [-1790.263] (-1794.894) (-1787.661) (-1792.847) * (-1789.233) (-1790.560) (-1796.285) [-1791.490] -- 0:06:46
138500 -- (-1790.071) [-1798.954] (-1801.983) (-1793.430) * [-1789.606] (-1801.110) (-1790.694) (-1792.260) -- 0:06:50
139000 -- [-1785.780] (-1796.526) (-1789.989) (-1788.015) * (-1792.348) [-1791.331] (-1790.238) (-1791.330) -- 0:06:48
139500 -- (-1790.300) [-1786.616] (-1793.712) (-1803.731) * (-1804.336) [-1788.945] (-1786.021) (-1792.356) -- 0:06:47
140000 -- (-1789.941) [-1785.992] (-1793.793) (-1796.294) * [-1795.955] (-1803.207) (-1790.387) (-1799.109) -- 0:06:45
Average standard deviation of split frequencies: 0.014928
140500 -- (-1791.567) (-1791.157) (-1809.511) [-1806.952] * (-1792.334) [-1803.361] (-1784.908) (-1790.514) -- 0:06:49
141000 -- [-1786.652] (-1791.902) (-1792.749) (-1792.249) * (-1795.460) (-1795.894) [-1792.809] (-1787.327) -- 0:06:48
141500 -- [-1788.402] (-1797.400) (-1799.570) (-1788.216) * [-1790.454] (-1800.328) (-1792.329) (-1790.444) -- 0:06:46
142000 -- (-1790.737) (-1788.406) (-1795.253) [-1793.774] * [-1792.584] (-1798.975) (-1789.550) (-1798.892) -- 0:06:44
142500 -- (-1801.389) (-1795.853) [-1790.208] (-1804.073) * (-1790.931) (-1798.326) (-1801.045) [-1790.226] -- 0:06:49
143000 -- (-1793.856) (-1800.084) [-1795.913] (-1795.910) * [-1793.326] (-1803.673) (-1799.282) (-1787.678) -- 0:06:47
143500 -- (-1792.870) (-1793.503) [-1791.687] (-1792.386) * [-1792.779] (-1793.532) (-1791.395) (-1787.596) -- 0:06:45
144000 -- (-1793.655) (-1790.391) [-1789.969] (-1798.157) * (-1786.729) (-1790.753) [-1787.868] (-1791.197) -- 0:06:44
144500 -- [-1791.782] (-1797.221) (-1794.685) (-1792.588) * [-1786.914] (-1788.633) (-1788.807) (-1787.798) -- 0:06:48
145000 -- [-1800.480] (-1793.104) (-1788.641) (-1793.743) * (-1796.899) (-1798.300) [-1787.572] (-1789.339) -- 0:06:46
Average standard deviation of split frequencies: 0.014383
145500 -- (-1791.454) (-1789.331) [-1795.172] (-1788.429) * (-1789.329) (-1801.079) (-1797.406) [-1792.353] -- 0:06:45
146000 -- [-1789.302] (-1793.911) (-1784.176) (-1793.146) * (-1796.693) [-1796.906] (-1795.806) (-1799.937) -- 0:06:43
146500 -- (-1797.679) (-1804.710) (-1790.478) [-1787.985] * (-1793.930) (-1792.652) [-1794.618] (-1785.389) -- 0:06:41
147000 -- (-1797.691) (-1805.796) (-1798.601) [-1789.108] * [-1791.427] (-1795.669) (-1801.441) (-1784.609) -- 0:06:46
147500 -- (-1792.129) (-1804.902) (-1789.641) [-1794.799] * [-1783.781] (-1792.428) (-1794.544) (-1800.658) -- 0:06:44
148000 -- [-1799.942] (-1793.950) (-1798.592) (-1803.635) * [-1786.666] (-1797.626) (-1798.827) (-1789.549) -- 0:06:42
148500 -- (-1789.448) (-1801.756) [-1795.582] (-1795.426) * (-1796.611) [-1788.366] (-1790.255) (-1798.767) -- 0:06:41
149000 -- (-1787.107) (-1803.187) (-1791.430) [-1794.688] * (-1797.095) [-1790.813] (-1786.661) (-1797.677) -- 0:06:45
149500 -- (-1792.945) (-1804.609) (-1797.954) [-1793.536] * (-1791.274) (-1796.255) (-1790.219) [-1784.853] -- 0:06:43
150000 -- [-1788.891] (-1790.425) (-1799.760) (-1794.236) * (-1797.309) (-1792.639) (-1792.074) [-1789.843] -- 0:06:42
Average standard deviation of split frequencies: 0.015928
150500 -- [-1789.883] (-1793.275) (-1796.371) (-1796.235) * (-1788.893) [-1786.085] (-1794.016) (-1785.967) -- 0:06:40
151000 -- (-1789.505) (-1793.807) (-1797.521) [-1785.764] * (-1791.092) (-1789.603) (-1796.797) [-1793.958] -- 0:06:44
151500 -- [-1794.573] (-1799.736) (-1794.994) (-1796.174) * (-1792.138) [-1790.553] (-1789.959) (-1788.011) -- 0:06:43
152000 -- [-1792.042] (-1795.294) (-1796.550) (-1792.727) * [-1794.901] (-1788.788) (-1786.762) (-1786.068) -- 0:06:41
152500 -- (-1793.183) (-1803.540) [-1790.240] (-1789.028) * (-1793.029) (-1794.213) (-1796.936) [-1793.397] -- 0:06:40
153000 -- (-1792.343) (-1787.691) [-1791.100] (-1793.161) * (-1792.985) (-1792.792) (-1793.667) [-1791.331] -- 0:06:38
153500 -- (-1797.069) [-1782.843] (-1788.994) (-1793.174) * (-1794.156) (-1798.400) (-1788.061) [-1784.870] -- 0:06:42
154000 -- [-1789.789] (-1788.691) (-1785.646) (-1796.479) * (-1790.703) (-1796.641) (-1789.953) [-1793.802] -- 0:06:41
154500 -- (-1790.856) [-1800.116] (-1790.048) (-1788.365) * [-1786.648] (-1793.818) (-1788.961) (-1790.719) -- 0:06:39
155000 -- [-1791.542] (-1795.027) (-1796.245) (-1795.218) * (-1787.992) (-1788.104) [-1795.654] (-1794.399) -- 0:06:37
Average standard deviation of split frequencies: 0.013461
155500 -- (-1791.989) [-1787.095] (-1797.879) (-1796.070) * (-1787.970) (-1784.950) [-1795.668] (-1797.341) -- 0:06:41
156000 -- [-1793.696] (-1791.153) (-1799.224) (-1795.233) * (-1793.099) (-1794.875) [-1789.720] (-1803.454) -- 0:06:40
156500 -- (-1789.811) [-1784.239] (-1795.829) (-1791.198) * [-1789.899] (-1794.205) (-1790.910) (-1794.470) -- 0:06:38
157000 -- (-1792.024) (-1789.236) (-1803.246) [-1787.437] * (-1795.997) (-1787.567) [-1785.858] (-1801.562) -- 0:06:37
157500 -- [-1791.614] (-1798.399) (-1791.914) (-1793.836) * (-1795.966) [-1785.013] (-1794.615) (-1796.596) -- 0:06:41
158000 -- (-1795.563) (-1791.988) (-1795.652) [-1785.418] * (-1789.987) [-1795.976] (-1792.226) (-1794.565) -- 0:06:39
158500 -- (-1794.974) [-1790.317] (-1797.409) (-1787.803) * (-1799.115) (-1792.641) (-1794.116) [-1789.768] -- 0:06:38
159000 -- (-1790.514) [-1798.395] (-1788.993) (-1790.148) * (-1794.730) [-1784.601] (-1792.722) (-1795.873) -- 0:06:36
159500 -- [-1788.426] (-1791.430) (-1796.945) (-1803.390) * (-1798.471) (-1788.088) [-1793.058] (-1795.613) -- 0:06:35
160000 -- (-1787.936) [-1787.218] (-1788.387) (-1799.426) * (-1804.210) (-1792.542) [-1794.570] (-1785.252) -- 0:06:39
Average standard deviation of split frequencies: 0.015204
160500 -- (-1802.924) [-1787.344] (-1795.147) (-1802.512) * [-1792.951] (-1790.181) (-1794.567) (-1789.914) -- 0:06:37
161000 -- (-1798.595) (-1795.699) [-1791.660] (-1794.960) * (-1794.414) [-1789.022] (-1797.047) (-1791.909) -- 0:06:36
161500 -- [-1783.667] (-1793.636) (-1808.380) (-1785.742) * [-1790.825] (-1789.271) (-1791.927) (-1795.589) -- 0:06:34
162000 -- (-1792.078) [-1788.837] (-1794.440) (-1798.985) * (-1791.972) [-1789.351] (-1795.510) (-1786.227) -- 0:06:38
162500 -- (-1798.879) [-1798.931] (-1788.865) (-1794.575) * (-1787.359) (-1788.919) (-1791.683) [-1792.728] -- 0:06:36
163000 -- [-1782.774] (-1802.064) (-1792.786) (-1781.660) * (-1791.467) [-1795.277] (-1802.376) (-1805.935) -- 0:06:35
163500 -- (-1793.509) (-1799.326) (-1800.531) [-1791.229] * (-1792.444) (-1789.453) (-1793.835) [-1791.534] -- 0:06:33
164000 -- (-1791.347) (-1795.391) (-1793.749) [-1790.825] * (-1788.080) (-1795.028) (-1790.832) [-1792.998] -- 0:06:32
164500 -- (-1792.547) [-1786.736] (-1792.658) (-1798.643) * (-1789.134) (-1796.734) [-1792.822] (-1796.243) -- 0:06:36
165000 -- (-1807.866) (-1790.968) [-1799.744] (-1796.755) * (-1789.135) [-1790.588] (-1792.803) (-1798.685) -- 0:06:34
Average standard deviation of split frequencies: 0.015232
165500 -- (-1789.210) (-1790.246) (-1803.814) [-1786.376] * (-1790.383) (-1793.294) [-1795.900] (-1804.593) -- 0:06:33
166000 -- [-1795.446] (-1792.564) (-1789.668) (-1788.710) * (-1790.262) (-1795.208) [-1792.536] (-1811.665) -- 0:06:31
166500 -- (-1794.997) (-1788.312) (-1805.473) [-1791.914] * (-1798.187) (-1794.025) (-1798.350) [-1792.604] -- 0:06:35
167000 -- (-1790.830) [-1789.888] (-1796.519) (-1794.216) * (-1796.726) [-1793.168] (-1799.632) (-1793.546) -- 0:06:34
167500 -- (-1791.467) (-1794.667) (-1792.475) [-1794.688] * (-1795.573) [-1789.050] (-1791.003) (-1796.344) -- 0:06:32
168000 -- (-1790.935) [-1789.772] (-1789.893) (-1798.282) * (-1795.942) [-1792.392] (-1787.615) (-1795.061) -- 0:06:31
168500 -- (-1790.172) (-1794.485) (-1798.614) [-1789.983] * (-1796.586) (-1795.123) [-1786.671] (-1796.689) -- 0:06:34
169000 -- (-1790.150) [-1794.326] (-1791.221) (-1785.844) * [-1790.143] (-1799.566) (-1800.713) (-1799.556) -- 0:06:33
169500 -- (-1793.688) (-1798.085) (-1796.801) [-1787.756] * (-1794.176) [-1797.531] (-1797.994) (-1791.057) -- 0:06:31
170000 -- (-1795.802) (-1798.553) (-1796.506) [-1790.473] * (-1793.237) (-1797.661) (-1789.240) [-1797.275] -- 0:06:30
Average standard deviation of split frequencies: 0.013308
170500 -- (-1795.532) [-1792.013] (-1789.599) (-1794.481) * (-1780.328) (-1794.788) [-1786.902] (-1793.263) -- 0:06:34
171000 -- [-1791.285] (-1791.005) (-1798.393) (-1786.617) * (-1793.828) (-1792.952) [-1788.137] (-1788.034) -- 0:06:32
171500 -- (-1798.642) (-1793.127) [-1789.758] (-1797.799) * (-1790.794) (-1795.463) (-1793.459) [-1791.579] -- 0:06:31
172000 -- (-1794.031) [-1790.401] (-1799.210) (-1793.452) * [-1793.091] (-1786.159) (-1792.141) (-1789.539) -- 0:06:29
172500 -- (-1791.715) [-1786.749] (-1796.562) (-1796.258) * (-1794.025) (-1801.239) (-1788.225) [-1792.736] -- 0:06:33
173000 -- (-1799.637) (-1790.043) (-1811.904) [-1785.705] * (-1793.708) [-1788.227] (-1788.658) (-1791.770) -- 0:06:31
173500 -- [-1791.592] (-1797.179) (-1803.427) (-1785.757) * (-1788.760) [-1793.260] (-1788.861) (-1802.428) -- 0:06:30
174000 -- (-1796.406) [-1786.556] (-1785.265) (-1788.557) * (-1794.355) (-1791.796) [-1793.246] (-1791.027) -- 0:06:29
174500 -- (-1794.576) (-1797.826) [-1791.473] (-1787.435) * (-1793.828) (-1798.395) [-1787.015] (-1795.828) -- 0:06:32
175000 -- (-1793.465) (-1791.751) [-1793.341] (-1795.503) * (-1797.794) (-1793.401) (-1794.221) [-1788.956] -- 0:06:31
Average standard deviation of split frequencies: 0.018993
175500 -- [-1789.616] (-1787.434) (-1794.508) (-1789.855) * (-1796.402) (-1786.645) (-1794.594) [-1792.164] -- 0:06:29
176000 -- (-1794.847) (-1790.313) (-1795.206) [-1792.694] * (-1795.351) [-1792.365] (-1804.166) (-1787.365) -- 0:06:28
176500 -- (-1793.349) (-1790.633) [-1785.479] (-1790.833) * (-1796.586) (-1793.731) [-1785.192] (-1790.314) -- 0:06:31
177000 -- (-1793.561) (-1792.138) [-1783.656] (-1787.448) * (-1800.024) (-1790.015) [-1786.675] (-1791.028) -- 0:06:30
177500 -- (-1791.304) (-1783.796) (-1793.487) [-1797.719] * [-1792.345] (-1782.722) (-1799.701) (-1797.511) -- 0:06:29
178000 -- (-1787.834) (-1790.271) [-1794.177] (-1800.201) * [-1795.588] (-1789.123) (-1791.734) (-1796.078) -- 0:06:27
178500 -- (-1793.771) (-1792.505) [-1790.794] (-1789.040) * (-1796.591) [-1790.025] (-1793.508) (-1790.671) -- 0:06:31
179000 -- (-1802.177) [-1791.506] (-1792.067) (-1795.593) * (-1788.520) (-1785.372) [-1794.931] (-1812.311) -- 0:06:29
179500 -- (-1793.794) (-1789.755) (-1800.258) [-1790.601] * (-1783.230) (-1801.165) [-1784.386] (-1787.590) -- 0:06:28
180000 -- (-1786.470) [-1789.545] (-1793.913) (-1795.588) * (-1796.981) (-1789.055) (-1789.181) [-1791.973] -- 0:06:27
Average standard deviation of split frequencies: 0.018976
180500 -- (-1790.071) [-1792.548] (-1785.995) (-1797.964) * (-1787.629) (-1795.601) [-1788.114] (-1805.044) -- 0:06:30
181000 -- [-1794.415] (-1787.641) (-1795.087) (-1803.203) * (-1794.522) [-1790.096] (-1794.411) (-1798.419) -- 0:06:29
181500 -- (-1785.273) [-1786.090] (-1791.714) (-1784.815) * [-1793.507] (-1793.138) (-1798.688) (-1788.589) -- 0:06:27
182000 -- (-1794.567) (-1796.322) (-1803.137) [-1791.426] * [-1782.188] (-1788.595) (-1799.834) (-1789.518) -- 0:06:26
182500 -- [-1792.535] (-1793.448) (-1809.136) (-1791.190) * [-1790.048] (-1793.441) (-1797.879) (-1790.511) -- 0:06:25
183000 -- (-1791.007) (-1802.546) (-1793.119) [-1791.927] * (-1795.112) (-1790.116) (-1796.812) [-1798.650] -- 0:06:28
183500 -- (-1792.390) (-1804.224) (-1794.268) [-1790.126] * [-1793.119] (-1789.901) (-1799.363) (-1793.335) -- 0:06:27
184000 -- (-1802.700) [-1797.466] (-1782.563) (-1797.016) * (-1793.705) (-1791.859) [-1792.146] (-1800.808) -- 0:06:25
184500 -- (-1800.536) (-1792.997) [-1795.014] (-1787.645) * [-1790.634] (-1789.746) (-1803.991) (-1798.237) -- 0:06:24
185000 -- [-1795.174] (-1788.599) (-1797.008) (-1791.453) * [-1788.960] (-1790.859) (-1792.034) (-1791.588) -- 0:06:27
Average standard deviation of split frequencies: 0.016359
185500 -- (-1800.110) [-1785.512] (-1795.575) (-1792.303) * [-1793.224] (-1782.684) (-1787.975) (-1809.795) -- 0:06:26
186000 -- (-1794.508) (-1788.595) (-1793.742) [-1787.398] * (-1800.402) [-1791.595] (-1789.340) (-1795.884) -- 0:06:25
186500 -- [-1789.270] (-1791.653) (-1793.106) (-1796.943) * (-1798.961) [-1790.446] (-1792.963) (-1787.136) -- 0:06:23
187000 -- (-1788.171) (-1783.753) [-1790.028] (-1791.913) * (-1790.249) (-1789.215) [-1788.078] (-1790.548) -- 0:06:26
187500 -- (-1797.416) (-1789.960) (-1788.041) [-1796.782] * [-1797.766] (-1794.311) (-1801.947) (-1800.969) -- 0:06:25
188000 -- (-1796.049) (-1797.168) (-1793.941) [-1784.827] * (-1794.745) (-1792.857) (-1804.213) [-1790.143] -- 0:06:24
188500 -- (-1797.400) (-1793.888) [-1788.646] (-1793.558) * (-1787.128) [-1788.394] (-1791.994) (-1800.610) -- 0:06:23
189000 -- (-1790.401) (-1785.619) [-1790.979] (-1787.495) * (-1794.227) [-1789.710] (-1804.641) (-1796.464) -- 0:06:26
189500 -- (-1789.113) (-1795.674) (-1788.917) [-1789.677] * (-1806.651) (-1797.141) [-1793.032] (-1792.551) -- 0:06:24
190000 -- (-1793.367) (-1793.081) [-1784.074] (-1788.756) * (-1791.229) [-1790.738] (-1798.079) (-1789.012) -- 0:06:23
Average standard deviation of split frequencies: 0.016183
190500 -- [-1791.264] (-1791.110) (-1788.622) (-1784.460) * [-1787.504] (-1793.819) (-1798.471) (-1792.054) -- 0:06:22
191000 -- (-1789.139) (-1796.305) (-1789.036) [-1789.454] * (-1799.981) [-1793.080] (-1807.425) (-1785.734) -- 0:06:25
191500 -- (-1792.963) [-1791.022] (-1799.156) (-1788.729) * (-1793.962) (-1795.700) (-1791.436) [-1791.040] -- 0:06:24
192000 -- (-1791.991) [-1794.082] (-1786.261) (-1802.694) * [-1794.389] (-1796.273) (-1788.558) (-1786.339) -- 0:06:22
192500 -- (-1793.276) [-1791.544] (-1781.395) (-1805.568) * (-1789.657) (-1801.760) [-1790.518] (-1794.533) -- 0:06:21
193000 -- (-1786.683) [-1794.484] (-1790.990) (-1787.457) * (-1799.118) [-1785.045] (-1796.438) (-1796.548) -- 0:06:20
193500 -- [-1786.886] (-1786.793) (-1790.601) (-1792.722) * (-1793.758) (-1786.392) (-1787.654) [-1790.616] -- 0:06:23
194000 -- [-1786.427] (-1789.503) (-1783.169) (-1800.502) * (-1791.978) [-1790.594] (-1795.126) (-1792.423) -- 0:06:22
194500 -- [-1793.062] (-1788.246) (-1791.494) (-1792.440) * (-1798.987) (-1792.023) (-1792.660) [-1797.452] -- 0:06:21
195000 -- [-1787.754] (-1791.881) (-1790.372) (-1795.787) * (-1790.817) (-1794.182) (-1799.639) [-1788.736] -- 0:06:19
Average standard deviation of split frequencies: 0.017273
195500 -- (-1796.294) (-1797.138) (-1785.498) [-1790.223] * [-1791.033] (-1790.760) (-1794.728) (-1792.242) -- 0:06:22
196000 -- (-1797.802) (-1793.277) [-1789.501] (-1799.378) * (-1801.147) (-1793.068) [-1788.728] (-1793.836) -- 0:06:21
196500 -- (-1798.209) (-1795.804) [-1796.512] (-1795.041) * (-1800.644) [-1789.678] (-1790.118) (-1795.017) -- 0:06:20
197000 -- (-1794.532) (-1796.566) (-1793.187) [-1789.448] * (-1798.507) (-1790.672) [-1791.350] (-1797.981) -- 0:06:19
197500 -- (-1790.643) (-1792.809) (-1791.177) [-1788.204] * (-1794.776) (-1789.538) (-1795.074) [-1789.302] -- 0:06:21
198000 -- (-1790.590) (-1786.195) (-1796.719) [-1796.435] * (-1793.756) (-1798.273) (-1793.404) [-1790.940] -- 0:06:20
198500 -- [-1794.578] (-1789.169) (-1811.473) (-1795.511) * [-1794.835] (-1787.821) (-1793.230) (-1788.824) -- 0:06:19
199000 -- (-1790.353) (-1792.266) (-1792.804) [-1792.724] * [-1792.199] (-1797.871) (-1793.488) (-1788.555) -- 0:06:18
199500 -- (-1790.764) (-1791.575) [-1796.286] (-1803.034) * (-1794.521) (-1800.447) (-1795.099) [-1786.538] -- 0:06:17
200000 -- (-1797.680) (-1791.851) (-1796.217) [-1787.547] * (-1789.797) [-1789.830] (-1805.074) (-1796.450) -- 0:06:20
Average standard deviation of split frequencies: 0.016658
200500 -- (-1789.959) [-1791.521] (-1789.705) (-1794.424) * (-1800.452) (-1794.813) (-1793.964) [-1789.027] -- 0:06:18
201000 -- (-1787.523) [-1790.090] (-1804.817) (-1799.111) * [-1792.574] (-1794.911) (-1792.603) (-1797.838) -- 0:06:17
201500 -- (-1789.274) (-1793.399) (-1791.665) [-1789.896] * (-1796.258) (-1805.809) (-1797.297) [-1785.887] -- 0:06:16
202000 -- (-1796.528) [-1787.572] (-1797.078) (-1795.514) * (-1804.253) [-1784.492] (-1796.411) (-1797.074) -- 0:06:19
202500 -- (-1793.927) [-1787.688] (-1792.130) (-1788.726) * (-1800.832) (-1784.030) [-1789.820] (-1792.922) -- 0:06:18
203000 -- [-1788.633] (-1789.055) (-1789.538) (-1802.954) * [-1793.102] (-1790.627) (-1794.413) (-1787.650) -- 0:06:16
203500 -- [-1793.382] (-1800.698) (-1799.356) (-1793.064) * [-1792.325] (-1799.847) (-1795.260) (-1790.344) -- 0:06:15
204000 -- (-1795.746) (-1791.791) [-1788.460] (-1796.076) * [-1795.483] (-1788.855) (-1796.843) (-1793.767) -- 0:06:18
204500 -- (-1802.817) (-1795.338) [-1786.049] (-1792.078) * [-1792.742] (-1791.161) (-1794.531) (-1789.802) -- 0:06:17
205000 -- [-1792.746] (-1792.620) (-1784.683) (-1793.064) * [-1794.703] (-1803.657) (-1805.765) (-1784.663) -- 0:06:16
Average standard deviation of split frequencies: 0.016227
205500 -- (-1792.757) (-1806.110) [-1786.733] (-1789.695) * [-1790.203] (-1795.448) (-1802.679) (-1794.145) -- 0:06:15
206000 -- [-1792.415] (-1788.241) (-1796.434) (-1793.666) * (-1794.104) [-1794.802] (-1804.354) (-1799.533) -- 0:06:13
206500 -- [-1790.594] (-1798.592) (-1801.706) (-1794.569) * (-1800.098) [-1794.955] (-1792.409) (-1800.472) -- 0:06:16
207000 -- (-1788.686) [-1798.067] (-1800.753) (-1793.383) * (-1790.841) [-1785.615] (-1802.032) (-1793.423) -- 0:06:15
207500 -- [-1798.908] (-1791.285) (-1792.055) (-1797.731) * [-1792.777] (-1788.299) (-1796.041) (-1798.447) -- 0:06:14
208000 -- (-1792.250) [-1794.155] (-1792.166) (-1792.488) * (-1801.265) (-1795.070) [-1788.588] (-1798.878) -- 0:06:13
208500 -- (-1789.297) (-1798.520) [-1799.082] (-1788.521) * (-1791.225) (-1790.037) (-1788.781) [-1788.208] -- 0:06:15
209000 -- (-1799.354) (-1798.081) [-1793.906] (-1785.118) * [-1791.061] (-1786.874) (-1787.493) (-1793.268) -- 0:06:14
209500 -- [-1787.333] (-1795.893) (-1790.237) (-1789.678) * (-1791.400) (-1800.891) [-1787.014] (-1799.593) -- 0:06:13
210000 -- (-1793.327) [-1790.645] (-1795.173) (-1795.447) * [-1789.509] (-1791.218) (-1786.138) (-1805.669) -- 0:06:16
Average standard deviation of split frequencies: 0.017901
210500 -- (-1791.218) (-1796.889) [-1790.672] (-1786.903) * (-1782.764) (-1796.410) [-1789.880] (-1800.460) -- 0:06:15
211000 -- (-1795.699) (-1794.357) [-1785.497] (-1786.294) * (-1797.971) (-1789.566) [-1797.645] (-1801.953) -- 0:06:13
211500 -- [-1787.709] (-1792.781) (-1791.128) (-1793.414) * (-1799.613) [-1783.366] (-1788.324) (-1795.029) -- 0:06:12
212000 -- (-1802.990) (-1804.168) [-1792.483] (-1788.864) * (-1796.745) (-1789.542) (-1798.252) [-1790.289] -- 0:06:11
212500 -- (-1798.367) (-1792.898) [-1786.995] (-1789.213) * [-1801.744] (-1797.655) (-1806.709) (-1796.497) -- 0:06:14
213000 -- [-1794.169] (-1793.775) (-1796.775) (-1787.849) * (-1797.465) (-1797.392) (-1804.225) [-1792.234] -- 0:06:13
213500 -- (-1797.709) (-1787.969) [-1791.990] (-1791.573) * [-1791.434] (-1800.042) (-1796.413) (-1791.267) -- 0:06:12
214000 -- (-1790.318) [-1799.377] (-1796.975) (-1788.932) * (-1794.699) [-1789.138] (-1795.227) (-1802.344) -- 0:06:10
214500 -- (-1793.380) [-1797.123] (-1794.061) (-1791.122) * (-1797.318) (-1794.365) [-1798.244] (-1800.873) -- 0:06:13
215000 -- (-1794.877) (-1797.441) (-1793.355) [-1790.348] * (-1799.037) (-1788.581) [-1793.031] (-1801.537) -- 0:06:12
Average standard deviation of split frequencies: 0.017856
215500 -- [-1785.299] (-1799.927) (-1789.470) (-1789.083) * (-1785.739) (-1807.087) (-1796.928) [-1787.660] -- 0:06:11
216000 -- (-1794.399) (-1795.487) [-1790.246] (-1800.093) * [-1784.408] (-1804.812) (-1788.850) (-1800.701) -- 0:06:10
216500 -- (-1794.277) [-1793.838] (-1802.417) (-1797.782) * (-1801.008) (-1797.896) [-1793.313] (-1798.796) -- 0:06:12
217000 -- (-1798.436) (-1802.772) [-1788.715] (-1787.457) * (-1798.575) (-1793.247) [-1797.212] (-1799.539) -- 0:06:11
217500 -- (-1798.470) [-1792.076] (-1801.224) (-1800.754) * (-1786.901) [-1790.473] (-1797.749) (-1795.503) -- 0:06:10
218000 -- [-1789.916] (-1797.519) (-1807.063) (-1790.820) * (-1787.017) [-1790.958] (-1794.215) (-1807.211) -- 0:06:09
218500 -- (-1790.030) [-1794.596] (-1796.063) (-1792.391) * [-1787.670] (-1799.942) (-1786.019) (-1793.838) -- 0:06:11
219000 -- [-1789.750] (-1792.049) (-1788.594) (-1787.333) * [-1784.158] (-1799.333) (-1797.682) (-1797.956) -- 0:06:10
219500 -- (-1796.833) [-1797.566] (-1791.772) (-1793.230) * (-1797.829) (-1793.317) [-1801.402] (-1799.100) -- 0:06:09
220000 -- (-1783.513) (-1796.673) [-1798.773] (-1799.956) * (-1795.228) [-1790.022] (-1794.974) (-1791.354) -- 0:06:12
Average standard deviation of split frequencies: 0.017090
220500 -- [-1795.947] (-1795.613) (-1786.784) (-1799.489) * (-1793.430) (-1797.981) (-1793.257) [-1798.031] -- 0:06:11
221000 -- (-1791.064) (-1798.366) [-1791.868] (-1796.019) * (-1798.113) (-1804.648) [-1794.432] (-1789.978) -- 0:06:10
221500 -- (-1789.573) [-1799.359] (-1796.474) (-1795.285) * [-1790.945] (-1802.159) (-1793.565) (-1795.055) -- 0:06:09
222000 -- (-1793.650) [-1789.386] (-1793.097) (-1793.397) * (-1800.551) (-1801.946) [-1785.637] (-1797.091) -- 0:06:11
222500 -- (-1792.784) (-1787.401) [-1786.850] (-1798.239) * (-1795.740) [-1800.273] (-1790.548) (-1795.798) -- 0:06:10
223000 -- (-1797.049) (-1793.710) [-1785.540] (-1799.827) * [-1788.561] (-1793.795) (-1792.162) (-1798.566) -- 0:06:09
223500 -- [-1790.308] (-1789.129) (-1794.901) (-1787.308) * (-1790.995) [-1786.199] (-1794.126) (-1789.712) -- 0:06:08
224000 -- (-1795.423) (-1795.169) [-1795.032] (-1797.778) * (-1786.046) [-1782.754] (-1802.203) (-1793.110) -- 0:06:10
224500 -- (-1793.433) [-1790.589] (-1790.264) (-1795.847) * (-1790.056) [-1788.607] (-1799.833) (-1799.759) -- 0:06:09
225000 -- (-1796.860) (-1800.899) [-1784.821] (-1791.839) * [-1787.603] (-1789.840) (-1798.585) (-1794.302) -- 0:06:08
Average standard deviation of split frequencies: 0.016877
225500 -- [-1789.630] (-1791.587) (-1793.975) (-1792.994) * [-1789.712] (-1785.833) (-1785.702) (-1791.123) -- 0:06:10
226000 -- [-1800.402] (-1796.077) (-1797.703) (-1787.238) * (-1792.128) [-1782.280] (-1789.319) (-1793.742) -- 0:06:09
226500 -- [-1793.807] (-1795.888) (-1803.833) (-1794.689) * [-1784.539] (-1784.464) (-1788.102) (-1797.626) -- 0:06:08
227000 -- (-1800.215) [-1785.514] (-1791.479) (-1793.702) * (-1788.310) (-1795.016) (-1789.750) [-1791.613] -- 0:06:07
227500 -- (-1801.589) (-1790.354) [-1797.619] (-1790.597) * (-1786.651) [-1792.315] (-1796.861) (-1790.290) -- 0:06:10
228000 -- (-1793.700) [-1788.153] (-1800.452) (-1786.867) * (-1805.470) [-1795.966] (-1796.844) (-1787.192) -- 0:06:09
228500 -- (-1788.772) [-1794.447] (-1797.257) (-1788.066) * (-1803.219) (-1783.915) [-1781.551] (-1803.551) -- 0:06:08
229000 -- (-1788.028) [-1794.809] (-1789.914) (-1795.901) * (-1800.623) [-1790.647] (-1790.530) (-1796.125) -- 0:06:10
229500 -- (-1798.523) (-1806.024) [-1791.966] (-1789.133) * (-1791.410) [-1789.425] (-1794.101) (-1792.230) -- 0:06:09
230000 -- (-1792.767) [-1793.075] (-1794.221) (-1793.084) * (-1796.608) (-1788.664) (-1793.458) [-1789.904] -- 0:06:08
Average standard deviation of split frequencies: 0.015978
230500 -- (-1790.616) [-1789.061] (-1792.104) (-1788.525) * [-1787.834] (-1793.685) (-1788.168) (-1797.691) -- 0:06:07
231000 -- (-1800.740) (-1801.205) (-1799.676) [-1791.158] * (-1793.881) (-1800.320) (-1788.669) [-1787.878] -- 0:06:09
231500 -- [-1794.399] (-1803.771) (-1793.858) (-1794.098) * (-1798.913) (-1806.000) (-1789.608) [-1799.297] -- 0:06:08
232000 -- (-1795.032) [-1792.979] (-1788.813) (-1789.795) * (-1796.264) (-1793.122) (-1793.946) [-1787.974] -- 0:06:07
232500 -- (-1795.886) (-1798.667) [-1791.180] (-1800.479) * [-1794.754] (-1789.103) (-1797.548) (-1790.679) -- 0:06:06
233000 -- (-1792.513) (-1792.744) (-1792.913) [-1790.397] * (-1792.914) [-1797.794] (-1796.674) (-1803.981) -- 0:06:08
233500 -- (-1791.303) (-1793.416) [-1791.851] (-1793.072) * (-1791.865) (-1792.365) [-1794.911] (-1790.770) -- 0:06:07
234000 -- (-1788.694) (-1788.356) [-1790.039] (-1790.914) * [-1795.179] (-1798.921) (-1792.903) (-1800.697) -- 0:06:06
234500 -- (-1789.143) (-1792.995) [-1784.997] (-1794.297) * (-1785.346) (-1803.093) [-1795.019] (-1790.920) -- 0:06:08
235000 -- (-1792.382) [-1792.823] (-1786.970) (-1790.225) * [-1795.991] (-1797.238) (-1800.102) (-1791.107) -- 0:06:07
Average standard deviation of split frequencies: 0.015435
235500 -- (-1792.380) [-1787.079] (-1798.142) (-1797.598) * [-1793.668] (-1788.133) (-1801.490) (-1792.215) -- 0:06:06
236000 -- (-1795.782) [-1788.170] (-1803.022) (-1788.587) * (-1789.953) (-1788.775) (-1800.792) [-1794.558] -- 0:06:05
236500 -- [-1795.590] (-1789.557) (-1785.851) (-1797.486) * (-1795.619) [-1784.978] (-1795.680) (-1797.837) -- 0:06:08
237000 -- (-1797.871) (-1789.538) [-1794.756] (-1792.657) * (-1794.006) [-1789.289] (-1801.951) (-1799.381) -- 0:06:07
237500 -- (-1790.225) (-1800.508) [-1793.614] (-1797.851) * [-1795.012] (-1797.114) (-1789.773) (-1794.476) -- 0:06:06
238000 -- (-1790.992) [-1800.409] (-1790.580) (-1789.654) * (-1787.754) (-1788.235) [-1790.466] (-1793.239) -- 0:06:04
238500 -- [-1794.329] (-1801.135) (-1788.925) (-1800.874) * [-1787.487] (-1798.273) (-1790.839) (-1799.271) -- 0:06:03
239000 -- (-1796.821) (-1791.405) (-1789.321) [-1783.524] * (-1796.746) [-1794.953] (-1798.261) (-1801.940) -- 0:06:06
239500 -- (-1796.402) (-1795.370) (-1798.241) [-1785.166] * (-1793.872) (-1783.799) [-1795.698] (-1790.445) -- 0:06:05
240000 -- (-1797.802) [-1795.184] (-1798.965) (-1796.584) * [-1792.971] (-1793.300) (-1799.478) (-1789.758) -- 0:06:04
Average standard deviation of split frequencies: 0.016738
240500 -- (-1796.989) (-1792.446) [-1789.870] (-1790.041) * (-1785.432) (-1792.086) (-1791.206) [-1790.025] -- 0:06:06
241000 -- [-1794.289] (-1787.766) (-1790.944) (-1791.593) * (-1789.258) (-1785.295) (-1791.792) [-1787.673] -- 0:06:05
241500 -- (-1802.643) (-1804.723) [-1794.909] (-1791.960) * (-1798.750) (-1785.984) [-1790.499] (-1793.624) -- 0:06:04
242000 -- [-1793.808] (-1795.520) (-1797.600) (-1790.554) * (-1793.203) (-1800.750) [-1791.842] (-1793.368) -- 0:06:06
242500 -- (-1793.236) [-1784.887] (-1795.924) (-1785.312) * (-1791.100) (-1794.739) [-1789.167] (-1792.509) -- 0:06:05
243000 -- [-1795.258] (-1786.867) (-1791.522) (-1788.199) * (-1795.269) (-1788.340) [-1785.584] (-1798.781) -- 0:06:04
243500 -- (-1794.358) [-1796.132] (-1790.824) (-1789.201) * [-1788.856] (-1786.533) (-1797.743) (-1808.058) -- 0:06:03
244000 -- (-1790.182) (-1791.605) (-1801.269) [-1789.228] * (-1789.294) (-1790.387) [-1794.062] (-1792.317) -- 0:06:05
244500 -- [-1791.891] (-1791.713) (-1787.749) (-1793.331) * [-1796.241] (-1796.774) (-1794.876) (-1790.202) -- 0:06:04
245000 -- (-1790.127) (-1792.684) [-1785.136] (-1794.211) * [-1784.884] (-1792.825) (-1795.920) (-1785.765) -- 0:06:03
Average standard deviation of split frequencies: 0.017072
245500 -- [-1791.475] (-1804.041) (-1797.796) (-1799.221) * (-1791.806) (-1787.840) [-1795.135] (-1797.380) -- 0:06:05
246000 -- (-1789.959) (-1792.513) (-1790.574) [-1792.842] * [-1788.051] (-1796.888) (-1797.666) (-1794.806) -- 0:06:04
246500 -- (-1788.526) (-1794.665) [-1786.395] (-1795.597) * [-1790.401] (-1791.095) (-1795.419) (-1796.775) -- 0:06:03
247000 -- (-1794.940) [-1790.264] (-1789.532) (-1790.815) * (-1795.028) (-1796.561) (-1793.952) [-1788.335] -- 0:06:02
247500 -- (-1784.886) (-1795.802) (-1793.364) [-1787.094] * [-1790.441] (-1796.859) (-1798.367) (-1795.700) -- 0:06:04
248000 -- [-1796.351] (-1798.027) (-1788.350) (-1786.500) * (-1791.033) (-1787.780) [-1796.564] (-1795.178) -- 0:06:03
248500 -- [-1787.863] (-1788.869) (-1793.787) (-1789.246) * [-1790.621] (-1788.175) (-1789.212) (-1799.795) -- 0:06:02
249000 -- (-1793.953) (-1790.446) (-1787.530) [-1795.517] * (-1800.144) [-1790.769] (-1798.966) (-1790.763) -- 0:06:01
249500 -- (-1789.969) [-1794.548] (-1796.085) (-1796.319) * [-1790.514] (-1791.406) (-1789.556) (-1808.614) -- 0:06:03
250000 -- (-1797.741) (-1785.447) (-1791.908) [-1791.691] * (-1789.088) (-1788.771) [-1792.783] (-1798.707) -- 0:06:03
Average standard deviation of split frequencies: 0.015216
250500 -- (-1799.931) (-1796.743) (-1797.521) [-1790.467] * (-1797.256) (-1789.562) [-1790.284] (-1785.377) -- 0:06:02
251000 -- (-1797.234) [-1791.121] (-1795.373) (-1793.174) * [-1786.512] (-1798.755) (-1796.838) (-1787.844) -- 0:06:01
251500 -- (-1790.392) (-1802.474) [-1793.264] (-1790.739) * (-1786.212) (-1803.279) (-1803.853) [-1794.336] -- 0:06:00
252000 -- [-1783.701] (-1798.384) (-1800.184) (-1800.988) * (-1794.180) [-1798.115] (-1799.628) (-1791.214) -- 0:06:02
252500 -- [-1793.945] (-1800.874) (-1793.517) (-1793.969) * (-1791.861) [-1806.545] (-1797.612) (-1797.168) -- 0:06:01
253000 -- (-1792.238) (-1795.671) [-1794.412] (-1791.928) * [-1790.857] (-1800.090) (-1795.710) (-1804.358) -- 0:06:00
253500 -- (-1795.454) (-1805.843) (-1787.632) [-1788.435] * (-1791.869) (-1798.108) [-1788.299] (-1799.296) -- 0:05:59
254000 -- (-1789.885) (-1789.283) [-1794.475] (-1795.911) * (-1789.438) [-1789.647] (-1798.581) (-1802.244) -- 0:06:01
254500 -- (-1793.920) (-1794.495) [-1793.832] (-1792.583) * [-1789.662] (-1792.719) (-1803.137) (-1792.080) -- 0:06:00
255000 -- [-1792.574] (-1792.667) (-1793.502) (-1793.616) * (-1787.634) (-1796.678) (-1785.706) [-1789.275] -- 0:05:59
Average standard deviation of split frequencies: 0.012890
255500 -- (-1789.296) (-1798.750) (-1793.461) [-1787.426] * (-1800.153) (-1784.019) [-1786.885] (-1801.788) -- 0:05:58
256000 -- (-1801.237) (-1794.316) [-1790.545] (-1797.883) * [-1793.842] (-1790.465) (-1792.867) (-1794.801) -- 0:06:00
256500 -- (-1795.508) (-1789.166) (-1793.497) [-1793.984] * (-1790.567) (-1798.551) [-1787.341] (-1803.489) -- 0:05:59
257000 -- (-1802.069) [-1787.403] (-1788.026) (-1788.945) * (-1796.253) [-1788.758] (-1794.737) (-1795.360) -- 0:05:58
257500 -- (-1797.780) (-1789.016) [-1798.539] (-1784.003) * (-1792.100) (-1799.291) (-1794.932) [-1792.037] -- 0:05:57
258000 -- (-1789.182) (-1789.289) (-1790.020) [-1787.348] * (-1795.263) (-1798.427) [-1789.715] (-1801.757) -- 0:05:56
258500 -- (-1792.884) [-1790.736] (-1798.531) (-1789.600) * (-1799.163) [-1787.190] (-1792.194) (-1799.625) -- 0:05:58
259000 -- [-1790.458] (-1788.556) (-1791.319) (-1788.821) * (-1794.919) [-1795.292] (-1793.922) (-1801.023) -- 0:05:57
259500 -- (-1789.944) (-1787.270) [-1795.804] (-1796.426) * (-1794.019) (-1793.275) (-1796.281) [-1794.377] -- 0:05:56
260000 -- [-1792.457] (-1793.129) (-1796.914) (-1790.304) * (-1789.962) [-1800.100] (-1786.948) (-1792.827) -- 0:05:55
Average standard deviation of split frequencies: 0.013152
260500 -- (-1790.091) (-1797.222) (-1794.647) [-1790.399] * (-1786.153) [-1791.432] (-1798.672) (-1788.481) -- 0:05:57
261000 -- (-1794.017) (-1797.653) [-1794.949] (-1800.738) * [-1794.246] (-1788.747) (-1800.032) (-1788.609) -- 0:05:56
261500 -- (-1793.079) (-1793.309) [-1791.912] (-1792.895) * [-1792.006] (-1794.050) (-1792.608) (-1791.795) -- 0:05:55
262000 -- (-1784.854) (-1803.133) (-1798.432) [-1797.085] * (-1796.746) (-1796.928) [-1793.633] (-1789.141) -- 0:05:54
262500 -- [-1783.824] (-1791.409) (-1803.199) (-1798.303) * (-1790.264) (-1786.275) (-1793.287) [-1784.624] -- 0:05:56
263000 -- [-1791.960] (-1798.086) (-1798.178) (-1794.765) * [-1789.416] (-1800.032) (-1796.907) (-1789.549) -- 0:05:55
263500 -- [-1790.120] (-1810.598) (-1794.370) (-1796.427) * (-1807.435) (-1787.288) (-1790.557) [-1786.611] -- 0:05:54
264000 -- (-1799.556) [-1788.463] (-1790.062) (-1803.770) * (-1796.330) (-1787.465) (-1794.814) [-1789.122] -- 0:05:56
264500 -- (-1794.256) (-1790.226) [-1795.787] (-1789.848) * (-1794.237) (-1794.365) (-1789.661) [-1793.818] -- 0:05:55
265000 -- [-1790.821] (-1791.397) (-1795.156) (-1788.370) * (-1796.644) [-1788.805] (-1792.020) (-1795.621) -- 0:05:55
Average standard deviation of split frequencies: 0.014500
265500 -- (-1787.022) [-1787.605] (-1798.927) (-1791.296) * [-1798.974] (-1793.680) (-1786.145) (-1787.172) -- 0:05:54
266000 -- [-1786.660] (-1798.540) (-1784.912) (-1787.859) * (-1795.500) (-1795.428) [-1798.952] (-1788.834) -- 0:05:55
266500 -- [-1785.296] (-1801.248) (-1798.659) (-1792.422) * (-1800.921) (-1798.679) (-1787.598) [-1788.930] -- 0:05:55
267000 -- (-1793.665) [-1796.051] (-1791.964) (-1788.312) * (-1798.676) (-1794.934) (-1789.937) [-1791.878] -- 0:05:54
267500 -- [-1786.101] (-1794.010) (-1802.815) (-1789.401) * (-1803.907) (-1799.316) [-1783.285] (-1796.923) -- 0:05:53
268000 -- (-1804.627) [-1791.355] (-1789.946) (-1798.283) * (-1792.016) (-1812.588) [-1789.906] (-1798.674) -- 0:05:55
268500 -- (-1786.274) (-1794.093) (-1795.484) [-1791.924] * [-1791.525] (-1801.415) (-1787.437) (-1789.003) -- 0:05:54
269000 -- [-1787.430] (-1796.359) (-1790.960) (-1788.701) * (-1793.114) (-1792.220) [-1792.588] (-1797.929) -- 0:05:53
269500 -- (-1798.390) [-1790.443] (-1785.693) (-1783.930) * (-1796.936) (-1785.487) [-1795.165] (-1799.361) -- 0:05:52
270000 -- [-1791.927] (-1800.402) (-1787.525) (-1785.784) * (-1792.321) (-1802.588) (-1789.603) [-1795.399] -- 0:05:54
Average standard deviation of split frequencies: 0.016308
270500 -- (-1791.064) (-1796.259) [-1798.703] (-1794.656) * (-1792.431) (-1792.378) (-1792.908) [-1795.970] -- 0:05:53
271000 -- (-1797.983) (-1791.285) (-1794.220) [-1795.011] * (-1791.560) [-1789.679] (-1791.694) (-1794.068) -- 0:05:52
271500 -- (-1796.672) (-1789.170) [-1798.725] (-1806.946) * (-1790.975) [-1798.014] (-1792.121) (-1799.107) -- 0:05:51
272000 -- (-1792.169) [-1787.153] (-1791.290) (-1794.442) * (-1793.186) [-1787.181] (-1796.265) (-1788.195) -- 0:05:53
272500 -- (-1793.249) [-1791.935] (-1792.172) (-1806.523) * (-1795.659) (-1794.200) (-1781.373) [-1797.362] -- 0:05:52
273000 -- (-1791.702) (-1792.500) [-1792.936] (-1807.345) * [-1786.613] (-1790.766) (-1790.004) (-1789.379) -- 0:05:51
273500 -- [-1787.542] (-1792.812) (-1793.157) (-1787.854) * (-1802.891) [-1795.742] (-1797.005) (-1794.426) -- 0:05:53
274000 -- (-1802.052) [-1790.496] (-1796.236) (-1798.268) * (-1792.087) (-1789.447) (-1789.327) [-1792.697] -- 0:05:52
274500 -- [-1794.253] (-1788.169) (-1801.717) (-1800.157) * [-1801.458] (-1795.562) (-1787.244) (-1789.855) -- 0:05:51
275000 -- (-1788.700) (-1790.630) [-1798.675] (-1792.331) * (-1804.634) (-1798.940) [-1785.433] (-1792.443) -- 0:05:50
Average standard deviation of split frequencies: 0.014440
275500 -- (-1795.572) [-1792.509] (-1793.597) (-1790.074) * [-1790.937] (-1796.999) (-1791.286) (-1793.805) -- 0:05:49
276000 -- (-1800.389) (-1812.294) (-1801.834) [-1792.233] * (-1792.038) (-1799.924) [-1790.611] (-1799.654) -- 0:05:51
276500 -- (-1788.906) [-1789.981] (-1792.372) (-1789.633) * [-1796.349] (-1805.541) (-1796.817) (-1798.239) -- 0:05:50
277000 -- (-1801.748) [-1787.795] (-1785.754) (-1794.536) * (-1786.317) (-1797.930) [-1788.551] (-1793.048) -- 0:05:49
277500 -- (-1792.731) (-1797.800) (-1791.538) [-1794.378] * (-1792.971) [-1794.954] (-1789.716) (-1794.385) -- 0:05:48
278000 -- [-1795.364] (-1783.193) (-1800.225) (-1797.977) * (-1789.009) (-1794.148) (-1789.985) [-1783.934] -- 0:05:50
278500 -- (-1781.732) [-1786.810] (-1788.731) (-1787.661) * [-1790.839] (-1799.204) (-1785.382) (-1791.326) -- 0:05:49
279000 -- (-1787.595) (-1800.040) (-1794.963) [-1787.997] * (-1790.980) (-1794.771) [-1791.937] (-1789.066) -- 0:05:48
279500 -- [-1789.508] (-1798.731) (-1793.336) (-1790.130) * (-1792.106) (-1793.388) [-1787.571] (-1789.887) -- 0:05:48
280000 -- (-1788.146) [-1803.396] (-1800.387) (-1786.084) * (-1794.640) (-1792.557) [-1786.077] (-1786.349) -- 0:05:49
Average standard deviation of split frequencies: 0.015727
280500 -- (-1796.566) (-1801.984) (-1786.882) [-1790.680] * [-1796.176] (-1793.900) (-1801.387) (-1797.136) -- 0:05:48
281000 -- (-1789.254) (-1798.083) [-1786.917] (-1795.112) * [-1791.323] (-1790.161) (-1803.097) (-1796.651) -- 0:05:47
281500 -- (-1792.977) [-1789.675] (-1790.167) (-1790.870) * (-1802.503) [-1787.306] (-1803.070) (-1793.097) -- 0:05:47
282000 -- [-1785.409] (-1801.455) (-1796.889) (-1791.371) * [-1793.393] (-1802.707) (-1796.428) (-1796.529) -- 0:05:46
282500 -- (-1789.192) (-1805.160) (-1798.192) [-1789.743] * (-1794.427) [-1795.342] (-1801.015) (-1796.017) -- 0:05:47
283000 -- (-1792.945) (-1785.095) [-1790.455] (-1792.329) * [-1800.343] (-1794.909) (-1801.504) (-1789.523) -- 0:05:47
283500 -- [-1786.875] (-1791.097) (-1794.197) (-1787.361) * (-1802.022) (-1792.928) (-1801.513) [-1793.679] -- 0:05:46
284000 -- [-1786.583] (-1783.165) (-1795.153) (-1800.317) * [-1795.241] (-1788.815) (-1791.003) (-1806.505) -- 0:05:45
284500 -- (-1788.117) (-1786.858) [-1797.474] (-1805.318) * (-1805.440) [-1792.138] (-1794.384) (-1808.266) -- 0:05:47
285000 -- (-1783.581) (-1798.619) [-1787.479] (-1792.679) * (-1792.471) (-1791.947) [-1789.711] (-1805.918) -- 0:05:46
Average standard deviation of split frequencies: 0.014685
285500 -- (-1790.019) [-1801.544] (-1800.519) (-1786.520) * [-1797.805] (-1792.675) (-1790.405) (-1798.273) -- 0:05:45
286000 -- (-1790.338) (-1793.994) (-1797.390) [-1788.497] * (-1787.009) (-1802.433) (-1795.247) [-1789.005] -- 0:05:44
286500 -- (-1791.197) (-1798.017) [-1792.026] (-1782.899) * (-1795.579) (-1791.907) (-1793.910) [-1788.595] -- 0:05:46
287000 -- (-1800.906) (-1791.660) (-1808.727) [-1791.015] * (-1792.321) (-1796.214) [-1792.233] (-1798.227) -- 0:05:45
287500 -- (-1796.439) (-1793.621) (-1799.268) [-1791.512] * (-1790.839) (-1798.667) (-1787.056) [-1796.318] -- 0:05:44
288000 -- [-1790.468] (-1791.175) (-1800.107) (-1792.559) * (-1794.527) [-1788.123] (-1806.275) (-1792.772) -- 0:05:43
288500 -- [-1790.446] (-1801.275) (-1790.594) (-1799.146) * [-1786.801] (-1791.136) (-1789.418) (-1791.940) -- 0:05:42
289000 -- (-1795.666) (-1795.515) [-1793.605] (-1794.943) * (-1788.908) [-1791.434] (-1795.508) (-1794.434) -- 0:05:44
289500 -- [-1784.685] (-1788.089) (-1792.064) (-1787.419) * (-1787.269) (-1802.914) (-1795.329) [-1785.877] -- 0:05:43
290000 -- (-1789.877) (-1793.554) (-1793.930) [-1794.940] * (-1789.006) (-1796.970) [-1791.599] (-1800.228) -- 0:05:42
Average standard deviation of split frequencies: 0.014449
290500 -- [-1782.607] (-1794.241) (-1787.243) (-1788.965) * [-1792.632] (-1800.507) (-1792.423) (-1794.736) -- 0:05:41
291000 -- (-1797.766) (-1793.974) (-1788.213) [-1788.477] * (-1792.868) [-1795.350] (-1791.854) (-1789.267) -- 0:05:43
291500 -- (-1792.666) (-1796.240) [-1789.958] (-1795.519) * (-1792.740) (-1791.287) (-1794.754) [-1789.367] -- 0:05:42
292000 -- (-1795.660) [-1788.487] (-1787.754) (-1791.805) * (-1794.844) [-1790.094] (-1791.758) (-1784.524) -- 0:05:41
292500 -- [-1791.576] (-1788.353) (-1793.157) (-1785.904) * (-1789.274) (-1794.688) (-1798.258) [-1789.011] -- 0:05:41
293000 -- [-1788.130] (-1795.556) (-1803.047) (-1798.066) * (-1802.212) (-1792.195) (-1799.074) [-1787.888] -- 0:05:42
293500 -- [-1791.688] (-1795.016) (-1795.908) (-1791.268) * [-1793.939] (-1795.142) (-1796.917) (-1796.923) -- 0:05:41
294000 -- [-1797.737] (-1795.239) (-1810.267) (-1788.689) * (-1797.796) (-1791.504) [-1792.890] (-1785.407) -- 0:05:40
294500 -- (-1792.573) [-1787.062] (-1806.087) (-1798.259) * (-1797.541) (-1798.660) [-1799.771] (-1800.875) -- 0:05:40
295000 -- (-1805.082) [-1788.269] (-1805.351) (-1791.372) * (-1788.621) (-1801.486) [-1795.814] (-1789.032) -- 0:05:39
Average standard deviation of split frequencies: 0.014188
295500 -- (-1792.762) [-1786.562] (-1794.359) (-1787.261) * (-1797.176) (-1797.157) [-1794.626] (-1785.517) -- 0:05:40
296000 -- [-1788.813] (-1793.057) (-1802.815) (-1787.890) * [-1797.212] (-1796.044) (-1804.490) (-1786.433) -- 0:05:40
296500 -- (-1800.481) (-1799.584) (-1799.361) [-1796.823] * (-1793.636) (-1792.043) [-1794.312] (-1796.568) -- 0:05:39
297000 -- (-1790.531) [-1793.260] (-1792.675) (-1787.987) * [-1794.680] (-1800.609) (-1788.790) (-1795.190) -- 0:05:38
297500 -- (-1803.710) (-1790.834) [-1786.349] (-1789.854) * (-1795.331) (-1791.212) [-1787.334] (-1798.741) -- 0:05:40
298000 -- [-1783.667] (-1790.492) (-1794.236) (-1797.024) * (-1793.331) (-1788.790) [-1789.125] (-1793.658) -- 0:05:39
298500 -- (-1792.077) (-1790.677) [-1788.761] (-1789.877) * (-1796.875) (-1798.709) (-1792.481) [-1793.033] -- 0:05:38
299000 -- (-1791.486) (-1790.873) [-1793.390] (-1797.234) * (-1786.731) (-1793.698) [-1786.113] (-1797.300) -- 0:05:37
299500 -- [-1789.830] (-1797.697) (-1798.270) (-1792.872) * [-1785.480] (-1786.739) (-1787.549) (-1796.772) -- 0:05:39
300000 -- (-1790.565) [-1802.254] (-1803.978) (-1795.435) * [-1786.951] (-1792.015) (-1795.469) (-1785.859) -- 0:05:38
Average standard deviation of split frequencies: 0.011688
300500 -- [-1794.007] (-1791.576) (-1796.901) (-1798.119) * (-1790.731) [-1787.821] (-1797.261) (-1789.941) -- 0:05:37
301000 -- (-1793.840) (-1804.277) (-1793.263) [-1787.336] * (-1801.720) (-1792.910) [-1789.271] (-1795.183) -- 0:05:36
301500 -- [-1799.607] (-1797.000) (-1786.704) (-1790.525) * (-1792.003) (-1790.496) [-1789.756] (-1791.761) -- 0:05:38
302000 -- [-1784.103] (-1797.888) (-1802.256) (-1793.848) * (-1794.339) (-1794.388) (-1788.620) [-1793.105] -- 0:05:37
302500 -- (-1801.349) (-1803.957) (-1789.096) [-1794.679] * [-1793.797] (-1790.993) (-1796.990) (-1788.505) -- 0:05:36
303000 -- (-1790.068) (-1787.606) [-1782.966] (-1795.479) * (-1797.759) (-1800.383) (-1791.688) [-1786.792] -- 0:05:35
303500 -- (-1791.180) (-1787.878) [-1793.486] (-1797.030) * (-1797.399) [-1792.984] (-1793.746) (-1796.798) -- 0:05:35
304000 -- (-1789.257) (-1799.069) (-1790.261) [-1785.160] * (-1796.032) [-1784.171] (-1794.652) (-1790.324) -- 0:05:36
304500 -- (-1795.838) [-1792.377] (-1795.292) (-1794.726) * (-1791.052) [-1789.493] (-1792.274) (-1790.022) -- 0:05:35
305000 -- [-1795.721] (-1792.270) (-1796.672) (-1791.621) * (-1785.712) (-1797.775) (-1797.326) [-1788.997] -- 0:05:34
Average standard deviation of split frequencies: 0.009943
305500 -- (-1811.709) (-1792.615) [-1791.634] (-1796.644) * (-1796.313) (-1791.547) (-1792.248) [-1788.927] -- 0:05:34
306000 -- [-1790.095] (-1795.360) (-1793.396) (-1789.750) * (-1789.413) (-1788.452) [-1793.741] (-1790.409) -- 0:05:35
306500 -- (-1791.827) (-1791.580) [-1786.901] (-1794.808) * (-1808.164) [-1787.555] (-1790.675) (-1791.588) -- 0:05:34
307000 -- [-1792.521] (-1796.191) (-1795.826) (-1798.992) * (-1799.640) (-1783.917) [-1790.454] (-1787.793) -- 0:05:34
307500 -- (-1797.063) (-1801.743) [-1788.473] (-1794.051) * (-1796.300) [-1787.633] (-1793.804) (-1793.156) -- 0:05:33
308000 -- (-1795.634) (-1795.619) [-1789.368] (-1792.867) * (-1801.270) [-1794.021] (-1789.511) (-1792.435) -- 0:05:34
308500 -- (-1787.345) (-1803.815) [-1792.608] (-1791.748) * (-1794.206) [-1786.888] (-1790.663) (-1796.945) -- 0:05:33
309000 -- (-1791.578) [-1789.710] (-1792.211) (-1806.280) * (-1796.066) (-1791.395) (-1793.977) [-1794.596] -- 0:05:33
309500 -- [-1790.541] (-1813.473) (-1802.776) (-1788.513) * [-1788.856] (-1798.392) (-1790.476) (-1795.274) -- 0:05:32
310000 -- [-1790.507] (-1798.678) (-1790.493) (-1790.239) * (-1789.996) (-1790.334) [-1790.556] (-1796.845) -- 0:05:31
Average standard deviation of split frequencies: 0.011312
310500 -- (-1798.972) (-1790.880) (-1790.723) [-1789.286] * (-1787.677) (-1796.105) (-1793.455) [-1792.494] -- 0:05:33
311000 -- [-1794.244] (-1789.648) (-1796.089) (-1800.387) * (-1801.512) (-1810.070) [-1792.597] (-1788.374) -- 0:05:32
311500 -- (-1790.973) (-1786.581) [-1791.423] (-1796.204) * (-1793.650) (-1798.690) (-1804.678) [-1788.194] -- 0:05:31
312000 -- (-1796.313) (-1808.398) (-1803.606) [-1791.053] * (-1799.746) (-1802.213) (-1786.547) [-1790.240] -- 0:05:30
312500 -- [-1787.322] (-1800.753) (-1793.762) (-1796.233) * (-1792.191) (-1795.239) (-1789.233) [-1786.403] -- 0:05:32
313000 -- (-1795.655) (-1789.971) (-1801.714) [-1790.578] * [-1789.736] (-1802.956) (-1805.977) (-1795.919) -- 0:05:31
313500 -- (-1790.863) (-1795.751) [-1795.680] (-1790.628) * (-1790.878) (-1790.381) [-1795.808] (-1797.163) -- 0:05:30
314000 -- (-1789.288) (-1793.749) (-1791.482) [-1791.406] * (-1797.906) (-1783.952) (-1802.199) [-1788.071] -- 0:05:29
314500 -- (-1795.327) [-1788.918] (-1790.111) (-1791.302) * [-1786.906] (-1789.145) (-1794.105) (-1793.223) -- 0:05:31
315000 -- (-1796.149) (-1794.703) (-1804.389) [-1791.048] * (-1791.616) [-1790.404] (-1798.418) (-1791.805) -- 0:05:30
Average standard deviation of split frequencies: 0.010171
315500 -- (-1793.647) (-1785.839) [-1786.330] (-1796.054) * (-1796.018) [-1791.036] (-1796.880) (-1799.795) -- 0:05:29
316000 -- (-1794.090) (-1802.134) (-1783.701) [-1789.624] * (-1790.367) [-1787.098] (-1789.381) (-1794.227) -- 0:05:29
316500 -- (-1789.928) [-1795.133] (-1794.701) (-1800.267) * (-1797.436) (-1794.634) (-1789.736) [-1794.844] -- 0:05:28
317000 -- (-1796.804) (-1799.016) (-1789.762) [-1795.909] * (-1793.700) (-1794.331) [-1783.701] (-1792.548) -- 0:05:29
317500 -- [-1790.474] (-1794.773) (-1789.086) (-1788.577) * [-1786.595] (-1795.351) (-1798.127) (-1796.400) -- 0:05:28
318000 -- (-1788.759) (-1790.733) [-1783.934] (-1798.827) * (-1794.497) [-1789.205] (-1790.281) (-1796.418) -- 0:05:28
318500 -- (-1800.726) [-1787.919] (-1795.691) (-1789.846) * (-1794.728) (-1792.312) [-1789.293] (-1798.708) -- 0:05:27
319000 -- [-1792.393] (-1796.246) (-1793.436) (-1798.958) * [-1791.873] (-1796.738) (-1793.222) (-1799.166) -- 0:05:28
319500 -- [-1799.621] (-1791.378) (-1796.339) (-1796.420) * (-1792.658) (-1795.363) [-1791.230] (-1806.840) -- 0:05:28
320000 -- (-1794.867) (-1786.480) (-1802.026) [-1793.507] * (-1788.249) (-1790.593) [-1788.339] (-1802.104) -- 0:05:27
Average standard deviation of split frequencies: 0.009088
320500 -- [-1787.774] (-1789.554) (-1800.202) (-1791.794) * (-1795.583) [-1792.332] (-1792.964) (-1793.677) -- 0:05:26
321000 -- (-1787.970) (-1790.699) [-1800.101] (-1794.927) * (-1794.331) (-1794.504) (-1787.130) [-1799.965] -- 0:05:27
321500 -- (-1791.804) (-1805.867) [-1793.075] (-1792.008) * (-1794.172) (-1799.411) [-1786.236] (-1801.665) -- 0:05:27
322000 -- (-1790.755) (-1787.297) [-1790.051] (-1792.072) * (-1791.549) [-1786.396] (-1796.765) (-1796.978) -- 0:05:26
322500 -- [-1791.430] (-1803.297) (-1789.094) (-1788.713) * (-1796.779) [-1793.268] (-1798.759) (-1791.342) -- 0:05:25
323000 -- [-1789.524] (-1797.751) (-1788.395) (-1797.261) * (-1797.011) (-1795.032) (-1789.231) [-1790.611] -- 0:05:26
323500 -- (-1787.092) (-1797.950) (-1788.119) [-1783.078] * (-1797.329) [-1792.883] (-1790.336) (-1797.270) -- 0:05:26
324000 -- [-1792.617] (-1788.719) (-1787.627) (-1787.502) * [-1793.370] (-1794.426) (-1794.974) (-1791.260) -- 0:05:25
324500 -- (-1787.866) (-1794.566) [-1791.111] (-1791.000) * (-1794.501) [-1787.301] (-1793.451) (-1792.350) -- 0:05:24
325000 -- (-1790.576) (-1786.471) (-1791.615) [-1791.553] * (-1788.171) (-1789.465) [-1792.729] (-1792.402) -- 0:05:24
Average standard deviation of split frequencies: 0.008939
325500 -- (-1795.248) (-1796.491) (-1796.089) [-1785.872] * (-1794.181) (-1788.206) (-1796.036) [-1791.760] -- 0:05:25
326000 -- (-1799.846) (-1792.257) [-1796.089] (-1792.296) * (-1790.353) [-1788.969] (-1797.005) (-1787.450) -- 0:05:24
326500 -- [-1792.800] (-1793.991) (-1795.387) (-1791.485) * (-1790.879) (-1793.882) [-1797.310] (-1795.342) -- 0:05:23
327000 -- (-1791.185) [-1791.242] (-1789.538) (-1789.451) * (-1793.291) (-1784.287) (-1791.176) [-1792.726] -- 0:05:23
327500 -- (-1792.262) (-1798.076) [-1792.713] (-1804.501) * (-1798.441) [-1791.408] (-1793.796) (-1798.914) -- 0:05:24
328000 -- [-1795.337] (-1796.009) (-1797.746) (-1801.501) * [-1787.388] (-1803.027) (-1792.090) (-1797.204) -- 0:05:23
328500 -- (-1790.054) (-1789.923) [-1791.218] (-1791.168) * [-1787.612] (-1794.097) (-1793.398) (-1795.664) -- 0:05:22
329000 -- (-1791.057) (-1799.391) [-1786.246] (-1797.034) * (-1794.346) (-1795.685) [-1796.958] (-1811.727) -- 0:05:24
329500 -- (-1797.337) (-1793.303) (-1788.720) [-1793.340] * (-1803.196) [-1795.066] (-1796.809) (-1791.188) -- 0:05:23
330000 -- (-1795.064) (-1792.820) (-1799.908) [-1789.302] * (-1791.282) (-1790.282) (-1796.463) [-1793.615] -- 0:05:22
Average standard deviation of split frequencies: 0.008295
330500 -- (-1795.770) (-1798.031) [-1787.668] (-1796.027) * (-1790.517) (-1795.194) [-1784.765] (-1794.103) -- 0:05:22
331000 -- (-1793.711) (-1798.294) [-1785.649] (-1792.402) * [-1788.217] (-1790.597) (-1789.937) (-1808.690) -- 0:05:23
331500 -- (-1792.180) (-1787.407) (-1795.428) [-1797.332] * (-1806.141) (-1786.395) (-1798.513) [-1798.399] -- 0:05:22
332000 -- [-1785.086] (-1801.694) (-1794.990) (-1798.317) * (-1794.958) [-1786.347] (-1792.058) (-1798.794) -- 0:05:21
332500 -- (-1788.036) [-1784.831] (-1803.547) (-1799.835) * [-1791.268] (-1799.235) (-1793.520) (-1790.965) -- 0:05:21
333000 -- (-1797.975) [-1784.678] (-1795.580) (-1787.283) * (-1794.517) [-1791.477] (-1795.558) (-1789.753) -- 0:05:20
333500 -- (-1794.102) (-1790.653) (-1790.000) [-1791.356] * [-1792.940] (-1784.708) (-1798.961) (-1794.149) -- 0:05:21
334000 -- [-1797.634] (-1795.186) (-1803.910) (-1789.891) * [-1793.634] (-1798.250) (-1795.408) (-1796.920) -- 0:05:21
334500 -- [-1789.788] (-1798.502) (-1795.307) (-1793.611) * (-1789.728) (-1794.943) [-1793.999] (-1793.589) -- 0:05:20
335000 -- (-1788.644) (-1790.536) [-1788.543] (-1800.669) * (-1793.658) [-1795.423] (-1792.383) (-1802.011) -- 0:05:19
Average standard deviation of split frequencies: 0.009948
335500 -- (-1792.791) (-1794.414) [-1793.962] (-1793.146) * (-1798.677) (-1788.753) (-1793.589) [-1792.150] -- 0:05:20
336000 -- (-1802.207) (-1799.838) [-1787.930] (-1798.455) * [-1793.828] (-1789.561) (-1803.211) (-1790.346) -- 0:05:20
336500 -- [-1787.917] (-1796.162) (-1802.945) (-1795.267) * (-1790.745) (-1798.839) [-1790.061] (-1792.859) -- 0:05:19
337000 -- (-1794.199) (-1790.553) [-1791.667] (-1796.250) * (-1789.719) (-1795.181) [-1794.729] (-1795.028) -- 0:05:18
337500 -- (-1791.795) [-1790.436] (-1787.716) (-1801.981) * [-1789.294] (-1796.490) (-1797.013) (-1803.518) -- 0:05:19
338000 -- [-1784.296] (-1789.637) (-1792.577) (-1782.988) * [-1785.280] (-1791.570) (-1785.826) (-1797.180) -- 0:05:19
338500 -- (-1803.637) [-1786.439] (-1789.681) (-1788.102) * [-1789.294] (-1794.139) (-1796.167) (-1792.298) -- 0:05:18
339000 -- (-1789.466) (-1789.288) [-1782.036] (-1790.345) * [-1792.720] (-1802.658) (-1792.041) (-1795.175) -- 0:05:17
339500 -- (-1800.269) (-1792.217) (-1790.145) [-1790.433] * [-1786.960] (-1798.045) (-1798.023) (-1788.530) -- 0:05:17
340000 -- [-1792.407] (-1793.744) (-1797.910) (-1796.802) * (-1794.319) (-1791.798) [-1794.758] (-1790.724) -- 0:05:18
Average standard deviation of split frequencies: 0.009938
340500 -- (-1796.677) (-1791.512) (-1799.380) [-1793.863] * (-1796.547) [-1783.419] (-1789.496) (-1792.951) -- 0:05:17
341000 -- (-1790.754) (-1795.140) [-1785.898] (-1798.002) * (-1792.213) (-1784.791) (-1793.984) [-1790.524] -- 0:05:16
341500 -- (-1795.813) (-1798.039) [-1793.505] (-1800.155) * (-1792.662) [-1797.496] (-1792.289) (-1787.078) -- 0:05:16
342000 -- (-1794.346) (-1793.032) [-1787.617] (-1796.948) * (-1798.655) (-1798.964) (-1789.436) [-1786.498] -- 0:05:17
342500 -- (-1788.819) (-1787.414) [-1787.358] (-1798.773) * (-1806.117) (-1792.009) [-1786.978] (-1796.675) -- 0:05:16
343000 -- (-1790.998) (-1784.222) (-1791.818) [-1794.201] * (-1799.616) (-1795.539) [-1787.579] (-1796.263) -- 0:05:16
343500 -- [-1787.410] (-1794.188) (-1800.380) (-1791.467) * [-1793.716] (-1807.936) (-1789.295) (-1798.831) -- 0:05:17
344000 -- (-1796.059) (-1790.930) (-1802.864) [-1785.887] * (-1795.652) [-1790.377] (-1796.101) (-1792.980) -- 0:05:16
344500 -- (-1795.879) (-1794.774) [-1791.762] (-1788.959) * (-1791.079) [-1784.848] (-1792.013) (-1798.746) -- 0:05:15
345000 -- (-1794.069) (-1793.583) (-1804.634) [-1786.969] * (-1795.854) (-1784.628) [-1795.076] (-1793.195) -- 0:05:15
Average standard deviation of split frequencies: 0.009785
345500 -- (-1793.429) (-1788.724) (-1788.462) [-1790.559] * [-1788.511] (-1792.187) (-1797.783) (-1809.999) -- 0:05:16
346000 -- [-1791.922] (-1803.739) (-1791.322) (-1787.895) * (-1805.420) (-1801.907) [-1787.391] (-1790.150) -- 0:05:15
346500 -- (-1788.695) (-1796.843) [-1792.737] (-1790.623) * (-1811.717) (-1802.637) [-1789.911] (-1788.409) -- 0:05:14
347000 -- [-1790.725] (-1797.456) (-1795.486) (-1796.159) * (-1796.047) [-1788.941] (-1795.846) (-1797.154) -- 0:05:14
347500 -- (-1802.580) [-1787.780] (-1798.467) (-1788.995) * (-1796.675) [-1795.024] (-1793.960) (-1786.358) -- 0:05:15
348000 -- (-1795.912) (-1795.430) [-1795.154] (-1792.760) * [-1791.739] (-1800.039) (-1793.492) (-1797.500) -- 0:05:14
348500 -- [-1793.325] (-1796.495) (-1793.026) (-1796.630) * [-1791.497] (-1792.161) (-1790.524) (-1798.190) -- 0:05:14
349000 -- (-1798.196) (-1783.764) (-1798.468) [-1785.110] * (-1788.044) (-1792.739) [-1788.301] (-1790.864) -- 0:05:13
349500 -- (-1812.947) [-1786.717] (-1792.854) (-1791.085) * [-1791.697] (-1787.619) (-1795.252) (-1797.234) -- 0:05:12
350000 -- (-1798.002) (-1786.760) [-1803.440] (-1795.038) * [-1789.124] (-1788.512) (-1797.198) (-1802.415) -- 0:05:13
Average standard deviation of split frequencies: 0.009532
350500 -- (-1797.318) [-1790.105] (-1790.994) (-1789.638) * (-1794.020) [-1782.232] (-1798.183) (-1793.375) -- 0:05:13
351000 -- (-1794.333) (-1788.073) (-1788.119) [-1790.702] * (-1797.786) [-1785.266] (-1789.983) (-1793.106) -- 0:05:12
351500 -- (-1792.879) (-1791.262) (-1790.677) [-1788.779] * (-1806.276) (-1795.257) (-1797.243) [-1791.914] -- 0:05:11
352000 -- (-1789.594) (-1792.358) [-1795.364] (-1799.749) * (-1797.700) (-1799.900) (-1797.516) [-1794.017] -- 0:05:12
352500 -- [-1790.363] (-1789.970) (-1793.070) (-1800.627) * (-1793.447) (-1806.913) (-1792.742) [-1789.407] -- 0:05:12
353000 -- (-1791.167) (-1801.523) [-1795.334] (-1792.657) * (-1813.967) (-1795.093) [-1791.947] (-1795.562) -- 0:05:11
353500 -- (-1801.048) (-1797.663) [-1799.448] (-1791.079) * [-1793.522] (-1807.690) (-1788.199) (-1799.318) -- 0:05:10
354000 -- (-1794.023) (-1792.845) (-1787.805) [-1795.518] * (-1800.487) (-1788.168) (-1796.253) [-1794.762] -- 0:05:12
354500 -- (-1790.560) (-1806.832) [-1798.268] (-1811.496) * (-1803.299) (-1799.279) [-1789.949] (-1795.357) -- 0:05:11
355000 -- (-1794.023) (-1797.114) (-1799.435) [-1791.287] * (-1789.841) [-1784.078] (-1798.478) (-1795.534) -- 0:05:10
Average standard deviation of split frequencies: 0.008306
355500 -- (-1792.340) (-1805.858) (-1796.092) [-1783.424] * [-1794.152] (-1793.228) (-1792.443) (-1800.727) -- 0:05:11
356000 -- (-1794.049) [-1791.423] (-1804.557) (-1793.698) * (-1797.493) (-1792.070) [-1799.609] (-1790.348) -- 0:05:11
356500 -- (-1792.847) (-1798.085) (-1798.530) [-1786.858] * [-1791.336] (-1798.147) (-1796.042) (-1790.415) -- 0:05:10
357000 -- [-1795.171] (-1793.939) (-1801.222) (-1786.621) * [-1790.893] (-1797.267) (-1785.247) (-1788.934) -- 0:05:09
357500 -- [-1789.451] (-1797.091) (-1796.332) (-1801.181) * (-1796.474) (-1794.529) (-1786.890) [-1792.292] -- 0:05:09
358000 -- (-1797.590) (-1799.232) (-1789.905) [-1790.441] * (-1789.362) (-1788.114) [-1789.862] (-1790.149) -- 0:05:10
358500 -- [-1792.549] (-1793.702) (-1798.336) (-1796.607) * (-1794.785) (-1789.667) (-1795.617) [-1788.920] -- 0:05:09
359000 -- (-1791.733) (-1794.136) [-1794.949] (-1796.010) * (-1796.167) [-1786.431] (-1785.736) (-1805.275) -- 0:05:08
359500 -- (-1788.833) [-1789.406] (-1797.616) (-1805.811) * [-1788.630] (-1788.031) (-1803.274) (-1794.829) -- 0:05:08
360000 -- (-1790.705) [-1786.667] (-1798.772) (-1794.919) * [-1793.186] (-1789.845) (-1800.853) (-1792.028) -- 0:05:09
Average standard deviation of split frequencies: 0.008912
360500 -- (-1799.721) (-1800.095) [-1796.913] (-1791.914) * (-1795.317) [-1785.052] (-1793.038) (-1788.888) -- 0:05:08
361000 -- [-1793.128] (-1795.870) (-1791.690) (-1782.576) * (-1795.291) [-1791.794] (-1784.631) (-1790.980) -- 0:05:07
361500 -- (-1792.881) [-1792.538] (-1796.206) (-1794.701) * (-1802.987) [-1791.152] (-1786.573) (-1792.116) -- 0:05:09
362000 -- (-1802.017) (-1797.524) [-1791.606] (-1790.395) * (-1802.927) (-1787.990) (-1789.344) [-1789.205] -- 0:05:08
362500 -- (-1791.620) [-1786.723] (-1793.696) (-1796.882) * (-1794.457) (-1792.121) [-1792.132] (-1799.335) -- 0:05:07
363000 -- [-1788.546] (-1794.296) (-1790.915) (-1799.307) * (-1791.743) (-1793.848) [-1789.977] (-1790.622) -- 0:05:07
363500 -- (-1791.652) [-1788.388] (-1791.400) (-1798.858) * [-1788.478] (-1792.239) (-1800.122) (-1795.273) -- 0:05:06
364000 -- (-1791.324) (-1788.263) [-1789.738] (-1791.059) * (-1796.268) (-1784.357) [-1792.324] (-1787.771) -- 0:05:07
364500 -- (-1797.988) [-1793.987] (-1802.649) (-1792.301) * [-1782.111] (-1798.110) (-1788.056) (-1795.431) -- 0:05:06
365000 -- [-1793.431] (-1789.860) (-1790.773) (-1798.419) * [-1788.379] (-1797.718) (-1794.042) (-1805.683) -- 0:05:06
Average standard deviation of split frequencies: 0.008430
365500 -- (-1792.661) [-1784.655] (-1799.129) (-1787.664) * [-1789.334] (-1789.930) (-1795.846) (-1796.042) -- 0:05:05
366000 -- [-1786.736] (-1793.628) (-1792.875) (-1795.320) * (-1790.489) (-1801.812) (-1793.260) [-1790.274] -- 0:05:06
366500 -- [-1788.403] (-1799.531) (-1802.159) (-1791.760) * [-1786.515] (-1796.386) (-1787.673) (-1798.714) -- 0:05:05
367000 -- [-1785.484] (-1791.623) (-1789.321) (-1789.855) * [-1785.845] (-1792.508) (-1792.034) (-1796.564) -- 0:05:05
367500 -- (-1789.107) (-1798.331) (-1789.550) [-1792.560] * (-1788.488) (-1789.603) [-1793.765] (-1791.347) -- 0:05:06
368000 -- (-1798.703) (-1799.905) (-1786.121) [-1792.105] * (-1788.212) (-1799.163) [-1790.258] (-1797.852) -- 0:05:05
368500 -- (-1797.363) (-1793.709) (-1791.370) [-1785.915] * [-1790.032] (-1806.564) (-1805.174) (-1793.471) -- 0:05:05
369000 -- (-1787.733) (-1789.041) (-1793.022) [-1792.443] * (-1792.420) (-1792.512) (-1795.832) [-1795.585] -- 0:05:04
369500 -- (-1786.444) (-1787.087) [-1793.314] (-1801.877) * (-1788.609) (-1794.909) (-1794.401) [-1787.396] -- 0:05:03
370000 -- [-1789.025] (-1792.283) (-1802.214) (-1806.298) * (-1802.399) [-1787.934] (-1795.915) (-1792.885) -- 0:05:04
Average standard deviation of split frequencies: 0.007284
370500 -- (-1794.090) (-1787.819) (-1797.553) [-1789.525] * [-1787.500] (-1789.418) (-1790.766) (-1792.425) -- 0:05:04
371000 -- (-1790.008) [-1799.770] (-1793.966) (-1790.850) * (-1793.069) [-1788.655] (-1795.120) (-1791.773) -- 0:05:03
371500 -- (-1800.834) (-1793.321) [-1792.285] (-1787.771) * (-1790.450) (-1795.140) [-1787.529] (-1791.210) -- 0:05:02
372000 -- [-1797.236] (-1802.972) (-1788.991) (-1792.938) * (-1787.689) [-1783.974] (-1796.835) (-1791.907) -- 0:05:03
372500 -- (-1796.703) [-1795.601] (-1788.768) (-1792.118) * [-1792.279] (-1791.519) (-1799.446) (-1787.033) -- 0:05:03
373000 -- [-1793.603] (-1796.295) (-1786.805) (-1793.995) * (-1790.192) (-1794.257) [-1791.675] (-1794.661) -- 0:05:02
373500 -- [-1786.105] (-1796.083) (-1789.015) (-1795.590) * [-1788.721] (-1795.270) (-1793.266) (-1798.751) -- 0:05:01
374000 -- (-1793.325) (-1797.405) (-1795.453) [-1789.458] * (-1797.583) (-1791.588) [-1790.596] (-1790.474) -- 0:05:02
374500 -- (-1802.836) (-1786.648) [-1796.157] (-1793.915) * (-1795.408) (-1797.959) [-1790.461] (-1786.846) -- 0:05:02
375000 -- (-1795.671) (-1792.663) (-1797.606) [-1793.537] * (-1790.597) (-1801.628) (-1789.337) [-1796.844] -- 0:05:01
Average standard deviation of split frequencies: 0.007750
375500 -- (-1795.750) [-1792.268] (-1795.550) (-1798.962) * (-1793.375) [-1784.636] (-1793.163) (-1798.245) -- 0:05:02
376000 -- (-1789.805) [-1791.231] (-1798.881) (-1793.799) * (-1799.983) [-1783.676] (-1793.372) (-1802.930) -- 0:05:02
376500 -- (-1784.947) (-1800.357) [-1791.172] (-1796.626) * [-1792.040] (-1798.793) (-1796.216) (-1796.253) -- 0:05:01
377000 -- [-1791.457] (-1792.185) (-1792.881) (-1789.735) * (-1795.186) (-1793.595) [-1798.150] (-1791.632) -- 0:05:02
377500 -- (-1794.665) [-1789.033] (-1793.007) (-1804.593) * (-1794.917) (-1792.395) [-1792.191] (-1797.089) -- 0:05:01
378000 -- (-1794.708) (-1786.579) (-1795.380) [-1794.392] * [-1785.799] (-1805.745) (-1804.775) (-1796.544) -- 0:05:01
378500 -- (-1797.208) (-1797.180) (-1797.437) [-1781.772] * [-1792.422] (-1785.894) (-1791.201) (-1793.648) -- 0:05:00
379000 -- (-1794.365) (-1791.568) (-1795.873) [-1792.730] * (-1785.425) (-1791.337) [-1791.301] (-1795.143) -- 0:05:01
379500 -- (-1795.420) (-1799.976) (-1786.480) [-1784.923] * [-1786.739] (-1798.121) (-1796.162) (-1791.374) -- 0:05:00
380000 -- [-1785.733] (-1794.646) (-1791.441) (-1794.326) * (-1792.560) [-1792.266] (-1787.534) (-1788.340) -- 0:05:00
Average standard deviation of split frequencies: 0.008556
380500 -- (-1791.406) (-1784.353) (-1789.695) [-1786.976] * (-1794.327) (-1801.814) [-1784.114] (-1790.591) -- 0:04:59
381000 -- (-1792.274) [-1791.359] (-1794.304) (-1789.710) * (-1792.121) (-1790.167) (-1785.640) [-1790.984] -- 0:05:00
381500 -- [-1783.927] (-1800.920) (-1801.667) (-1788.657) * (-1795.516) (-1794.680) (-1787.527) [-1791.157] -- 0:04:59
382000 -- (-1792.789) (-1792.253) [-1793.178] (-1794.934) * [-1792.831] (-1796.790) (-1796.138) (-1789.251) -- 0:04:59
382500 -- (-1790.067) (-1789.715) [-1791.127] (-1801.167) * (-1800.224) (-1790.666) [-1789.533] (-1786.665) -- 0:04:58
383000 -- (-1797.713) [-1785.573] (-1797.504) (-1795.045) * (-1797.085) (-1791.493) (-1794.422) [-1790.733] -- 0:04:58
383500 -- (-1806.228) [-1791.633] (-1795.897) (-1793.114) * (-1788.475) (-1796.926) [-1787.880] (-1791.359) -- 0:04:59
384000 -- (-1798.719) (-1782.698) (-1787.062) [-1783.503] * (-1794.208) (-1783.965) (-1789.548) [-1793.788] -- 0:04:58
384500 -- (-1789.614) [-1789.826] (-1790.840) (-1785.253) * (-1791.982) [-1789.756] (-1796.402) (-1791.733) -- 0:04:57
385000 -- [-1788.364] (-1789.423) (-1790.405) (-1784.493) * (-1798.189) (-1798.510) (-1794.954) [-1788.625] -- 0:04:58
Average standard deviation of split frequencies: 0.008660
385500 -- (-1786.113) (-1803.878) [-1790.184] (-1793.077) * (-1789.918) (-1794.523) [-1785.629] (-1793.532) -- 0:04:58
386000 -- (-1797.444) [-1792.321] (-1805.905) (-1799.156) * (-1785.781) (-1792.569) [-1790.813] (-1792.777) -- 0:04:57
386500 -- (-1797.818) (-1795.446) (-1813.720) [-1784.659] * (-1787.641) (-1797.278) [-1794.545] (-1807.517) -- 0:04:56
387000 -- (-1794.438) (-1788.328) [-1808.703] (-1793.547) * (-1791.036) [-1796.164] (-1797.207) (-1793.696) -- 0:04:56
387500 -- (-1798.586) [-1787.743] (-1788.046) (-1792.352) * [-1788.444] (-1791.153) (-1804.451) (-1793.457) -- 0:04:57
388000 -- (-1798.919) [-1785.722] (-1799.352) (-1792.611) * (-1793.981) (-1803.475) [-1799.568] (-1804.010) -- 0:04:56
388500 -- (-1794.297) [-1790.391] (-1799.681) (-1791.988) * [-1786.382] (-1801.003) (-1797.176) (-1789.043) -- 0:04:55
389000 -- [-1790.847] (-1792.660) (-1798.634) (-1799.503) * (-1798.675) [-1792.674] (-1790.960) (-1789.904) -- 0:04:56
389500 -- (-1787.878) (-1785.574) (-1789.903) [-1796.478] * (-1789.818) (-1792.658) [-1790.094] (-1798.972) -- 0:04:56
390000 -- [-1789.030] (-1788.340) (-1794.935) (-1795.321) * (-1792.340) (-1799.878) (-1789.450) [-1796.393] -- 0:04:55
Average standard deviation of split frequencies: 0.008885
390500 -- (-1791.922) (-1794.824) (-1787.617) [-1793.882] * [-1802.562] (-1790.426) (-1793.173) (-1792.989) -- 0:04:54
391000 -- [-1785.265] (-1794.193) (-1801.248) (-1794.674) * [-1793.939] (-1785.349) (-1793.631) (-1795.221) -- 0:04:54
391500 -- (-1786.968) (-1796.889) [-1786.524] (-1805.023) * (-1798.200) (-1795.093) (-1790.876) [-1791.145] -- 0:04:55
392000 -- [-1787.540] (-1796.007) (-1796.373) (-1793.618) * (-1808.699) (-1793.984) (-1785.742) [-1790.989] -- 0:04:54
392500 -- (-1791.523) (-1790.695) (-1794.724) [-1787.688] * (-1792.634) (-1805.009) [-1790.430] (-1802.134) -- 0:04:54
393000 -- (-1808.288) [-1790.018] (-1792.053) (-1793.143) * (-1790.247) [-1792.638] (-1788.973) (-1793.962) -- 0:04:53
393500 -- (-1793.135) (-1802.345) (-1797.899) [-1791.939] * (-1791.877) (-1788.436) [-1792.072] (-1786.685) -- 0:04:54
394000 -- (-1789.193) (-1797.523) [-1793.877] (-1790.029) * (-1792.693) (-1798.017) (-1791.037) [-1796.028] -- 0:04:53
394500 -- (-1805.961) (-1799.770) (-1793.207) [-1788.665] * (-1799.574) (-1809.201) [-1792.326] (-1790.516) -- 0:04:53
395000 -- (-1787.934) (-1802.265) [-1789.913] (-1787.745) * [-1790.497] (-1802.443) (-1787.519) (-1787.559) -- 0:04:54
Average standard deviation of split frequencies: 0.009523
395500 -- (-1794.754) (-1788.044) [-1789.313] (-1788.763) * (-1787.441) (-1795.263) [-1787.369] (-1784.975) -- 0:04:53
396000 -- [-1786.298] (-1794.344) (-1800.915) (-1796.732) * (-1791.455) (-1796.393) (-1793.438) [-1789.585] -- 0:04:52
396500 -- (-1794.038) (-1796.108) (-1799.285) [-1786.528] * (-1790.863) [-1795.890] (-1790.704) (-1793.263) -- 0:04:52
397000 -- (-1797.920) (-1803.468) (-1792.125) [-1786.566] * (-1799.046) (-1786.160) [-1788.517] (-1792.274) -- 0:04:51
397500 -- (-1794.058) (-1792.022) [-1792.077] (-1803.776) * (-1790.620) [-1795.009] (-1791.864) (-1791.162) -- 0:04:52
398000 -- [-1787.887] (-1802.941) (-1796.954) (-1796.403) * (-1796.195) [-1789.773] (-1792.028) (-1792.801) -- 0:04:51
398500 -- (-1791.971) [-1794.863] (-1795.937) (-1797.258) * (-1795.314) (-1789.078) [-1790.795] (-1791.463) -- 0:04:51
399000 -- (-1800.393) [-1785.362] (-1789.928) (-1787.826) * (-1794.048) (-1783.108) [-1793.403] (-1803.541) -- 0:04:50
399500 -- (-1793.825) (-1786.729) (-1796.629) [-1788.779] * (-1797.203) (-1795.110) [-1793.799] (-1800.514) -- 0:04:51
400000 -- (-1795.876) [-1793.843] (-1790.165) (-1799.580) * (-1792.029) (-1787.341) [-1787.643] (-1797.342) -- 0:04:51
Average standard deviation of split frequencies: 0.009305
400500 -- (-1797.858) (-1790.478) (-1793.380) [-1792.084] * [-1795.282] (-1789.793) (-1792.726) (-1791.874) -- 0:04:50
401000 -- (-1795.077) [-1796.436] (-1793.867) (-1794.655) * (-1795.988) (-1797.250) [-1796.913] (-1793.838) -- 0:04:49
401500 -- [-1799.989] (-1794.692) (-1800.728) (-1784.234) * (-1790.863) [-1800.137] (-1797.651) (-1787.455) -- 0:04:50
402000 -- (-1804.924) [-1795.609] (-1801.903) (-1794.572) * (-1793.971) (-1805.326) [-1794.305] (-1798.949) -- 0:04:50
402500 -- [-1787.797] (-1805.619) (-1787.565) (-1790.726) * (-1787.848) [-1794.154] (-1791.721) (-1799.183) -- 0:04:49
403000 -- [-1794.488] (-1789.359) (-1791.234) (-1792.416) * (-1787.809) (-1796.769) (-1791.473) [-1791.027] -- 0:04:48
403500 -- (-1794.795) (-1790.630) [-1792.544] (-1796.706) * [-1795.989] (-1790.921) (-1792.017) (-1791.279) -- 0:04:48
404000 -- (-1794.663) (-1794.757) (-1794.779) [-1795.151] * (-1790.396) [-1784.833] (-1787.940) (-1793.006) -- 0:04:49
404500 -- (-1787.534) (-1792.797) [-1786.098] (-1799.724) * (-1789.263) [-1797.317] (-1791.033) (-1805.886) -- 0:04:48
405000 -- [-1789.938] (-1789.073) (-1786.466) (-1785.428) * (-1792.662) (-1783.608) [-1787.876] (-1792.390) -- 0:04:47
Average standard deviation of split frequencies: 0.010344
405500 -- [-1792.253] (-1788.027) (-1798.809) (-1789.370) * (-1796.722) (-1794.187) [-1788.663] (-1794.270) -- 0:04:47
406000 -- (-1804.110) (-1793.626) [-1788.886] (-1800.941) * [-1789.691] (-1800.072) (-1798.157) (-1791.517) -- 0:04:48
406500 -- (-1796.786) (-1792.370) (-1788.148) [-1788.564] * [-1785.561] (-1789.679) (-1807.836) (-1800.963) -- 0:04:47
407000 -- (-1792.438) (-1799.215) [-1787.303] (-1797.964) * [-1789.065] (-1793.091) (-1800.743) (-1792.882) -- 0:04:47
407500 -- [-1790.934] (-1790.519) (-1795.471) (-1791.728) * (-1792.968) (-1806.348) [-1794.909] (-1794.699) -- 0:04:47
408000 -- (-1796.832) [-1791.475] (-1789.951) (-1801.938) * (-1796.916) [-1790.039] (-1788.196) (-1791.193) -- 0:04:47
408500 -- [-1791.349] (-1792.431) (-1802.749) (-1804.218) * (-1791.730) (-1785.944) [-1794.682] (-1796.155) -- 0:04:46
409000 -- (-1799.951) (-1802.339) [-1795.578] (-1810.521) * (-1792.277) (-1792.093) (-1798.439) [-1790.134] -- 0:04:46
409500 -- (-1791.744) [-1787.604] (-1794.133) (-1788.162) * (-1789.824) (-1791.124) [-1787.284] (-1794.687) -- 0:04:46
410000 -- (-1792.159) (-1788.942) (-1791.794) [-1789.649] * [-1787.271] (-1791.802) (-1793.498) (-1791.821) -- 0:04:46
Average standard deviation of split frequencies: 0.009079
410500 -- (-1806.412) [-1792.843] (-1795.765) (-1794.209) * (-1786.554) (-1800.565) (-1793.178) [-1790.060] -- 0:04:45
411000 -- (-1794.777) (-1786.591) (-1792.358) [-1793.045] * (-1796.176) (-1796.075) (-1786.905) [-1785.723] -- 0:04:45
411500 -- (-1795.169) (-1791.833) (-1788.863) [-1795.318] * (-1789.857) [-1793.323] (-1793.205) (-1792.699) -- 0:04:46
412000 -- (-1791.760) (-1790.476) [-1783.918] (-1786.665) * (-1787.006) (-1793.231) (-1799.725) [-1788.443] -- 0:04:45
412500 -- (-1790.757) [-1794.171] (-1789.435) (-1792.685) * (-1799.153) (-1793.455) [-1794.988] (-1790.674) -- 0:04:44
413000 -- (-1789.600) (-1796.906) (-1790.155) [-1791.452] * [-1788.005] (-1795.137) (-1791.826) (-1795.265) -- 0:04:44
413500 -- [-1786.676] (-1787.786) (-1796.910) (-1797.647) * [-1788.911] (-1790.522) (-1785.253) (-1786.767) -- 0:04:43
414000 -- (-1792.774) (-1790.247) [-1790.226] (-1795.361) * (-1799.239) (-1792.591) (-1795.855) [-1788.290] -- 0:04:44
414500 -- [-1791.817] (-1791.818) (-1789.971) (-1803.321) * (-1786.018) (-1795.999) [-1785.204] (-1799.467) -- 0:04:43
415000 -- [-1794.856] (-1790.447) (-1793.405) (-1794.751) * (-1803.218) (-1793.941) [-1785.757] (-1795.345) -- 0:04:43
Average standard deviation of split frequencies: 0.009065
415500 -- (-1795.827) [-1791.875] (-1788.693) (-1790.045) * (-1807.050) (-1798.166) (-1797.160) [-1788.705] -- 0:04:44
416000 -- [-1783.614] (-1784.729) (-1791.394) (-1792.218) * (-1800.633) [-1799.059] (-1794.319) (-1802.696) -- 0:04:43
416500 -- (-1797.108) [-1789.470] (-1792.226) (-1802.175) * (-1800.375) (-1792.426) [-1788.121] (-1793.554) -- 0:04:42
417000 -- [-1787.874] (-1797.887) (-1794.607) (-1807.226) * [-1794.297] (-1805.837) (-1791.342) (-1791.904) -- 0:04:42
417500 -- (-1794.268) [-1789.339] (-1786.926) (-1792.396) * (-1806.010) (-1791.778) (-1792.639) [-1787.706] -- 0:04:41
418000 -- (-1791.544) (-1787.811) (-1793.311) [-1788.698] * (-1807.071) (-1788.453) (-1785.481) [-1789.634] -- 0:04:42
418500 -- (-1791.910) (-1791.772) (-1800.050) [-1789.707] * (-1788.984) (-1791.486) (-1790.279) [-1789.851] -- 0:04:42
419000 -- (-1788.064) (-1794.668) (-1794.665) [-1793.791] * (-1796.966) (-1793.503) [-1797.272] (-1795.737) -- 0:04:41
419500 -- [-1789.273] (-1808.336) (-1798.916) (-1793.701) * [-1798.073] (-1787.001) (-1804.825) (-1784.556) -- 0:04:40
420000 -- (-1799.292) (-1793.376) [-1795.651] (-1793.978) * (-1793.484) [-1790.713] (-1791.517) (-1793.265) -- 0:04:41
Average standard deviation of split frequencies: 0.009474
420500 -- [-1791.487] (-1795.991) (-1796.245) (-1801.830) * [-1793.542] (-1798.246) (-1787.491) (-1795.804) -- 0:04:41
421000 -- (-1806.619) (-1809.208) (-1795.643) [-1790.169] * (-1796.369) [-1786.696] (-1801.748) (-1787.277) -- 0:04:40
421500 -- (-1794.366) (-1802.049) (-1792.398) [-1785.245] * (-1794.713) (-1792.303) (-1788.273) [-1789.624] -- 0:04:39
422000 -- [-1789.780] (-1788.172) (-1797.704) (-1794.955) * (-1795.293) [-1796.294] (-1784.184) (-1787.940) -- 0:04:40
422500 -- (-1787.017) (-1794.754) [-1798.357] (-1793.869) * (-1797.380) (-1782.757) [-1794.789] (-1795.521) -- 0:04:40
423000 -- (-1790.791) (-1805.665) [-1791.188] (-1795.370) * (-1793.725) [-1793.635] (-1792.537) (-1795.349) -- 0:04:39
423500 -- (-1795.477) (-1787.753) [-1789.667] (-1791.488) * (-1790.684) (-1802.769) (-1791.928) [-1792.195] -- 0:04:39
424000 -- (-1791.855) (-1794.591) [-1794.851] (-1789.420) * (-1802.017) (-1791.017) (-1791.905) [-1788.978] -- 0:04:38
424500 -- (-1802.699) (-1791.587) [-1788.816] (-1791.469) * (-1792.305) (-1803.929) (-1786.908) [-1796.370] -- 0:04:39
425000 -- (-1796.286) (-1801.757) (-1791.140) [-1797.608] * (-1805.146) (-1800.317) (-1791.527) [-1785.759] -- 0:04:38
Average standard deviation of split frequencies: 0.009456
425500 -- (-1791.659) (-1788.415) [-1789.475] (-1792.437) * (-1797.226) (-1788.970) (-1792.772) [-1786.038] -- 0:04:38
426000 -- (-1787.214) [-1789.843] (-1794.313) (-1790.589) * [-1793.334] (-1799.004) (-1792.763) (-1794.630) -- 0:04:37
426500 -- [-1787.728] (-1793.538) (-1802.264) (-1795.087) * (-1808.002) (-1795.571) (-1790.970) [-1790.781] -- 0:04:38
427000 -- [-1789.750] (-1795.636) (-1800.187) (-1809.590) * [-1791.017] (-1794.630) (-1785.193) (-1790.647) -- 0:04:37
427500 -- [-1788.935] (-1795.144) (-1794.504) (-1789.206) * (-1788.045) [-1782.904] (-1795.063) (-1797.978) -- 0:04:37
428000 -- (-1788.269) (-1794.279) (-1790.301) [-1792.181] * (-1794.480) (-1793.906) (-1804.329) [-1791.145] -- 0:04:36
428500 -- (-1792.069) (-1797.360) [-1784.423] (-1791.499) * (-1810.131) (-1796.134) [-1799.267] (-1794.612) -- 0:04:37
429000 -- (-1790.950) (-1796.699) [-1787.857] (-1788.324) * (-1797.610) (-1796.441) (-1799.189) [-1793.919] -- 0:04:36
429500 -- (-1791.583) (-1792.220) (-1799.978) [-1792.740] * (-1804.267) (-1793.793) (-1798.809) [-1799.540] -- 0:04:36
430000 -- (-1789.136) [-1794.923] (-1784.008) (-1801.661) * (-1798.381) (-1790.547) [-1792.539] (-1798.481) -- 0:04:35
Average standard deviation of split frequencies: 0.009961
430500 -- (-1793.481) [-1800.997] (-1790.486) (-1787.321) * (-1811.790) (-1792.269) (-1796.319) [-1795.030] -- 0:04:36
431000 -- [-1791.833] (-1795.073) (-1800.372) (-1787.859) * (-1806.025) [-1786.650] (-1795.194) (-1795.856) -- 0:04:35
431500 -- (-1790.590) [-1785.602] (-1797.331) (-1805.252) * (-1795.386) [-1788.264] (-1787.168) (-1797.958) -- 0:04:35
432000 -- [-1790.179] (-1788.440) (-1788.330) (-1801.111) * (-1791.775) (-1784.713) [-1801.359] (-1797.938) -- 0:04:36
432500 -- (-1792.241) (-1792.410) [-1790.541] (-1799.029) * [-1790.311] (-1791.179) (-1792.833) (-1796.954) -- 0:04:35
433000 -- (-1786.213) [-1793.533] (-1794.147) (-1797.751) * [-1798.001] (-1790.629) (-1794.570) (-1787.846) -- 0:04:34
433500 -- [-1787.957] (-1792.739) (-1800.253) (-1789.120) * (-1790.885) (-1802.956) [-1788.171] (-1797.586) -- 0:04:34
434000 -- (-1789.912) [-1785.501] (-1791.614) (-1793.997) * (-1789.225) [-1790.711] (-1794.220) (-1791.077) -- 0:04:33
434500 -- (-1795.547) [-1792.124] (-1789.325) (-1788.408) * [-1790.344] (-1794.713) (-1796.988) (-1801.261) -- 0:04:34
435000 -- (-1794.407) (-1800.231) [-1792.566] (-1785.851) * (-1789.221) (-1791.725) [-1789.735] (-1804.852) -- 0:04:34
Average standard deviation of split frequencies: 0.010271
435500 -- (-1804.874) (-1790.546) (-1793.605) [-1788.398] * [-1787.499] (-1796.650) (-1789.136) (-1791.999) -- 0:04:33
436000 -- (-1803.241) [-1792.054] (-1789.367) (-1790.779) * (-1787.591) (-1794.193) [-1790.334] (-1791.130) -- 0:04:32
436500 -- [-1793.852] (-1791.497) (-1795.960) (-1789.814) * (-1790.581) (-1798.882) (-1787.261) [-1792.918] -- 0:04:33
437000 -- (-1796.341) (-1793.299) (-1792.360) [-1791.267] * (-1792.504) (-1800.805) (-1788.318) [-1784.515] -- 0:04:33
437500 -- (-1803.816) (-1792.081) (-1801.406) [-1788.537] * [-1796.490] (-1792.944) (-1804.219) (-1798.107) -- 0:04:32
438000 -- (-1797.366) (-1784.985) (-1788.577) [-1791.690] * (-1792.408) (-1792.892) (-1802.094) [-1788.032] -- 0:04:32
438500 -- [-1796.751] (-1794.794) (-1795.355) (-1790.135) * [-1789.906] (-1786.316) (-1804.309) (-1801.492) -- 0:04:32
439000 -- [-1795.469] (-1794.595) (-1789.018) (-1795.624) * (-1794.286) (-1787.538) (-1810.315) [-1788.251] -- 0:04:32
439500 -- (-1796.980) [-1788.175] (-1794.193) (-1794.744) * (-1796.471) (-1785.309) [-1789.567] (-1794.541) -- 0:04:31
440000 -- (-1796.273) (-1806.166) (-1794.346) [-1793.631] * (-1790.044) (-1789.806) (-1799.655) [-1798.827] -- 0:04:31
Average standard deviation of split frequencies: 0.009093
440500 -- [-1788.247] (-1794.601) (-1796.318) (-1802.525) * (-1786.923) (-1799.012) (-1789.504) [-1799.325] -- 0:04:31
441000 -- (-1799.823) (-1793.402) [-1796.866] (-1807.789) * (-1794.488) [-1795.523] (-1787.235) (-1793.879) -- 0:04:31
441500 -- [-1795.209] (-1797.411) (-1793.831) (-1799.488) * (-1800.455) (-1788.284) [-1788.465] (-1791.935) -- 0:04:30
442000 -- (-1803.303) [-1794.569] (-1793.761) (-1789.579) * [-1792.796] (-1796.864) (-1800.716) (-1787.664) -- 0:04:30
442500 -- (-1802.455) (-1795.661) [-1789.586] (-1791.463) * [-1786.874] (-1797.595) (-1804.263) (-1791.617) -- 0:04:30
443000 -- [-1788.357] (-1792.315) (-1794.600) (-1791.469) * (-1789.890) (-1794.128) [-1796.419] (-1791.533) -- 0:04:30
443500 -- (-1797.567) [-1789.130] (-1790.304) (-1795.805) * (-1798.335) (-1786.928) (-1803.076) [-1788.889] -- 0:04:29
444000 -- (-1795.738) (-1803.299) [-1786.299] (-1790.797) * (-1792.400) (-1790.126) (-1794.772) [-1789.713] -- 0:04:29
444500 -- [-1793.804] (-1790.614) (-1797.784) (-1784.130) * [-1791.075] (-1796.405) (-1800.040) (-1795.870) -- 0:04:29
445000 -- (-1797.850) [-1785.056] (-1786.117) (-1793.148) * (-1785.149) (-1796.777) (-1794.215) [-1786.365] -- 0:04:29
Average standard deviation of split frequencies: 0.008984
445500 -- (-1796.396) (-1794.998) (-1788.031) [-1792.433] * (-1798.374) (-1797.917) [-1794.707] (-1799.333) -- 0:04:28
446000 -- (-1796.101) [-1789.790] (-1800.547) (-1802.844) * [-1796.872] (-1796.506) (-1798.338) (-1793.822) -- 0:04:28
446500 -- (-1800.920) (-1810.035) [-1794.505] (-1784.763) * (-1792.598) (-1801.038) (-1810.828) [-1786.959] -- 0:04:29
447000 -- (-1798.553) (-1795.353) [-1790.980] (-1787.922) * (-1794.407) (-1792.205) (-1795.888) [-1793.087] -- 0:04:28
447500 -- (-1790.080) [-1801.385] (-1789.510) (-1792.140) * (-1799.341) [-1788.862] (-1793.581) (-1789.920) -- 0:04:27
448000 -- (-1787.195) (-1801.562) [-1786.460] (-1789.069) * (-1802.941) (-1795.981) (-1794.141) [-1792.224] -- 0:04:27
448500 -- (-1796.119) (-1786.799) (-1791.865) [-1794.772] * (-1792.859) [-1792.532] (-1795.235) (-1790.214) -- 0:04:28
449000 -- (-1791.463) (-1799.092) [-1784.395] (-1788.234) * (-1794.435) [-1789.478] (-1801.467) (-1792.653) -- 0:04:27
449500 -- (-1794.281) (-1797.894) [-1788.932] (-1794.947) * (-1799.897) [-1788.700] (-1802.417) (-1791.976) -- 0:04:26
450000 -- (-1800.660) [-1789.254] (-1793.243) (-1790.337) * (-1800.457) (-1783.161) [-1793.977] (-1795.759) -- 0:04:26
Average standard deviation of split frequencies: 0.008054
450500 -- (-1805.619) (-1800.606) [-1786.832] (-1799.239) * [-1791.046] (-1791.112) (-1791.962) (-1791.820) -- 0:04:25
451000 -- (-1797.336) (-1794.663) (-1789.854) [-1790.532] * [-1795.701] (-1783.455) (-1795.484) (-1789.003) -- 0:04:26
451500 -- (-1792.798) (-1788.113) (-1789.732) [-1796.349] * (-1799.513) (-1787.128) (-1805.327) [-1783.484] -- 0:04:26
452000 -- (-1799.458) (-1785.913) (-1801.178) [-1797.459] * (-1788.583) [-1784.405] (-1794.918) (-1788.620) -- 0:04:25
452500 -- (-1798.591) (-1793.572) (-1792.571) [-1796.940] * (-1792.374) (-1791.819) (-1792.695) [-1788.217] -- 0:04:24
453000 -- (-1794.455) (-1796.708) [-1788.859] (-1792.596) * (-1804.495) (-1792.720) (-1788.941) [-1790.787] -- 0:04:25
453500 -- [-1788.278] (-1793.706) (-1799.840) (-1784.231) * (-1799.396) (-1793.620) [-1794.568] (-1793.033) -- 0:04:25
454000 -- (-1801.135) (-1792.023) (-1791.091) [-1790.512] * (-1789.668) (-1789.796) [-1791.002] (-1795.367) -- 0:04:24
454500 -- (-1791.196) [-1800.219] (-1791.541) (-1796.622) * (-1799.842) (-1791.951) (-1802.670) [-1789.344] -- 0:04:24
455000 -- (-1795.667) [-1791.075] (-1788.966) (-1790.094) * (-1796.177) [-1787.227] (-1783.988) (-1789.781) -- 0:04:24
Average standard deviation of split frequencies: 0.007753
455500 -- (-1792.993) [-1784.694] (-1791.759) (-1800.692) * (-1792.858) (-1795.344) [-1791.110] (-1800.911) -- 0:04:24
456000 -- [-1791.022] (-1793.150) (-1782.727) (-1787.384) * (-1794.387) (-1789.502) (-1799.287) [-1794.083] -- 0:04:23
456500 -- (-1786.138) (-1787.519) (-1800.163) [-1787.921] * [-1798.751] (-1792.536) (-1791.717) (-1796.736) -- 0:04:23
457000 -- (-1797.234) (-1790.964) (-1790.416) [-1790.550] * (-1792.659) [-1789.383] (-1798.563) (-1789.330) -- 0:04:22
457500 -- (-1801.079) [-1789.516] (-1795.224) (-1799.097) * (-1793.831) (-1788.754) (-1800.821) [-1795.260] -- 0:04:23
458000 -- (-1809.600) [-1797.414] (-1787.653) (-1807.564) * [-1793.739] (-1793.210) (-1788.446) (-1804.950) -- 0:04:22
458500 -- (-1794.070) [-1790.123] (-1795.122) (-1803.392) * [-1788.234] (-1792.695) (-1804.036) (-1794.781) -- 0:04:22
459000 -- (-1790.456) (-1789.160) [-1786.909] (-1793.786) * (-1792.123) [-1788.009] (-1789.936) (-1787.820) -- 0:04:21
459500 -- (-1796.038) (-1793.928) [-1784.730] (-1797.018) * (-1784.240) [-1781.574] (-1789.746) (-1797.949) -- 0:04:22
460000 -- (-1789.908) [-1787.226] (-1790.075) (-1801.920) * (-1796.684) [-1792.012] (-1785.328) (-1786.125) -- 0:04:21
Average standard deviation of split frequencies: 0.008391
460500 -- (-1791.287) (-1795.529) [-1790.276] (-1793.858) * (-1788.523) [-1791.439] (-1797.357) (-1788.601) -- 0:04:21
461000 -- [-1796.081] (-1793.206) (-1799.479) (-1789.285) * (-1795.255) (-1801.724) (-1806.805) [-1794.141] -- 0:04:20
461500 -- [-1787.334] (-1809.289) (-1788.473) (-1801.154) * (-1790.866) (-1796.784) [-1782.742] (-1786.379) -- 0:04:21
462000 -- (-1787.348) (-1796.170) [-1791.182] (-1792.408) * (-1792.470) [-1784.844] (-1799.891) (-1794.684) -- 0:04:20
462500 -- (-1792.967) (-1795.495) (-1795.682) [-1789.891] * (-1786.223) (-1789.811) (-1786.931) [-1787.933] -- 0:04:20
463000 -- [-1793.800] (-1791.060) (-1797.430) (-1794.870) * (-1792.902) (-1796.226) (-1787.410) [-1787.275] -- 0:04:19
463500 -- [-1795.089] (-1790.436) (-1789.622) (-1791.420) * (-1798.779) (-1789.198) [-1791.694] (-1792.392) -- 0:04:20
464000 -- (-1786.299) [-1785.631] (-1791.257) (-1793.172) * (-1791.840) [-1790.579] (-1798.005) (-1782.883) -- 0:04:19
464500 -- (-1790.381) (-1791.435) [-1795.747] (-1787.029) * (-1792.467) [-1787.596] (-1803.676) (-1793.200) -- 0:04:19
465000 -- (-1792.113) (-1791.271) [-1786.310] (-1788.317) * (-1796.371) [-1787.477] (-1797.463) (-1794.554) -- 0:04:18
Average standard deviation of split frequencies: 0.008396
465500 -- (-1792.583) [-1800.484] (-1792.255) (-1787.086) * [-1796.047] (-1787.700) (-1793.830) (-1784.823) -- 0:04:19
466000 -- [-1791.574] (-1802.184) (-1792.246) (-1799.005) * (-1800.419) (-1796.603) [-1798.168] (-1791.874) -- 0:04:18
466500 -- (-1790.239) [-1796.713] (-1799.360) (-1792.722) * [-1795.159] (-1791.504) (-1796.445) (-1793.022) -- 0:04:18
467000 -- (-1795.654) (-1794.325) (-1799.059) [-1790.167] * (-1799.450) [-1785.858] (-1798.548) (-1802.872) -- 0:04:17
467500 -- (-1794.536) [-1792.713] (-1793.863) (-1792.048) * [-1794.420] (-1787.929) (-1788.899) (-1808.907) -- 0:04:18
468000 -- (-1805.034) (-1796.555) (-1789.721) [-1789.184] * [-1789.700] (-1790.474) (-1800.768) (-1792.117) -- 0:04:18
468500 -- (-1800.623) (-1805.751) (-1794.182) [-1793.298] * (-1798.145) [-1793.416] (-1797.480) (-1793.981) -- 0:04:17
469000 -- [-1795.430] (-1794.400) (-1788.389) (-1799.918) * (-1791.191) [-1790.211] (-1789.425) (-1797.366) -- 0:04:17
469500 -- (-1790.104) (-1790.990) (-1806.554) [-1790.641] * (-1787.737) (-1801.841) (-1796.949) [-1787.571] -- 0:04:17
470000 -- (-1795.441) [-1790.842] (-1789.315) (-1795.133) * (-1795.410) [-1791.120] (-1795.540) (-1788.328) -- 0:04:17
Average standard deviation of split frequencies: 0.008113
470500 -- [-1792.705] (-1792.985) (-1797.080) (-1789.011) * (-1790.565) (-1794.806) (-1798.838) [-1787.992] -- 0:04:16
471000 -- [-1784.766] (-1804.116) (-1790.025) (-1808.580) * (-1793.517) (-1790.932) (-1794.415) [-1787.781] -- 0:04:17
471500 -- (-1787.292) (-1799.248) [-1787.132] (-1802.888) * [-1793.331] (-1796.419) (-1796.595) (-1787.768) -- 0:04:16
472000 -- [-1790.598] (-1792.745) (-1792.977) (-1800.370) * [-1787.044] (-1788.570) (-1791.644) (-1790.433) -- 0:04:16
472500 -- (-1795.025) [-1793.194] (-1796.642) (-1797.358) * (-1792.274) (-1805.138) [-1789.520] (-1789.208) -- 0:04:15
473000 -- (-1789.061) [-1794.522] (-1803.483) (-1799.126) * (-1796.919) [-1791.813] (-1797.847) (-1793.192) -- 0:04:15
473500 -- (-1791.168) (-1794.176) [-1796.517] (-1790.116) * (-1800.342) (-1791.485) (-1795.787) [-1787.431] -- 0:04:15
474000 -- (-1800.511) [-1799.975] (-1793.383) (-1794.390) * (-1794.628) (-1792.768) (-1792.691) [-1788.238] -- 0:04:15
474500 -- [-1790.494] (-1791.531) (-1794.041) (-1792.889) * [-1788.375] (-1800.605) (-1789.069) (-1789.566) -- 0:04:14
475000 -- (-1794.496) (-1797.023) (-1790.618) [-1783.706] * (-1791.927) (-1788.255) (-1800.878) [-1791.310] -- 0:04:15
Average standard deviation of split frequencies: 0.008913
475500 -- (-1793.120) (-1794.682) [-1790.262] (-1787.182) * (-1793.756) [-1790.316] (-1794.286) (-1794.671) -- 0:04:14
476000 -- (-1807.954) (-1796.452) (-1785.144) [-1784.429] * (-1795.625) (-1796.640) [-1795.709] (-1788.067) -- 0:04:14
476500 -- [-1792.254] (-1789.747) (-1785.967) (-1791.809) * (-1793.851) [-1784.758] (-1796.691) (-1791.309) -- 0:04:14
477000 -- [-1792.307] (-1797.022) (-1788.841) (-1798.486) * (-1790.803) [-1792.899] (-1790.886) (-1790.995) -- 0:04:14
477500 -- (-1796.725) [-1795.626] (-1786.724) (-1797.012) * (-1792.446) (-1797.140) [-1790.669] (-1792.402) -- 0:04:13
478000 -- (-1787.963) (-1798.050) [-1784.672] (-1794.097) * (-1796.341) (-1802.775) (-1791.623) [-1794.497] -- 0:04:13
478500 -- (-1796.575) (-1794.452) [-1782.123] (-1794.833) * (-1798.438) (-1796.172) (-1791.129) [-1789.377] -- 0:04:13
479000 -- [-1786.127] (-1797.478) (-1790.751) (-1790.700) * (-1791.204) [-1789.438] (-1793.278) (-1792.280) -- 0:04:13
479500 -- [-1786.479] (-1798.538) (-1794.667) (-1789.212) * (-1789.164) (-1808.256) [-1794.057] (-1797.093) -- 0:04:12
480000 -- [-1793.427] (-1801.972) (-1794.309) (-1785.318) * (-1797.185) (-1795.037) (-1798.156) [-1794.912] -- 0:04:12
Average standard deviation of split frequencies: 0.008434
480500 -- [-1788.857] (-1799.163) (-1793.702) (-1797.326) * [-1795.382] (-1790.413) (-1792.604) (-1794.338) -- 0:04:12
481000 -- (-1787.399) (-1789.267) (-1793.804) [-1791.748] * (-1795.377) (-1793.397) [-1790.144] (-1805.847) -- 0:04:12
481500 -- [-1792.928] (-1789.147) (-1796.380) (-1788.223) * [-1794.509] (-1793.004) (-1792.764) (-1800.174) -- 0:04:11
482000 -- (-1789.960) (-1789.563) [-1789.569] (-1795.961) * (-1794.230) [-1791.371] (-1790.885) (-1797.261) -- 0:04:12
482500 -- (-1784.867) (-1793.087) [-1789.370] (-1794.118) * (-1797.387) (-1791.936) (-1798.699) [-1791.099] -- 0:04:12
483000 -- (-1793.476) (-1788.161) [-1788.903] (-1796.245) * (-1789.708) (-1788.633) (-1788.955) [-1790.165] -- 0:04:11
483500 -- (-1789.417) (-1785.703) [-1789.363] (-1793.869) * (-1791.699) [-1788.582] (-1795.460) (-1793.786) -- 0:04:11
484000 -- (-1798.042) (-1799.716) (-1790.332) [-1785.164] * (-1800.811) (-1794.549) (-1788.032) [-1794.637] -- 0:04:10
484500 -- (-1792.539) (-1789.004) (-1797.272) [-1792.526] * [-1789.019] (-1795.911) (-1789.895) (-1799.410) -- 0:04:11
485000 -- (-1789.092) (-1791.701) [-1792.888] (-1797.609) * (-1796.925) (-1801.111) (-1788.904) [-1794.063] -- 0:04:10
Average standard deviation of split frequencies: 0.008051
485500 -- (-1790.994) (-1795.203) [-1791.298] (-1791.666) * (-1798.590) (-1793.898) [-1791.629] (-1793.083) -- 0:04:10
486000 -- (-1786.933) (-1798.728) (-1794.635) [-1784.404] * [-1791.522] (-1799.259) (-1790.549) (-1794.917) -- 0:04:09
486500 -- [-1792.259] (-1805.977) (-1800.459) (-1795.978) * (-1801.231) (-1792.663) (-1787.856) [-1790.129] -- 0:04:10
487000 -- (-1789.093) [-1793.149] (-1797.581) (-1798.158) * [-1787.015] (-1797.142) (-1785.785) (-1799.764) -- 0:04:09
487500 -- (-1794.675) (-1803.417) [-1790.081] (-1787.309) * (-1795.135) (-1799.453) (-1801.022) [-1790.906] -- 0:04:09
488000 -- [-1792.947] (-1793.834) (-1789.962) (-1791.347) * (-1802.592) (-1794.247) (-1797.739) [-1789.704] -- 0:04:08
488500 -- [-1787.799] (-1793.216) (-1797.440) (-1799.612) * [-1789.680] (-1793.205) (-1785.459) (-1798.710) -- 0:04:09
489000 -- (-1799.527) (-1798.331) (-1794.466) [-1789.843] * [-1789.936] (-1795.746) (-1787.077) (-1788.996) -- 0:04:08
489500 -- (-1794.411) (-1795.934) (-1799.572) [-1792.507] * (-1792.980) (-1795.922) (-1792.766) [-1793.652] -- 0:04:08
490000 -- (-1794.027) [-1789.720] (-1798.324) (-1792.796) * (-1803.985) [-1793.680] (-1801.473) (-1787.272) -- 0:04:07
Average standard deviation of split frequencies: 0.007686
490500 -- (-1791.550) (-1788.449) [-1783.916] (-1796.345) * (-1796.420) [-1791.845] (-1785.896) (-1794.156) -- 0:04:08
491000 -- (-1785.907) [-1791.953] (-1794.774) (-1789.159) * (-1801.083) (-1786.529) [-1785.334] (-1786.367) -- 0:04:07
491500 -- [-1783.259] (-1794.235) (-1784.423) (-1787.223) * [-1787.005] (-1796.599) (-1788.733) (-1785.437) -- 0:04:07
492000 -- (-1802.192) [-1787.780] (-1788.114) (-1785.269) * (-1788.175) [-1792.585] (-1792.831) (-1803.226) -- 0:04:06
492500 -- (-1794.322) [-1786.030] (-1794.596) (-1790.148) * (-1789.287) (-1793.263) (-1787.187) [-1789.629] -- 0:04:07
493000 -- (-1794.554) (-1794.761) [-1790.168] (-1790.717) * [-1785.595] (-1792.987) (-1794.457) (-1787.849) -- 0:04:06
493500 -- (-1793.468) (-1789.349) [-1792.451] (-1790.317) * (-1791.093) (-1790.333) [-1785.933] (-1798.410) -- 0:04:06
494000 -- (-1803.302) [-1786.755] (-1792.475) (-1789.783) * (-1791.807) (-1790.423) [-1795.372] (-1798.806) -- 0:04:05
494500 -- (-1792.097) (-1789.690) [-1789.967] (-1793.105) * (-1787.890) (-1800.254) [-1788.408] (-1798.863) -- 0:04:05
495000 -- (-1803.172) [-1795.745] (-1790.997) (-1787.089) * (-1793.260) (-1799.275) [-1792.125] (-1790.197) -- 0:04:05
Average standard deviation of split frequencies: 0.007508
495500 -- (-1794.686) [-1784.763] (-1794.080) (-1792.160) * [-1789.584] (-1792.909) (-1794.071) (-1791.213) -- 0:04:05
496000 -- (-1793.058) [-1791.336] (-1805.733) (-1796.925) * (-1783.924) (-1793.629) [-1793.368] (-1786.556) -- 0:04:04
496500 -- (-1800.133) [-1792.705] (-1801.248) (-1790.354) * (-1792.505) (-1790.886) (-1797.815) [-1798.245] -- 0:04:05
497000 -- (-1796.253) [-1806.068] (-1802.207) (-1789.477) * (-1793.214) (-1785.227) [-1802.457] (-1806.138) -- 0:04:04
497500 -- (-1792.042) [-1789.156] (-1790.156) (-1797.974) * [-1792.324] (-1787.937) (-1799.438) (-1797.688) -- 0:04:04
498000 -- [-1787.786] (-1785.911) (-1802.024) (-1792.066) * (-1795.717) [-1788.594] (-1794.475) (-1804.402) -- 0:04:03
498500 -- (-1788.425) (-1794.316) (-1797.736) [-1793.638] * (-1793.102) [-1784.611] (-1797.093) (-1792.891) -- 0:04:04
499000 -- [-1790.288] (-1783.323) (-1794.021) (-1801.694) * [-1787.126] (-1788.555) (-1799.454) (-1799.050) -- 0:04:03
499500 -- (-1800.494) (-1790.252) [-1789.116] (-1801.648) * (-1801.619) (-1794.892) [-1790.165] (-1794.531) -- 0:04:03
500000 -- (-1801.644) [-1794.644] (-1796.896) (-1796.146) * (-1787.628) (-1792.256) [-1786.434] (-1799.951) -- 0:04:04
Average standard deviation of split frequencies: 0.006685
500500 -- (-1795.719) [-1792.480] (-1792.049) (-1804.059) * (-1791.105) (-1790.012) [-1789.486] (-1794.882) -- 0:04:03
501000 -- (-1802.119) [-1791.518] (-1793.132) (-1791.722) * [-1787.396] (-1791.236) (-1800.477) (-1787.732) -- 0:04:03
501500 -- (-1792.639) (-1798.408) [-1793.913] (-1800.227) * [-1793.803] (-1789.424) (-1807.310) (-1787.670) -- 0:04:02
502000 -- (-1791.763) (-1788.145) (-1795.160) [-1792.507] * (-1791.761) (-1790.624) [-1795.834] (-1789.272) -- 0:04:03
502500 -- (-1786.242) [-1794.551] (-1804.253) (-1787.911) * [-1783.450] (-1804.647) (-1798.325) (-1788.120) -- 0:04:02
503000 -- (-1791.028) (-1792.663) (-1794.801) [-1793.440] * (-1798.063) (-1795.795) (-1795.890) [-1794.137] -- 0:04:02
503500 -- (-1794.476) (-1803.086) [-1787.972] (-1795.724) * (-1791.209) (-1788.351) [-1791.797] (-1784.228) -- 0:04:01
504000 -- (-1789.548) (-1800.106) [-1787.434] (-1788.083) * (-1789.566) (-1794.764) (-1803.795) [-1795.624] -- 0:04:01
504500 -- (-1799.958) (-1805.681) [-1792.294] (-1788.332) * (-1792.756) [-1799.577] (-1797.874) (-1795.545) -- 0:04:01
505000 -- (-1790.406) (-1796.147) (-1801.005) [-1785.564] * (-1792.809) (-1797.047) [-1787.900] (-1795.932) -- 0:04:01
Average standard deviation of split frequencies: 0.006775
505500 -- (-1790.475) (-1795.116) (-1792.675) [-1789.276] * (-1790.659) (-1788.277) [-1787.970] (-1792.187) -- 0:04:00
506000 -- (-1793.008) (-1801.693) (-1788.635) [-1791.392] * (-1792.271) (-1788.166) [-1787.500] (-1795.119) -- 0:04:00
506500 -- (-1800.831) (-1792.701) (-1787.336) [-1791.063] * (-1791.235) [-1785.747] (-1798.158) (-1796.124) -- 0:04:00
507000 -- [-1794.062] (-1795.729) (-1797.305) (-1789.336) * [-1788.208] (-1794.654) (-1791.889) (-1796.624) -- 0:04:00
507500 -- (-1800.910) (-1791.087) [-1793.101] (-1790.636) * (-1795.243) [-1798.288] (-1796.037) (-1804.421) -- 0:03:59
508000 -- (-1801.415) (-1790.764) [-1789.010] (-1791.661) * (-1789.151) (-1791.500) [-1794.482] (-1803.638) -- 0:03:59
508500 -- (-1794.334) [-1795.024] (-1800.720) (-1790.983) * (-1797.106) (-1803.264) [-1796.394] (-1785.456) -- 0:03:59
509000 -- (-1795.973) [-1793.848] (-1795.922) (-1797.117) * (-1792.045) (-1784.645) (-1798.635) [-1793.043] -- 0:03:59
509500 -- (-1792.413) (-1797.294) (-1785.614) [-1788.634] * (-1787.738) (-1796.580) [-1793.491] (-1793.792) -- 0:03:58
510000 -- (-1792.306) (-1794.855) [-1786.217] (-1794.481) * [-1789.998] (-1810.645) (-1794.195) (-1791.639) -- 0:03:58
Average standard deviation of split frequencies: 0.006126
510500 -- (-1808.595) [-1788.842] (-1793.414) (-1788.401) * (-1789.024) (-1805.660) [-1789.819] (-1785.546) -- 0:03:57
511000 -- (-1806.026) [-1792.824] (-1790.335) (-1787.797) * [-1790.077] (-1798.088) (-1795.520) (-1787.527) -- 0:03:58
511500 -- [-1792.658] (-1788.521) (-1801.442) (-1801.914) * (-1793.096) [-1793.252] (-1799.307) (-1792.203) -- 0:03:57
512000 -- [-1796.810] (-1790.610) (-1795.872) (-1791.598) * (-1801.627) (-1794.383) (-1798.601) [-1786.565] -- 0:03:57
512500 -- (-1803.500) (-1789.708) (-1794.321) [-1786.045] * (-1796.112) [-1792.473] (-1785.406) (-1797.261) -- 0:03:56
513000 -- (-1791.204) [-1795.156] (-1798.001) (-1788.463) * (-1803.649) [-1786.287] (-1786.349) (-1787.476) -- 0:03:57
513500 -- (-1790.144) [-1789.203] (-1792.272) (-1793.186) * [-1789.594] (-1795.719) (-1790.191) (-1791.479) -- 0:03:56
514000 -- (-1786.935) [-1790.591] (-1786.948) (-1794.558) * (-1793.723) (-1795.949) [-1790.462] (-1790.024) -- 0:03:56
514500 -- [-1785.909] (-1796.912) (-1798.771) (-1797.424) * (-1786.568) (-1799.703) (-1800.393) [-1782.749] -- 0:03:55
515000 -- (-1798.081) (-1800.531) (-1792.633) [-1799.946] * (-1795.095) [-1789.411] (-1790.758) (-1797.982) -- 0:03:56
Average standard deviation of split frequencies: 0.006063
515500 -- (-1790.756) [-1795.074] (-1792.417) (-1796.889) * (-1804.522) [-1798.622] (-1801.154) (-1801.708) -- 0:03:55
516000 -- [-1788.625] (-1793.380) (-1794.447) (-1791.871) * [-1791.858] (-1796.681) (-1799.141) (-1795.955) -- 0:03:55
516500 -- (-1795.149) (-1790.067) (-1794.912) [-1791.141] * (-1788.309) (-1792.307) (-1788.923) [-1786.317] -- 0:03:54
517000 -- (-1788.574) (-1785.608) (-1799.901) [-1788.963] * (-1791.251) [-1786.082] (-1803.698) (-1801.191) -- 0:03:55
517500 -- (-1790.439) (-1789.894) [-1789.605] (-1792.666) * (-1795.644) [-1790.987] (-1797.871) (-1793.060) -- 0:03:54
518000 -- [-1790.196] (-1795.456) (-1801.535) (-1799.780) * (-1801.634) [-1790.964] (-1793.082) (-1796.897) -- 0:03:54
518500 -- [-1787.281] (-1790.852) (-1795.594) (-1800.920) * (-1786.406) (-1790.019) [-1797.055] (-1806.570) -- 0:03:54
519000 -- [-1789.024] (-1796.171) (-1804.610) (-1790.156) * [-1788.205] (-1785.946) (-1798.505) (-1796.976) -- 0:03:54
519500 -- (-1801.651) (-1799.900) [-1791.685] (-1786.607) * [-1794.225] (-1782.206) (-1795.473) (-1796.125) -- 0:03:54
520000 -- (-1801.949) (-1798.605) [-1788.087] (-1788.482) * (-1797.505) (-1795.330) (-1809.819) [-1791.084] -- 0:03:53
Average standard deviation of split frequencies: 0.006971
520500 -- (-1800.578) (-1800.054) (-1788.745) [-1795.006] * [-1795.044] (-1799.594) (-1794.337) (-1797.004) -- 0:03:53
521000 -- (-1801.516) (-1788.269) (-1802.955) [-1794.833] * (-1807.782) [-1791.046] (-1798.767) (-1796.005) -- 0:03:53
521500 -- (-1805.537) [-1780.785] (-1801.280) (-1797.436) * (-1798.403) (-1804.955) [-1792.657] (-1791.454) -- 0:03:53
522000 -- (-1797.100) (-1795.714) (-1793.132) [-1785.220] * (-1792.513) (-1800.013) (-1794.514) [-1793.924] -- 0:03:52
522500 -- (-1790.671) [-1790.296] (-1796.853) (-1792.736) * (-1792.124) [-1798.426] (-1792.972) (-1800.428) -- 0:03:52
523000 -- (-1791.907) (-1796.365) (-1796.021) [-1782.603] * [-1791.464] (-1793.681) (-1788.649) (-1800.255) -- 0:03:52
523500 -- (-1803.748) (-1794.343) (-1795.386) [-1792.114] * (-1791.941) (-1790.572) (-1796.093) [-1788.549] -- 0:03:52
524000 -- (-1792.589) (-1788.130) (-1799.507) [-1792.498] * (-1790.442) [-1792.735] (-1790.562) (-1803.155) -- 0:03:51
524500 -- [-1784.447] (-1790.626) (-1798.701) (-1791.094) * (-1791.442) [-1793.369] (-1795.524) (-1798.124) -- 0:03:51
525000 -- (-1796.828) [-1780.964] (-1799.840) (-1796.887) * (-1794.517) (-1789.604) (-1790.715) [-1795.661] -- 0:03:51
Average standard deviation of split frequencies: 0.006632
525500 -- (-1800.833) [-1788.352] (-1792.939) (-1799.181) * [-1789.608] (-1789.762) (-1791.877) (-1796.970) -- 0:03:51
526000 -- [-1786.809] (-1788.884) (-1788.082) (-1792.528) * [-1797.920] (-1796.683) (-1793.674) (-1800.566) -- 0:03:50
526500 -- [-1785.000] (-1794.633) (-1786.209) (-1794.468) * [-1793.818] (-1796.222) (-1796.887) (-1807.815) -- 0:03:50
527000 -- (-1787.562) (-1792.580) [-1795.162] (-1789.940) * [-1793.253] (-1798.501) (-1786.675) (-1797.096) -- 0:03:50
527500 -- (-1792.872) (-1790.481) [-1789.304] (-1795.874) * (-1792.246) [-1790.332] (-1796.934) (-1807.501) -- 0:03:50
528000 -- [-1797.350] (-1796.618) (-1797.822) (-1790.551) * [-1788.451] (-1791.663) (-1800.289) (-1798.360) -- 0:03:49
528500 -- (-1792.169) (-1796.401) (-1798.262) [-1793.561] * (-1787.595) [-1788.473] (-1797.855) (-1791.960) -- 0:03:49
529000 -- (-1804.147) (-1797.066) [-1794.078] (-1791.205) * (-1799.964) (-1806.396) (-1797.538) [-1795.267] -- 0:03:49
529500 -- (-1805.057) [-1781.086] (-1795.665) (-1789.813) * (-1794.074) (-1793.588) [-1789.638] (-1802.117) -- 0:03:49
530000 -- (-1801.979) [-1793.893] (-1803.301) (-1798.078) * (-1795.053) (-1787.771) (-1795.152) [-1789.237] -- 0:03:48
Average standard deviation of split frequencies: 0.006662
530500 -- [-1791.182] (-1787.053) (-1794.675) (-1797.826) * (-1789.732) [-1790.447] (-1795.251) (-1790.814) -- 0:03:49
531000 -- (-1797.546) (-1801.137) (-1800.748) [-1795.014] * (-1799.108) [-1790.578] (-1793.599) (-1802.778) -- 0:03:48
531500 -- [-1794.989] (-1790.667) (-1794.171) (-1795.330) * (-1797.026) [-1785.897] (-1787.749) (-1785.809) -- 0:03:48
532000 -- [-1789.903] (-1790.483) (-1800.212) (-1789.835) * (-1795.028) (-1793.958) (-1795.393) [-1789.775] -- 0:03:47
532500 -- [-1788.579] (-1793.950) (-1809.525) (-1795.465) * (-1801.376) (-1793.842) (-1789.015) [-1784.742] -- 0:03:48
533000 -- (-1791.825) (-1800.137) [-1785.960] (-1794.657) * (-1794.647) (-1789.016) (-1789.468) [-1796.369] -- 0:03:47
533500 -- (-1803.771) (-1804.143) (-1796.081) [-1790.704] * (-1800.514) (-1799.694) (-1792.024) [-1792.907] -- 0:03:47
534000 -- (-1791.415) (-1796.774) (-1787.160) [-1792.278] * (-1794.456) (-1799.962) (-1793.890) [-1796.639] -- 0:03:46
534500 -- (-1788.955) [-1793.300] (-1794.686) (-1788.631) * (-1790.283) (-1795.182) [-1783.603] (-1801.634) -- 0:03:47
535000 -- (-1802.915) [-1789.236] (-1796.775) (-1794.308) * (-1789.067) (-1796.321) [-1788.306] (-1796.910) -- 0:03:46
Average standard deviation of split frequencies: 0.006420
535500 -- (-1796.366) [-1790.134] (-1790.094) (-1799.065) * (-1786.873) (-1790.108) (-1792.678) [-1796.383] -- 0:03:46
536000 -- (-1789.164) (-1799.069) (-1786.417) [-1789.250] * (-1798.687) [-1785.274] (-1791.418) (-1804.507) -- 0:03:45
536500 -- [-1790.536] (-1794.855) (-1792.208) (-1792.704) * (-1788.796) (-1791.578) [-1784.888] (-1795.919) -- 0:03:45
537000 -- (-1796.110) (-1799.693) [-1792.615] (-1794.400) * (-1793.000) (-1785.157) (-1787.015) [-1793.857] -- 0:03:45
537500 -- (-1793.103) (-1791.581) [-1793.317] (-1801.740) * (-1796.203) (-1791.120) [-1791.699] (-1787.830) -- 0:03:45
538000 -- [-1787.550] (-1790.133) (-1790.735) (-1794.196) * (-1794.510) (-1800.629) [-1785.632] (-1784.344) -- 0:03:44
538500 -- [-1789.932] (-1794.686) (-1796.645) (-1788.174) * [-1790.403] (-1796.563) (-1788.128) (-1797.723) -- 0:03:44
539000 -- (-1797.423) (-1790.281) (-1791.212) [-1786.568] * [-1788.654] (-1787.715) (-1797.253) (-1792.464) -- 0:03:44
539500 -- (-1799.885) [-1788.033] (-1797.009) (-1790.825) * [-1789.037] (-1795.973) (-1791.789) (-1795.613) -- 0:03:44
540000 -- (-1801.076) (-1794.683) [-1789.841] (-1800.421) * (-1790.932) [-1794.283] (-1797.462) (-1802.413) -- 0:03:44
Average standard deviation of split frequencies: 0.006626
540500 -- (-1794.384) (-1795.990) (-1788.402) [-1788.479] * (-1793.498) (-1790.781) [-1795.741] (-1796.200) -- 0:03:43
541000 -- (-1794.444) [-1790.873] (-1794.755) (-1789.468) * (-1787.608) [-1789.099] (-1786.994) (-1793.805) -- 0:03:43
541500 -- [-1791.594] (-1797.993) (-1800.960) (-1797.870) * [-1787.640] (-1790.772) (-1793.632) (-1791.333) -- 0:03:43
542000 -- (-1794.280) [-1790.113] (-1799.469) (-1788.837) * (-1791.526) (-1793.054) [-1792.095] (-1799.916) -- 0:03:43
542500 -- (-1792.060) [-1786.386] (-1796.724) (-1788.605) * (-1786.355) (-1793.800) [-1789.843] (-1790.450) -- 0:03:42
543000 -- (-1788.574) (-1795.553) (-1796.012) [-1788.133] * (-1787.617) (-1797.773) [-1786.826] (-1801.985) -- 0:03:42
543500 -- (-1791.989) (-1793.727) (-1794.539) [-1788.000] * (-1797.773) (-1786.391) (-1803.129) [-1789.139] -- 0:03:42
544000 -- (-1794.394) (-1786.882) (-1790.585) [-1789.912] * (-1799.020) (-1801.702) (-1789.674) [-1796.359] -- 0:03:42
544500 -- (-1790.045) (-1791.115) (-1800.854) [-1789.351] * (-1785.300) (-1790.042) (-1788.569) [-1796.677] -- 0:03:41
545000 -- (-1801.426) (-1800.946) (-1792.849) [-1792.608] * [-1787.415] (-1798.935) (-1794.376) (-1796.766) -- 0:03:41
Average standard deviation of split frequencies: 0.006734
545500 -- (-1788.305) (-1787.705) (-1783.850) [-1787.365] * (-1800.411) (-1796.756) (-1794.144) [-1785.174] -- 0:03:41
546000 -- (-1802.539) [-1789.788] (-1788.458) (-1790.991) * [-1796.577] (-1790.969) (-1798.758) (-1794.664) -- 0:03:41
546500 -- (-1805.727) (-1786.825) (-1796.558) [-1794.137] * (-1785.145) (-1795.670) (-1798.279) [-1786.696] -- 0:03:40
547000 -- (-1800.605) (-1792.963) [-1794.235] (-1782.709) * (-1795.000) [-1794.348] (-1796.990) (-1807.551) -- 0:03:40
547500 -- (-1793.290) [-1788.825] (-1789.667) (-1792.897) * (-1798.447) [-1788.539] (-1789.390) (-1794.040) -- 0:03:40
548000 -- (-1799.238) [-1792.785] (-1796.444) (-1791.277) * (-1801.033) (-1796.707) (-1785.004) [-1791.088] -- 0:03:40
548500 -- (-1800.057) (-1800.197) (-1794.429) [-1785.193] * [-1788.891] (-1789.432) (-1793.268) (-1805.201) -- 0:03:39
549000 -- [-1793.757] (-1788.332) (-1799.423) (-1788.775) * (-1798.739) [-1786.429] (-1788.491) (-1798.212) -- 0:03:39
549500 -- (-1789.816) [-1793.705] (-1798.683) (-1791.623) * (-1785.715) [-1789.504] (-1791.118) (-1786.444) -- 0:03:38
550000 -- (-1796.167) [-1785.164] (-1803.110) (-1801.181) * [-1790.858] (-1799.607) (-1795.652) (-1794.133) -- 0:03:39
Average standard deviation of split frequencies: 0.006934
550500 -- (-1786.314) [-1797.140] (-1796.467) (-1790.981) * (-1801.330) (-1797.662) [-1794.052] (-1793.523) -- 0:03:38
551000 -- (-1800.096) (-1793.421) (-1794.742) [-1790.923] * (-1791.031) (-1801.383) (-1793.495) [-1788.549] -- 0:03:38
551500 -- [-1790.441] (-1788.469) (-1790.067) (-1792.340) * (-1806.790) [-1789.553] (-1796.664) (-1794.714) -- 0:03:37
552000 -- (-1796.118) (-1793.830) (-1789.771) [-1791.774] * [-1791.516] (-1794.254) (-1795.255) (-1794.650) -- 0:03:38
552500 -- [-1794.954] (-1791.689) (-1789.948) (-1796.838) * (-1795.558) (-1790.472) [-1788.756] (-1784.193) -- 0:03:37
553000 -- (-1787.636) (-1788.768) [-1789.072] (-1800.225) * [-1789.215] (-1797.379) (-1788.395) (-1800.126) -- 0:03:37
553500 -- (-1796.307) [-1791.294] (-1790.993) (-1802.446) * (-1797.329) (-1793.326) (-1796.529) [-1790.070] -- 0:03:36
554000 -- (-1791.972) [-1789.655] (-1797.819) (-1792.418) * (-1798.083) (-1800.362) [-1787.616] (-1784.844) -- 0:03:37
554500 -- (-1791.339) (-1797.469) [-1785.670] (-1790.869) * (-1798.497) (-1800.047) (-1791.982) [-1796.590] -- 0:03:36
555000 -- (-1796.090) (-1794.185) [-1790.663] (-1793.038) * (-1787.152) (-1794.146) (-1797.040) [-1786.965] -- 0:03:36
Average standard deviation of split frequencies: 0.007122
555500 -- [-1789.570] (-1801.880) (-1798.672) (-1794.565) * (-1794.658) (-1787.915) (-1794.136) [-1786.886] -- 0:03:36
556000 -- [-1789.356] (-1788.885) (-1801.958) (-1795.663) * (-1797.131) (-1798.168) (-1792.931) [-1796.608] -- 0:03:35
556500 -- (-1793.112) [-1793.526] (-1792.121) (-1796.102) * (-1794.580) (-1793.075) [-1785.678] (-1795.968) -- 0:03:35
557000 -- (-1788.065) (-1795.672) [-1788.697] (-1793.484) * (-1792.317) (-1791.918) [-1784.982] (-1788.707) -- 0:03:35
557500 -- (-1788.640) (-1795.761) (-1788.139) [-1790.571] * [-1790.870] (-1785.363) (-1798.059) (-1801.486) -- 0:03:35
558000 -- (-1793.566) (-1793.363) [-1794.517] (-1805.779) * (-1789.208) (-1798.149) [-1788.756] (-1796.909) -- 0:03:34
558500 -- (-1797.189) [-1790.182] (-1788.294) (-1789.222) * [-1788.978] (-1802.992) (-1793.425) (-1804.400) -- 0:03:35
559000 -- (-1790.042) [-1789.629] (-1790.913) (-1796.799) * [-1800.255] (-1800.419) (-1789.585) (-1788.331) -- 0:03:34
559500 -- (-1804.184) [-1787.671] (-1793.175) (-1792.457) * (-1800.487) (-1804.111) [-1785.907] (-1794.615) -- 0:03:34
560000 -- (-1800.790) (-1794.384) (-1792.714) [-1792.118] * (-1790.919) [-1790.721] (-1788.720) (-1795.044) -- 0:03:33
Average standard deviation of split frequencies: 0.006726
560500 -- (-1793.400) (-1789.853) (-1794.704) [-1792.560] * [-1795.343] (-1800.158) (-1795.721) (-1802.130) -- 0:03:33
561000 -- [-1784.657] (-1790.294) (-1797.034) (-1790.875) * (-1790.666) (-1790.434) [-1803.251] (-1801.939) -- 0:03:33
561500 -- (-1797.865) [-1788.159] (-1806.912) (-1795.605) * [-1787.734] (-1792.040) (-1798.748) (-1791.475) -- 0:03:33
562000 -- (-1792.643) [-1785.768] (-1797.742) (-1797.715) * [-1790.070] (-1793.283) (-1796.513) (-1795.499) -- 0:03:32
562500 -- (-1789.665) [-1787.133] (-1790.758) (-1792.149) * (-1789.373) (-1796.378) [-1788.160] (-1790.549) -- 0:03:33
563000 -- (-1795.570) [-1799.339] (-1793.428) (-1795.193) * [-1794.193] (-1790.969) (-1792.630) (-1799.135) -- 0:03:32
563500 -- (-1793.299) (-1790.144) [-1796.975] (-1791.546) * (-1788.196) (-1790.472) (-1798.785) [-1791.642] -- 0:03:32
564000 -- (-1800.586) [-1790.331] (-1792.121) (-1794.986) * (-1789.535) [-1796.616] (-1790.633) (-1794.113) -- 0:03:31
564500 -- (-1791.818) (-1795.565) [-1798.994] (-1808.010) * [-1786.249] (-1791.960) (-1789.153) (-1788.660) -- 0:03:32
565000 -- [-1794.060] (-1793.519) (-1791.056) (-1792.036) * (-1796.149) (-1789.405) [-1786.984] (-1790.854) -- 0:03:31
Average standard deviation of split frequencies: 0.006890
565500 -- [-1785.840] (-1785.761) (-1796.623) (-1800.639) * (-1797.586) [-1787.261] (-1790.465) (-1795.759) -- 0:03:31
566000 -- (-1791.477) [-1790.604] (-1791.020) (-1805.802) * (-1795.120) (-1794.663) [-1786.641] (-1790.866) -- 0:03:30
566500 -- (-1796.935) (-1791.980) [-1783.011] (-1799.935) * (-1798.713) (-1790.770) (-1790.801) [-1789.811] -- 0:03:30
567000 -- (-1795.890) (-1795.771) (-1800.048) [-1794.698] * (-1798.984) (-1786.661) [-1791.915] (-1793.326) -- 0:03:30
567500 -- [-1791.797] (-1793.096) (-1787.524) (-1792.924) * [-1793.776] (-1792.469) (-1793.426) (-1791.843) -- 0:03:30
568000 -- (-1791.531) (-1788.677) [-1790.684] (-1790.008) * (-1795.146) (-1796.581) [-1797.746] (-1790.193) -- 0:03:29
568500 -- [-1785.643] (-1792.761) (-1801.188) (-1786.570) * (-1791.175) (-1792.797) [-1802.370] (-1793.544) -- 0:03:29
569000 -- (-1784.711) (-1788.667) (-1794.014) [-1786.925] * (-1798.000) (-1799.049) [-1792.566] (-1805.210) -- 0:03:29
569500 -- (-1792.278) (-1796.879) (-1798.517) [-1789.640] * (-1792.363) [-1787.564] (-1789.908) (-1791.691) -- 0:03:29
570000 -- [-1786.463] (-1792.401) (-1793.953) (-1791.503) * (-1797.089) [-1792.701] (-1791.702) (-1791.215) -- 0:03:28
Average standard deviation of split frequencies: 0.007510
570500 -- [-1785.275] (-1792.812) (-1792.799) (-1792.321) * (-1803.741) (-1794.367) [-1790.202] (-1788.252) -- 0:03:28
571000 -- [-1792.090] (-1790.935) (-1791.200) (-1798.835) * (-1794.450) [-1787.289] (-1792.102) (-1798.824) -- 0:03:28
571500 -- [-1788.471] (-1790.466) (-1789.954) (-1794.873) * (-1793.041) (-1795.990) (-1795.747) [-1794.782] -- 0:03:28
572000 -- [-1796.842] (-1793.898) (-1791.808) (-1796.425) * [-1785.736] (-1786.934) (-1794.803) (-1791.026) -- 0:03:28
572500 -- (-1794.254) [-1789.901] (-1794.567) (-1803.002) * (-1796.002) (-1797.923) (-1788.332) [-1790.300] -- 0:03:27
573000 -- (-1792.932) (-1796.227) [-1787.472] (-1796.975) * (-1798.544) (-1785.156) [-1787.029] (-1801.315) -- 0:03:27
573500 -- [-1790.163] (-1797.306) (-1795.347) (-1799.668) * (-1795.494) (-1797.097) [-1789.040] (-1805.094) -- 0:03:27
574000 -- (-1793.242) (-1785.555) [-1785.636] (-1805.141) * (-1798.393) (-1803.604) [-1794.418] (-1783.947) -- 0:03:27
574500 -- (-1795.651) [-1794.417] (-1792.418) (-1792.954) * (-1795.874) [-1789.332] (-1795.231) (-1790.130) -- 0:03:26
575000 -- (-1789.241) [-1791.455] (-1791.456) (-1795.283) * [-1786.482] (-1788.249) (-1787.150) (-1790.897) -- 0:03:26
Average standard deviation of split frequencies: 0.007142
575500 -- (-1786.468) (-1796.814) [-1788.995] (-1796.114) * (-1792.034) (-1795.905) (-1793.915) [-1801.701] -- 0:03:26
576000 -- (-1799.071) (-1793.850) [-1789.641] (-1806.378) * (-1797.061) [-1788.141] (-1787.953) (-1801.632) -- 0:03:26
576500 -- (-1797.591) (-1794.710) [-1789.696] (-1800.536) * (-1795.096) [-1784.204] (-1792.991) (-1789.575) -- 0:03:25
577000 -- (-1786.469) (-1794.187) (-1785.708) [-1798.545] * (-1799.493) (-1785.377) [-1791.642] (-1787.681) -- 0:03:25
577500 -- (-1800.293) [-1787.352] (-1797.428) (-1793.836) * [-1786.973] (-1791.776) (-1788.340) (-1785.120) -- 0:03:24
578000 -- (-1796.674) [-1798.221] (-1787.625) (-1798.862) * (-1795.455) [-1789.063] (-1788.046) (-1794.669) -- 0:03:25
578500 -- (-1795.396) [-1790.250] (-1790.540) (-1790.872) * (-1788.614) (-1795.671) (-1792.378) [-1797.981] -- 0:03:24
579000 -- (-1799.079) (-1790.738) (-1790.788) [-1794.076] * (-1789.444) [-1786.860] (-1803.447) (-1792.828) -- 0:03:24
579500 -- (-1791.324) (-1785.817) [-1790.736] (-1801.566) * (-1788.919) (-1785.139) (-1805.703) [-1795.695] -- 0:03:23
580000 -- (-1792.727) [-1791.289] (-1791.854) (-1792.395) * (-1796.755) (-1796.488) (-1797.872) [-1787.340] -- 0:03:24
Average standard deviation of split frequencies: 0.006642
580500 -- [-1789.504] (-1799.603) (-1792.229) (-1788.491) * (-1803.118) [-1792.195] (-1787.770) (-1796.744) -- 0:03:23
581000 -- (-1792.785) [-1789.376] (-1795.435) (-1789.345) * [-1790.910] (-1799.229) (-1797.352) (-1790.201) -- 0:03:23
581500 -- (-1792.139) [-1785.676] (-1791.739) (-1795.067) * [-1789.799] (-1799.244) (-1800.962) (-1790.369) -- 0:03:22
582000 -- (-1790.574) (-1791.727) (-1808.259) [-1786.904] * (-1799.360) [-1793.480] (-1798.940) (-1789.944) -- 0:03:23
582500 -- [-1796.485] (-1790.713) (-1792.394) (-1795.671) * [-1796.753] (-1803.138) (-1799.351) (-1800.739) -- 0:03:22
583000 -- (-1796.610) (-1795.247) [-1792.642] (-1790.113) * (-1793.827) (-1789.603) [-1798.163] (-1795.045) -- 0:03:22
583500 -- (-1791.733) [-1793.585] (-1799.891) (-1798.276) * (-1789.110) (-1794.021) [-1793.586] (-1792.835) -- 0:03:22
584000 -- [-1786.349] (-1793.413) (-1795.585) (-1793.064) * (-1791.823) [-1798.718] (-1792.422) (-1789.963) -- 0:03:21
584500 -- [-1786.311] (-1791.937) (-1791.545) (-1800.404) * (-1790.207) (-1789.003) (-1804.507) [-1786.026] -- 0:03:21
585000 -- (-1798.026) [-1798.803] (-1796.456) (-1793.153) * (-1802.876) [-1790.689] (-1788.175) (-1786.301) -- 0:03:21
Average standard deviation of split frequencies: 0.006070
585500 -- [-1786.599] (-1787.755) (-1788.546) (-1792.177) * (-1789.975) (-1798.826) (-1800.164) [-1789.698] -- 0:03:21
586000 -- (-1785.688) [-1788.035] (-1789.284) (-1790.051) * (-1794.299) (-1799.169) (-1790.970) [-1785.183] -- 0:03:20
586500 -- (-1792.431) (-1798.912) [-1790.474] (-1788.730) * [-1785.660] (-1791.087) (-1792.684) (-1791.962) -- 0:03:20
587000 -- (-1800.145) (-1802.710) (-1794.680) [-1791.481] * (-1803.422) [-1790.436] (-1795.855) (-1793.025) -- 0:03:20
587500 -- (-1799.774) (-1790.913) (-1797.499) [-1789.720] * (-1807.161) (-1798.727) [-1789.512] (-1790.714) -- 0:03:20
588000 -- (-1792.384) (-1790.140) [-1790.111] (-1801.722) * (-1792.947) (-1784.257) [-1790.870] (-1798.103) -- 0:03:19
588500 -- (-1807.729) (-1789.558) (-1795.979) [-1791.359] * [-1792.334] (-1792.587) (-1792.027) (-1788.666) -- 0:03:19
589000 -- [-1788.148] (-1796.893) (-1797.129) (-1794.219) * (-1795.017) [-1783.179] (-1796.670) (-1799.856) -- 0:03:19
589500 -- [-1785.789] (-1788.207) (-1796.761) (-1791.086) * (-1788.792) [-1797.509] (-1795.481) (-1805.179) -- 0:03:19
590000 -- (-1789.903) (-1787.387) [-1783.282] (-1795.381) * [-1791.621] (-1799.414) (-1798.784) (-1793.201) -- 0:03:18
Average standard deviation of split frequencies: 0.005514
590500 -- (-1791.014) [-1789.124] (-1789.176) (-1798.862) * [-1795.601] (-1798.973) (-1802.978) (-1790.894) -- 0:03:18
591000 -- [-1787.099] (-1792.195) (-1793.855) (-1799.974) * (-1787.652) (-1789.505) (-1791.897) [-1794.009] -- 0:03:18
591500 -- (-1794.697) (-1801.712) [-1787.002] (-1800.618) * [-1792.733] (-1798.196) (-1792.429) (-1787.788) -- 0:03:18
592000 -- (-1793.755) [-1791.156] (-1792.738) (-1798.670) * [-1787.829] (-1793.624) (-1796.363) (-1793.844) -- 0:03:17
592500 -- (-1795.078) (-1792.758) [-1788.388] (-1798.049) * (-1800.553) [-1793.383] (-1798.564) (-1793.761) -- 0:03:17
593000 -- [-1788.336] (-1791.821) (-1786.860) (-1803.515) * (-1800.479) (-1792.880) (-1796.713) [-1793.589] -- 0:03:17
593500 -- (-1803.275) [-1790.664] (-1790.992) (-1790.168) * (-1794.630) (-1798.766) [-1794.619] (-1790.393) -- 0:03:17
594000 -- [-1795.714] (-1792.637) (-1791.738) (-1795.305) * (-1796.046) (-1786.482) (-1801.326) [-1790.917] -- 0:03:16
594500 -- [-1791.780] (-1789.969) (-1791.920) (-1795.907) * (-1798.792) [-1787.708] (-1794.258) (-1791.086) -- 0:03:16
595000 -- (-1792.758) [-1792.015] (-1790.879) (-1801.588) * (-1791.981) (-1800.823) (-1803.170) [-1797.300] -- 0:03:16
Average standard deviation of split frequencies: 0.005752
595500 -- (-1794.475) (-1794.707) (-1790.941) [-1799.275] * (-1787.379) [-1792.232] (-1796.433) (-1797.393) -- 0:03:16
596000 -- (-1794.074) (-1788.128) [-1785.008] (-1795.661) * [-1789.970] (-1788.556) (-1794.624) (-1797.776) -- 0:03:15
596500 -- [-1796.595] (-1789.496) (-1793.606) (-1797.183) * (-1790.134) [-1793.751] (-1789.630) (-1798.762) -- 0:03:15
597000 -- (-1788.425) (-1794.329) [-1794.306] (-1811.563) * (-1786.100) (-1799.069) (-1797.262) [-1791.874] -- 0:03:15
597500 -- (-1801.396) [-1787.806] (-1791.406) (-1803.910) * [-1792.397] (-1794.141) (-1803.784) (-1787.890) -- 0:03:15
598000 -- [-1792.535] (-1794.352) (-1788.083) (-1787.952) * (-1789.279) [-1786.547] (-1797.877) (-1794.090) -- 0:03:14
598500 -- [-1802.063] (-1791.039) (-1789.442) (-1791.151) * (-1787.560) (-1797.004) [-1787.499] (-1787.976) -- 0:03:14
599000 -- (-1796.170) [-1788.990] (-1789.651) (-1792.505) * (-1796.874) (-1800.100) [-1790.646] (-1789.970) -- 0:03:14
599500 -- [-1790.755] (-1794.214) (-1798.006) (-1791.954) * [-1782.571] (-1809.115) (-1792.347) (-1789.530) -- 0:03:14
600000 -- (-1798.025) (-1801.353) [-1788.217] (-1795.043) * (-1794.459) [-1786.738] (-1795.904) (-1787.925) -- 0:03:14
Average standard deviation of split frequencies: 0.004495
600500 -- (-1790.526) [-1791.129] (-1791.381) (-1791.955) * [-1791.870] (-1797.294) (-1796.459) (-1799.099) -- 0:03:13
601000 -- (-1795.363) (-1785.701) [-1791.044] (-1807.673) * (-1795.136) (-1786.694) [-1789.789] (-1789.159) -- 0:03:13
601500 -- [-1790.483] (-1788.016) (-1785.572) (-1792.435) * (-1803.171) (-1791.771) (-1794.334) [-1800.295] -- 0:03:13
602000 -- [-1787.826] (-1790.540) (-1790.965) (-1811.474) * (-1799.187) (-1787.707) (-1800.468) [-1790.702] -- 0:03:13
602500 -- (-1791.583) (-1787.527) (-1793.876) [-1785.813] * (-1791.457) [-1787.784] (-1788.744) (-1794.952) -- 0:03:12
603000 -- (-1791.030) [-1786.409] (-1795.029) (-1790.972) * [-1795.487] (-1794.842) (-1791.824) (-1790.515) -- 0:03:12
603500 -- (-1795.863) (-1788.029) (-1790.439) [-1783.024] * (-1800.105) (-1801.101) (-1792.509) [-1784.726] -- 0:03:11
604000 -- [-1789.852] (-1801.153) (-1794.364) (-1802.254) * (-1797.459) [-1796.350] (-1791.100) (-1792.677) -- 0:03:12
604500 -- (-1795.571) [-1793.936] (-1794.592) (-1787.347) * [-1795.206] (-1789.647) (-1798.612) (-1793.474) -- 0:03:11
605000 -- (-1801.106) (-1786.450) [-1786.132] (-1788.248) * (-1796.279) [-1791.873] (-1786.119) (-1795.514) -- 0:03:11
Average standard deviation of split frequencies: 0.004385
605500 -- [-1787.394] (-1788.513) (-1782.621) (-1794.772) * [-1784.248] (-1792.451) (-1784.566) (-1794.652) -- 0:03:10
606000 -- (-1798.993) [-1790.375] (-1788.490) (-1797.815) * (-1798.138) [-1787.579] (-1791.696) (-1795.971) -- 0:03:11
606500 -- [-1792.238] (-1798.279) (-1789.532) (-1786.304) * (-1790.534) [-1787.280] (-1792.756) (-1802.309) -- 0:03:10
607000 -- (-1793.936) [-1796.985] (-1801.300) (-1801.335) * (-1789.013) [-1790.547] (-1798.095) (-1796.421) -- 0:03:10
607500 -- (-1797.260) [-1793.833] (-1792.477) (-1786.514) * (-1790.998) [-1791.465] (-1788.316) (-1798.534) -- 0:03:09
608000 -- (-1793.595) [-1789.324] (-1795.739) (-1787.490) * (-1795.205) [-1791.005] (-1790.920) (-1793.875) -- 0:03:10
608500 -- (-1799.458) (-1798.657) [-1792.530] (-1802.915) * [-1793.868] (-1790.334) (-1795.241) (-1794.015) -- 0:03:09
609000 -- [-1786.905] (-1790.347) (-1797.403) (-1795.718) * (-1803.502) (-1801.553) (-1791.727) [-1785.588] -- 0:03:09
609500 -- (-1796.534) (-1792.195) [-1788.585] (-1795.685) * [-1788.989] (-1797.413) (-1788.689) (-1793.040) -- 0:03:09
610000 -- [-1785.027] (-1798.934) (-1803.725) (-1792.113) * (-1793.508) (-1799.002) (-1789.005) [-1791.342] -- 0:03:08
Average standard deviation of split frequencies: 0.004421
610500 -- (-1789.554) (-1793.711) [-1793.693] (-1798.230) * [-1791.084] (-1808.154) (-1800.299) (-1788.058) -- 0:03:08
611000 -- [-1794.391] (-1794.452) (-1804.706) (-1797.584) * [-1795.960] (-1798.649) (-1790.352) (-1794.122) -- 0:03:08
611500 -- [-1790.663] (-1802.747) (-1793.506) (-1806.144) * (-1793.137) (-1796.178) [-1794.786] (-1797.104) -- 0:03:08
612000 -- (-1791.800) (-1786.169) (-1796.166) [-1802.300] * (-1794.932) [-1791.817] (-1790.964) (-1788.212) -- 0:03:07
612500 -- (-1787.124) [-1786.135] (-1799.698) (-1787.152) * (-1792.924) [-1800.243] (-1789.885) (-1795.823) -- 0:03:07
613000 -- (-1787.643) (-1788.057) (-1799.053) [-1785.651] * [-1793.551] (-1790.201) (-1792.752) (-1795.214) -- 0:03:07
613500 -- (-1799.526) (-1789.803) (-1795.976) [-1793.405] * (-1791.657) (-1799.758) (-1787.959) [-1798.909] -- 0:03:07
614000 -- (-1802.766) (-1797.431) [-1792.781] (-1790.026) * (-1795.602) (-1801.702) (-1787.974) [-1792.247] -- 0:03:06
614500 -- [-1799.225] (-1796.544) (-1792.347) (-1790.407) * [-1791.249] (-1800.405) (-1798.071) (-1793.036) -- 0:03:06
615000 -- (-1801.347) (-1797.537) (-1793.501) [-1794.883] * (-1797.832) (-1788.055) (-1795.136) [-1787.461] -- 0:03:06
Average standard deviation of split frequencies: 0.003965
615500 -- (-1794.680) (-1793.386) [-1793.759] (-1797.901) * (-1791.461) [-1792.018] (-1797.358) (-1790.239) -- 0:03:06
616000 -- (-1790.163) (-1792.416) (-1794.449) [-1789.946] * [-1792.903] (-1792.114) (-1790.108) (-1804.548) -- 0:03:05
616500 -- [-1785.933] (-1794.216) (-1795.017) (-1792.139) * (-1798.149) (-1783.913) [-1793.554] (-1787.828) -- 0:03:05
617000 -- (-1784.604) (-1801.709) [-1798.890] (-1795.655) * (-1799.912) (-1792.284) [-1791.898] (-1796.703) -- 0:03:05
617500 -- [-1792.363] (-1792.211) (-1794.712) (-1789.172) * (-1793.300) (-1797.952) [-1785.910] (-1802.145) -- 0:03:05
618000 -- (-1795.994) (-1795.193) (-1791.535) [-1787.420] * (-1794.090) (-1795.556) [-1790.476] (-1798.451) -- 0:03:04
618500 -- (-1805.466) (-1791.391) (-1794.423) [-1790.709] * (-1790.533) [-1794.142] (-1799.368) (-1798.476) -- 0:03:04
619000 -- (-1795.140) (-1796.168) (-1792.458) [-1789.501] * [-1793.255] (-1789.338) (-1795.299) (-1794.276) -- 0:03:04
619500 -- (-1800.021) (-1795.832) [-1793.931] (-1798.478) * (-1797.600) (-1789.932) (-1792.324) [-1790.049] -- 0:03:04
620000 -- (-1796.765) (-1797.023) [-1792.436] (-1799.045) * (-1797.401) (-1800.656) (-1797.779) [-1794.115] -- 0:03:03
Average standard deviation of split frequencies: 0.003798
620500 -- (-1797.814) (-1794.804) [-1787.589] (-1799.277) * [-1789.963] (-1796.137) (-1797.954) (-1795.951) -- 0:03:03
621000 -- (-1788.811) (-1790.875) (-1796.950) [-1789.985] * (-1794.635) (-1788.298) [-1787.777] (-1794.037) -- 0:03:03
621500 -- (-1799.719) [-1793.004] (-1791.207) (-1796.097) * (-1795.938) (-1796.187) [-1785.612] (-1798.847) -- 0:03:03
622000 -- (-1794.372) (-1797.746) (-1793.412) [-1786.960] * (-1798.842) (-1792.261) [-1787.594] (-1789.922) -- 0:03:02
622500 -- (-1804.375) [-1789.888] (-1788.114) (-1795.290) * (-1792.599) (-1789.732) (-1793.905) [-1790.062] -- 0:03:02
623000 -- (-1798.014) (-1800.231) (-1795.344) [-1792.536] * (-1797.117) (-1794.210) [-1788.123] (-1788.732) -- 0:03:02
623500 -- [-1793.849] (-1799.274) (-1798.246) (-1791.241) * (-1793.720) (-1794.673) (-1796.307) [-1790.358] -- 0:03:02
624000 -- (-1798.174) (-1791.556) (-1799.207) [-1789.530] * (-1792.434) (-1786.257) (-1792.955) [-1789.985] -- 0:03:01
624500 -- (-1790.032) (-1796.485) [-1784.565] (-1786.894) * (-1809.446) (-1795.596) [-1788.880] (-1794.274) -- 0:03:01
625000 -- (-1792.726) (-1793.570) [-1787.300] (-1807.084) * (-1791.718) (-1787.522) [-1790.556] (-1797.871) -- 0:03:01
Average standard deviation of split frequencies: 0.003902
625500 -- [-1790.282] (-1791.639) (-1802.294) (-1803.903) * (-1790.485) [-1798.472] (-1787.533) (-1794.031) -- 0:03:01
626000 -- [-1788.330] (-1794.718) (-1790.955) (-1791.637) * (-1796.269) (-1790.704) (-1789.821) [-1792.346] -- 0:03:01
626500 -- [-1793.268] (-1794.082) (-1797.717) (-1792.998) * (-1792.581) (-1792.641) [-1790.064] (-1790.260) -- 0:03:01
627000 -- [-1794.467] (-1792.617) (-1792.638) (-1797.302) * (-1791.566) (-1789.686) [-1791.423] (-1791.525) -- 0:03:00
627500 -- (-1793.791) (-1793.736) [-1788.749] (-1789.208) * (-1784.744) (-1787.897) [-1795.789] (-1794.303) -- 0:03:00
628000 -- [-1792.293] (-1791.354) (-1788.513) (-1788.120) * [-1791.919] (-1798.303) (-1795.382) (-1794.806) -- 0:03:00
628500 -- (-1802.158) [-1785.257] (-1790.490) (-1788.042) * (-1794.941) (-1792.809) (-1797.724) [-1783.824] -- 0:03:00
629000 -- (-1799.802) (-1802.036) [-1785.348] (-1791.846) * (-1805.491) [-1792.043] (-1791.323) (-1789.497) -- 0:02:59
629500 -- (-1799.365) (-1792.268) [-1791.376] (-1793.568) * (-1812.158) [-1791.496] (-1795.184) (-1795.333) -- 0:02:59
630000 -- (-1807.656) (-1796.612) [-1789.582] (-1800.035) * (-1787.768) [-1798.633] (-1807.975) (-1790.792) -- 0:02:59
Average standard deviation of split frequencies: 0.003941
630500 -- (-1803.774) [-1792.556] (-1790.583) (-1791.237) * (-1786.170) [-1790.785] (-1801.483) (-1796.185) -- 0:02:58
631000 -- (-1795.550) (-1785.540) [-1797.010] (-1793.816) * (-1805.758) [-1785.788] (-1802.297) (-1792.124) -- 0:02:58
631500 -- (-1803.625) (-1803.818) [-1784.724] (-1788.779) * (-1793.831) (-1786.048) (-1801.912) [-1793.158] -- 0:02:58
632000 -- (-1797.767) (-1808.251) (-1795.778) [-1792.224] * (-1794.730) (-1801.568) [-1804.626] (-1792.549) -- 0:02:58
632500 -- (-1792.431) (-1798.305) [-1789.972] (-1794.523) * (-1801.809) [-1796.482] (-1794.841) (-1796.529) -- 0:02:58
633000 -- [-1793.277] (-1807.565) (-1794.082) (-1799.003) * (-1792.584) [-1794.909] (-1797.111) (-1786.515) -- 0:02:57
633500 -- (-1796.365) (-1788.720) (-1796.621) [-1788.028] * (-1810.089) (-1797.346) [-1788.249] (-1789.709) -- 0:02:57
634000 -- (-1800.801) [-1792.057] (-1793.518) (-1789.131) * (-1799.324) (-1792.133) (-1790.884) [-1796.444] -- 0:02:57
634500 -- (-1809.328) [-1797.268] (-1804.824) (-1788.709) * (-1801.277) (-1793.341) [-1793.516] (-1799.145) -- 0:02:57
635000 -- (-1794.225) (-1793.650) (-1790.362) [-1794.792] * (-1792.971) (-1797.639) [-1785.279] (-1787.403) -- 0:02:57
Average standard deviation of split frequencies: 0.003571
635500 -- (-1794.206) (-1793.119) [-1792.692] (-1788.618) * [-1789.336] (-1801.500) (-1793.082) (-1795.446) -- 0:02:56
636000 -- (-1786.774) (-1797.156) [-1791.306] (-1787.365) * (-1789.746) (-1798.702) (-1795.700) [-1800.069] -- 0:02:56
636500 -- [-1789.597] (-1793.979) (-1790.798) (-1795.480) * [-1800.509] (-1797.513) (-1797.696) (-1799.262) -- 0:02:56
637000 -- (-1789.824) (-1791.624) (-1789.098) [-1791.711] * (-1798.792) [-1792.341] (-1803.143) (-1802.157) -- 0:02:56
637500 -- (-1793.579) (-1792.361) (-1800.279) [-1789.286] * [-1799.743] (-1790.542) (-1791.499) (-1808.274) -- 0:02:55
638000 -- (-1797.403) (-1793.049) (-1799.424) [-1785.945] * (-1788.880) (-1796.512) [-1789.591] (-1805.452) -- 0:02:55
638500 -- (-1797.891) (-1791.406) [-1797.098] (-1795.051) * (-1792.424) [-1795.483] (-1791.827) (-1790.756) -- 0:02:55
639000 -- (-1800.813) (-1785.798) (-1793.494) [-1788.084] * (-1792.719) [-1788.380] (-1792.716) (-1789.967) -- 0:02:55
639500 -- [-1791.873] (-1788.749) (-1789.270) (-1791.272) * (-1795.074) (-1800.664) (-1803.025) [-1789.025] -- 0:02:54
640000 -- [-1791.109] (-1792.915) (-1784.377) (-1787.707) * (-1796.564) (-1789.385) (-1788.729) [-1792.546] -- 0:02:54
Average standard deviation of split frequencies: 0.003679
640500 -- [-1791.548] (-1792.498) (-1785.072) (-1796.369) * [-1795.346] (-1792.630) (-1788.621) (-1789.299) -- 0:02:53
641000 -- (-1790.070) [-1792.737] (-1794.580) (-1791.196) * [-1791.991] (-1797.413) (-1794.597) (-1793.692) -- 0:02:54
641500 -- (-1788.641) (-1792.259) (-1790.976) [-1791.160] * (-1801.414) (-1797.893) [-1790.287] (-1794.206) -- 0:02:53
642000 -- [-1790.544] (-1795.874) (-1792.777) (-1792.890) * (-1790.398) (-1792.629) [-1793.087] (-1791.044) -- 0:02:53
642500 -- [-1792.540] (-1793.929) (-1792.261) (-1798.483) * (-1789.823) (-1798.491) (-1790.022) [-1789.582] -- 0:02:53
643000 -- (-1798.191) (-1796.006) [-1793.221] (-1788.590) * (-1797.838) [-1796.186] (-1786.163) (-1793.386) -- 0:02:53
643500 -- (-1790.441) (-1794.736) [-1794.431] (-1791.297) * (-1804.097) [-1789.707] (-1788.627) (-1796.994) -- 0:02:52
644000 -- [-1784.925] (-1802.706) (-1790.068) (-1790.555) * [-1792.442] (-1790.553) (-1786.817) (-1796.256) -- 0:02:52
644500 -- (-1792.920) (-1797.991) (-1792.878) [-1790.552] * (-1795.898) (-1795.835) (-1795.046) [-1797.385] -- 0:02:52
645000 -- (-1781.560) (-1797.492) [-1790.646] (-1798.972) * (-1797.655) (-1790.150) (-1795.054) [-1785.570] -- 0:02:52
Average standard deviation of split frequencies: 0.003715
645500 -- (-1791.038) (-1795.075) (-1794.617) [-1788.782] * (-1796.243) (-1794.421) (-1793.097) [-1793.371] -- 0:02:51
646000 -- (-1800.075) [-1794.325] (-1796.136) (-1793.269) * (-1794.550) (-1800.245) (-1796.514) [-1790.810] -- 0:02:51
646500 -- (-1794.537) (-1805.316) (-1802.005) [-1792.633] * (-1791.884) (-1804.695) (-1790.031) [-1789.724] -- 0:02:51
647000 -- (-1789.698) [-1792.403] (-1805.846) (-1792.709) * (-1792.442) (-1789.602) [-1796.034] (-1787.830) -- 0:02:50
647500 -- (-1798.664) (-1789.737) [-1799.183] (-1790.693) * (-1790.471) (-1802.408) (-1799.807) [-1786.457] -- 0:02:50
648000 -- (-1795.397) (-1790.039) (-1784.972) [-1787.042] * (-1801.001) (-1796.839) (-1797.820) [-1793.040] -- 0:02:50
648500 -- [-1789.890] (-1792.447) (-1791.543) (-1795.806) * (-1794.859) (-1799.871) [-1792.939] (-1793.185) -- 0:02:50
649000 -- (-1789.957) (-1803.259) (-1791.815) [-1794.004] * [-1788.135] (-1795.678) (-1786.315) (-1798.709) -- 0:02:49
649500 -- [-1784.467] (-1789.369) (-1791.923) (-1793.267) * (-1791.287) (-1790.370) [-1789.215] (-1794.016) -- 0:02:49
650000 -- (-1794.619) (-1794.277) [-1784.885] (-1792.020) * (-1798.849) [-1786.085] (-1791.664) (-1794.488) -- 0:02:49
Average standard deviation of split frequencies: 0.004215
650500 -- (-1792.188) (-1793.641) [-1785.503] (-1804.866) * (-1796.599) (-1803.168) [-1782.968] (-1794.656) -- 0:02:49
651000 -- (-1788.316) [-1794.532] (-1795.954) (-1799.984) * (-1798.961) [-1801.090] (-1785.295) (-1802.242) -- 0:02:48
651500 -- (-1794.016) (-1799.570) (-1793.069) [-1792.752] * (-1802.540) (-1790.473) [-1787.753] (-1795.964) -- 0:02:49
652000 -- (-1801.620) (-1787.087) [-1790.606] (-1811.976) * (-1796.123) (-1787.539) [-1792.641] (-1791.092) -- 0:02:48
652500 -- (-1794.775) [-1787.022] (-1792.535) (-1812.763) * [-1789.414] (-1797.282) (-1797.673) (-1794.823) -- 0:02:48
653000 -- [-1798.506] (-1793.850) (-1791.450) (-1811.790) * [-1786.417] (-1790.254) (-1797.250) (-1798.222) -- 0:02:47
653500 -- [-1790.355] (-1789.263) (-1792.979) (-1805.528) * [-1790.758] (-1790.408) (-1794.541) (-1792.654) -- 0:02:47
654000 -- (-1789.073) [-1805.540] (-1795.960) (-1808.686) * (-1794.144) [-1791.869] (-1794.327) (-1795.658) -- 0:02:47
654500 -- [-1786.397] (-1796.348) (-1788.573) (-1798.198) * (-1787.821) (-1789.828) [-1796.945] (-1789.746) -- 0:02:47
655000 -- [-1794.247] (-1804.419) (-1789.099) (-1794.618) * (-1798.990) [-1790.716] (-1795.617) (-1796.553) -- 0:02:46
Average standard deviation of split frequencies: 0.003724
655500 -- (-1788.873) [-1792.935] (-1797.437) (-1795.256) * (-1786.817) [-1790.668] (-1805.397) (-1800.486) -- 0:02:46
656000 -- [-1795.746] (-1793.700) (-1797.445) (-1802.319) * (-1792.841) [-1789.091] (-1796.563) (-1790.186) -- 0:02:46
656500 -- [-1794.297] (-1787.793) (-1786.766) (-1797.363) * [-1791.644] (-1793.304) (-1796.141) (-1793.816) -- 0:02:46
657000 -- [-1790.414] (-1791.311) (-1795.316) (-1805.080) * [-1788.749] (-1796.330) (-1791.117) (-1794.507) -- 0:02:46
657500 -- (-1790.515) (-1794.615) (-1799.621) [-1788.590] * (-1790.055) [-1785.220] (-1791.114) (-1785.954) -- 0:02:45
658000 -- [-1788.930] (-1803.044) (-1797.971) (-1793.575) * (-1787.885) (-1794.116) [-1791.482] (-1785.646) -- 0:02:45
658500 -- (-1798.129) (-1810.885) (-1801.288) [-1789.022] * [-1789.240] (-1785.480) (-1785.257) (-1787.271) -- 0:02:45
659000 -- (-1788.453) (-1797.422) [-1790.946] (-1791.381) * (-1790.645) (-1785.150) (-1794.675) [-1788.376] -- 0:02:45
659500 -- (-1798.709) (-1792.208) (-1796.564) [-1793.045] * (-1789.224) (-1788.416) (-1792.716) [-1787.767] -- 0:02:44
660000 -- (-1803.197) (-1794.612) [-1798.747] (-1800.911) * (-1801.200) (-1796.797) (-1794.896) [-1799.337] -- 0:02:44
Average standard deviation of split frequencies: 0.004567
660500 -- (-1799.867) [-1790.113] (-1795.037) (-1797.697) * (-1793.403) (-1799.073) (-1795.134) [-1790.865] -- 0:02:44
661000 -- [-1790.516] (-1792.841) (-1804.654) (-1792.728) * (-1786.761) (-1787.360) [-1792.163] (-1786.398) -- 0:02:44
661500 -- (-1785.810) (-1790.481) [-1793.220] (-1785.857) * (-1796.856) [-1791.475] (-1791.708) (-1799.614) -- 0:02:43
662000 -- (-1795.903) (-1794.297) (-1804.610) [-1790.127] * (-1789.571) (-1790.173) (-1789.686) [-1793.390] -- 0:02:43
662500 -- [-1781.768] (-1798.787) (-1801.348) (-1795.932) * [-1786.598] (-1796.091) (-1786.936) (-1799.309) -- 0:02:43
663000 -- [-1786.620] (-1791.233) (-1789.914) (-1805.439) * (-1783.888) [-1787.207] (-1791.757) (-1796.827) -- 0:02:43
663500 -- [-1788.440] (-1793.563) (-1801.129) (-1797.976) * (-1791.910) [-1785.247] (-1802.285) (-1793.086) -- 0:02:42
664000 -- (-1799.359) [-1790.122] (-1789.162) (-1797.866) * [-1798.684] (-1783.301) (-1790.362) (-1793.230) -- 0:02:42
664500 -- [-1794.762] (-1797.132) (-1789.069) (-1783.769) * (-1787.813) (-1791.915) [-1784.435] (-1791.115) -- 0:02:42
665000 -- (-1785.925) (-1804.307) [-1794.531] (-1801.770) * (-1791.121) [-1782.990] (-1791.652) (-1789.900) -- 0:02:42
Average standard deviation of split frequencies: 0.004440
665500 -- (-1793.184) [-1793.349] (-1802.175) (-1799.537) * (-1794.885) [-1783.973] (-1794.863) (-1790.209) -- 0:02:41
666000 -- (-1797.756) [-1786.579] (-1794.739) (-1794.772) * (-1795.555) (-1785.405) (-1793.073) [-1790.280] -- 0:02:41
666500 -- [-1788.250] (-1792.114) (-1794.039) (-1794.026) * (-1788.176) (-1794.106) (-1793.111) [-1784.076] -- 0:02:41
667000 -- [-1792.915] (-1786.019) (-1793.869) (-1794.510) * (-1796.387) (-1794.277) (-1799.563) [-1788.870] -- 0:02:41
667500 -- [-1793.134] (-1801.817) (-1786.806) (-1799.227) * (-1797.190) [-1787.521] (-1793.552) (-1790.018) -- 0:02:40
668000 -- [-1783.457] (-1793.848) (-1791.388) (-1791.783) * (-1794.836) (-1793.814) (-1802.850) [-1799.115] -- 0:02:40
668500 -- [-1789.565] (-1785.650) (-1799.507) (-1796.455) * (-1793.622) (-1791.923) [-1802.083] (-1792.358) -- 0:02:40
669000 -- (-1792.364) (-1798.702) [-1791.584] (-1791.804) * [-1794.435] (-1805.963) (-1802.312) (-1789.029) -- 0:02:40
669500 -- (-1796.012) (-1791.011) [-1791.860] (-1798.026) * (-1790.425) (-1792.641) [-1798.164] (-1787.301) -- 0:02:39
670000 -- (-1795.366) [-1790.462] (-1791.623) (-1795.756) * (-1790.590) [-1786.981] (-1794.938) (-1796.518) -- 0:02:39
Average standard deviation of split frequencies: 0.004537
670500 -- (-1790.154) (-1788.833) [-1789.201] (-1799.360) * (-1788.642) (-1796.904) [-1788.561] (-1792.689) -- 0:02:39
671000 -- (-1792.585) (-1792.692) (-1793.661) [-1789.375] * [-1783.854] (-1803.119) (-1793.530) (-1789.765) -- 0:02:39
671500 -- [-1787.964] (-1798.761) (-1794.080) (-1786.284) * (-1797.051) (-1795.286) (-1800.385) [-1787.322] -- 0:02:38
672000 -- [-1793.742] (-1790.136) (-1792.405) (-1804.527) * (-1791.231) (-1796.689) (-1788.163) [-1790.589] -- 0:02:38
672500 -- [-1793.973] (-1804.114) (-1789.971) (-1801.723) * (-1792.293) (-1794.416) (-1798.443) [-1788.686] -- 0:02:38
673000 -- (-1804.426) (-1800.670) (-1792.433) [-1785.570] * [-1784.828] (-1795.708) (-1793.906) (-1792.059) -- 0:02:38
673500 -- (-1792.998) (-1792.046) (-1795.789) [-1784.629] * (-1793.633) [-1795.195] (-1790.928) (-1798.846) -- 0:02:38
674000 -- (-1797.095) (-1793.045) [-1795.002] (-1792.444) * (-1800.875) (-1793.838) (-1783.122) [-1796.978] -- 0:02:37
674500 -- [-1788.577] (-1797.043) (-1790.269) (-1786.453) * (-1796.459) [-1786.789] (-1808.541) (-1790.868) -- 0:02:37
675000 -- [-1785.377] (-1790.705) (-1792.651) (-1798.539) * (-1790.925) (-1785.866) [-1789.194] (-1793.333) -- 0:02:37
Average standard deviation of split frequencies: 0.004945
675500 -- (-1787.407) (-1791.939) (-1791.301) [-1793.085] * (-1790.113) (-1789.264) (-1792.015) [-1790.648] -- 0:02:37
676000 -- (-1791.297) (-1789.551) [-1788.246] (-1795.356) * (-1787.605) [-1791.387] (-1790.530) (-1786.574) -- 0:02:36
676500 -- (-1804.497) (-1785.353) (-1790.249) [-1790.015] * [-1791.604] (-1790.226) (-1799.786) (-1793.543) -- 0:02:36
677000 -- (-1793.558) (-1795.140) [-1790.339] (-1784.291) * (-1799.539) [-1786.251] (-1789.237) (-1796.668) -- 0:02:36
677500 -- (-1795.470) (-1796.734) (-1797.822) [-1791.414] * (-1793.885) (-1797.060) (-1787.102) [-1798.340] -- 0:02:36
678000 -- [-1786.311] (-1792.942) (-1804.615) (-1793.885) * (-1795.329) (-1795.959) (-1785.782) [-1788.253] -- 0:02:35
678500 -- (-1789.828) (-1792.984) [-1796.228] (-1803.101) * [-1789.930] (-1793.452) (-1792.681) (-1792.114) -- 0:02:35
679000 -- [-1791.785] (-1790.013) (-1798.792) (-1799.237) * (-1795.065) (-1800.130) (-1786.438) [-1788.128] -- 0:02:35
679500 -- [-1788.679] (-1795.136) (-1789.321) (-1787.242) * (-1791.938) [-1784.467] (-1785.764) (-1789.860) -- 0:02:35
680000 -- (-1799.781) (-1798.279) (-1791.919) [-1789.183] * (-1789.238) [-1799.735] (-1799.913) (-1784.163) -- 0:02:34
Average standard deviation of split frequencies: 0.004911
680500 -- (-1795.335) [-1790.514] (-1793.135) (-1796.931) * [-1793.580] (-1791.280) (-1785.558) (-1791.839) -- 0:02:34
681000 -- (-1785.414) [-1799.684] (-1791.954) (-1796.261) * (-1792.992) [-1789.595] (-1785.849) (-1790.777) -- 0:02:34
681500 -- (-1798.791) [-1793.741] (-1792.428) (-1792.025) * (-1790.422) [-1794.867] (-1790.364) (-1793.647) -- 0:02:34
682000 -- [-1795.485] (-1790.537) (-1787.675) (-1790.580) * (-1790.007) [-1799.185] (-1801.108) (-1792.368) -- 0:02:33
682500 -- (-1797.233) [-1789.282] (-1805.629) (-1786.099) * (-1799.761) [-1799.109] (-1800.460) (-1792.555) -- 0:02:33
683000 -- (-1792.780) (-1791.118) [-1792.406] (-1795.712) * (-1799.791) (-1805.225) (-1786.151) [-1785.533] -- 0:02:33
683500 -- [-1786.495] (-1799.465) (-1800.435) (-1798.503) * (-1805.942) (-1788.158) [-1782.967] (-1799.413) -- 0:02:33
684000 -- [-1792.173] (-1796.807) (-1790.438) (-1798.894) * (-1797.236) (-1800.698) [-1787.842] (-1791.124) -- 0:02:32
684500 -- (-1800.306) (-1798.404) [-1792.587] (-1795.177) * (-1798.136) (-1798.672) [-1784.510] (-1791.112) -- 0:02:33
685000 -- (-1797.261) (-1811.680) [-1795.113] (-1793.089) * (-1807.324) (-1793.610) [-1786.071] (-1796.834) -- 0:02:32
Average standard deviation of split frequencies: 0.003748
685500 -- (-1788.489) (-1796.371) [-1791.927] (-1798.099) * [-1786.225] (-1793.036) (-1788.223) (-1799.010) -- 0:02:32
686000 -- (-1793.644) (-1798.266) [-1783.994] (-1786.857) * [-1794.283] (-1804.874) (-1797.597) (-1791.737) -- 0:02:31
686500 -- (-1792.626) (-1797.780) [-1791.004] (-1798.440) * [-1791.782] (-1795.369) (-1793.997) (-1796.907) -- 0:02:32
687000 -- (-1791.519) (-1790.769) (-1791.247) [-1796.645] * (-1786.282) [-1791.708] (-1811.436) (-1798.975) -- 0:02:31
687500 -- (-1791.595) (-1799.534) [-1791.672] (-1787.008) * (-1793.817) (-1793.499) [-1791.666] (-1794.522) -- 0:02:31
688000 -- (-1802.553) (-1798.459) (-1799.971) [-1787.968] * (-1793.609) (-1790.588) (-1794.990) [-1804.565] -- 0:02:31
688500 -- (-1798.545) (-1806.212) [-1793.972] (-1790.059) * (-1792.532) (-1795.181) (-1786.865) [-1794.070] -- 0:02:31
689000 -- (-1796.170) [-1791.848] (-1790.665) (-1793.013) * (-1799.030) (-1794.276) (-1791.922) [-1793.371] -- 0:02:30
689500 -- [-1787.453] (-1786.381) (-1790.262) (-1797.182) * (-1792.189) (-1796.897) [-1793.752] (-1796.436) -- 0:02:30
690000 -- [-1791.616] (-1787.302) (-1804.157) (-1793.615) * (-1792.323) (-1793.845) [-1792.297] (-1790.952) -- 0:02:30
Average standard deviation of split frequencies: 0.003413
690500 -- (-1794.529) [-1792.605] (-1789.039) (-1794.056) * (-1789.000) (-1796.821) (-1792.493) [-1788.737] -- 0:02:30
691000 -- (-1798.634) (-1797.035) (-1785.520) [-1792.506] * (-1794.754) [-1793.757] (-1796.099) (-1790.531) -- 0:02:29
691500 -- (-1801.655) [-1787.688] (-1792.156) (-1798.588) * [-1791.716] (-1788.383) (-1790.963) (-1802.612) -- 0:02:29
692000 -- (-1793.797) (-1791.758) [-1785.464] (-1799.561) * [-1784.487] (-1799.902) (-1798.602) (-1792.360) -- 0:02:29
692500 -- (-1793.462) (-1790.791) (-1791.638) [-1788.493] * (-1796.057) (-1798.064) [-1788.445] (-1793.102) -- 0:02:29
693000 -- [-1794.921] (-1793.347) (-1788.587) (-1786.805) * [-1791.592] (-1796.497) (-1798.603) (-1800.230) -- 0:02:28
693500 -- (-1797.830) [-1788.321] (-1789.172) (-1791.295) * (-1797.337) [-1789.555] (-1799.563) (-1800.648) -- 0:02:28
694000 -- [-1792.957] (-1797.307) (-1807.811) (-1792.054) * (-1794.892) [-1791.889] (-1799.633) (-1797.249) -- 0:02:28
694500 -- (-1789.224) (-1801.688) (-1794.957) [-1784.035] * (-1796.245) (-1792.674) [-1791.350] (-1795.639) -- 0:02:28
695000 -- (-1794.887) (-1797.098) [-1792.570] (-1791.724) * (-1785.618) [-1788.542] (-1803.812) (-1789.638) -- 0:02:27
Average standard deviation of split frequencies: 0.002894
695500 -- (-1796.423) [-1788.649] (-1795.315) (-1790.284) * (-1793.372) (-1804.258) (-1800.391) [-1792.480] -- 0:02:27
696000 -- (-1797.842) (-1796.797) (-1795.316) [-1791.413] * (-1788.427) (-1806.058) (-1792.559) [-1791.797] -- 0:02:27
696500 -- (-1789.896) [-1788.904] (-1793.398) (-1791.917) * (-1796.003) [-1795.858] (-1789.910) (-1795.142) -- 0:02:27
697000 -- [-1788.884] (-1796.347) (-1789.485) (-1789.886) * (-1794.247) (-1787.855) (-1791.953) [-1795.637] -- 0:02:26
697500 -- (-1793.785) (-1790.716) (-1788.430) [-1795.707] * (-1787.260) (-1792.148) [-1793.322] (-1789.605) -- 0:02:26
698000 -- (-1796.414) (-1788.766) (-1790.930) [-1788.667] * (-1789.342) (-1789.664) (-1792.107) [-1785.998] -- 0:02:26
698500 -- (-1802.761) (-1787.278) [-1790.032] (-1788.667) * (-1783.901) (-1798.497) (-1800.469) [-1787.200] -- 0:02:26
699000 -- (-1792.082) [-1783.711] (-1786.675) (-1789.543) * [-1791.793] (-1800.554) (-1792.579) (-1788.947) -- 0:02:25
699500 -- [-1794.786] (-1792.291) (-1791.376) (-1800.640) * (-1793.039) (-1794.456) [-1792.773] (-1791.565) -- 0:02:25
700000 -- (-1793.052) (-1791.082) (-1793.269) [-1787.922] * (-1788.338) (-1793.889) (-1785.516) [-1796.850] -- 0:02:25
Average standard deviation of split frequencies: 0.003119
700500 -- (-1798.923) (-1802.293) (-1793.165) [-1794.023] * (-1788.996) [-1787.704] (-1792.457) (-1797.071) -- 0:02:25
701000 -- [-1790.130] (-1800.614) (-1792.072) (-1789.875) * (-1794.964) (-1796.499) (-1793.586) [-1792.831] -- 0:02:25
701500 -- [-1788.603] (-1799.064) (-1787.777) (-1792.432) * [-1788.622] (-1801.664) (-1787.067) (-1794.216) -- 0:02:24
702000 -- (-1791.576) (-1808.745) (-1794.039) [-1793.431] * (-1788.602) (-1784.425) [-1790.097] (-1797.942) -- 0:02:24
702500 -- (-1796.703) (-1804.507) (-1804.821) [-1789.939] * [-1788.535] (-1790.102) (-1793.157) (-1798.970) -- 0:02:24
703000 -- (-1793.189) (-1801.517) (-1789.480) [-1790.013] * (-1798.600) (-1786.340) (-1792.425) [-1799.988] -- 0:02:24
703500 -- (-1788.504) (-1797.254) [-1787.633] (-1792.578) * (-1795.201) (-1791.745) (-1787.156) [-1793.402] -- 0:02:23
704000 -- [-1791.119] (-1790.735) (-1789.946) (-1793.052) * (-1787.099) (-1792.476) (-1793.792) [-1794.556] -- 0:02:23
704500 -- (-1787.410) (-1794.839) [-1793.845] (-1801.164) * (-1788.000) (-1797.878) [-1793.599] (-1792.860) -- 0:02:23
705000 -- [-1787.979] (-1796.344) (-1792.226) (-1798.547) * (-1789.597) (-1788.655) [-1791.489] (-1789.693) -- 0:02:23
Average standard deviation of split frequencies: 0.002732
705500 -- [-1785.843] (-1797.460) (-1788.667) (-1792.466) * (-1803.084) (-1791.660) [-1796.953] (-1791.787) -- 0:02:22
706000 -- (-1790.033) [-1790.070] (-1792.017) (-1801.253) * [-1788.656] (-1800.112) (-1802.734) (-1794.464) -- 0:02:22
706500 -- [-1790.705] (-1794.372) (-1790.417) (-1791.062) * (-1797.691) (-1791.701) (-1799.951) [-1790.930] -- 0:02:22
707000 -- (-1802.981) (-1786.936) [-1794.938] (-1799.856) * (-1792.883) [-1797.089] (-1792.510) (-1791.910) -- 0:02:22
707500 -- (-1791.291) [-1787.275] (-1791.540) (-1793.427) * (-1793.063) (-1793.440) (-1786.314) [-1791.769] -- 0:02:21
708000 -- (-1793.664) (-1786.277) [-1791.477] (-1793.068) * (-1797.458) [-1787.297] (-1791.231) (-1785.366) -- 0:02:21
708500 -- (-1792.987) [-1792.373] (-1792.022) (-1788.440) * (-1793.872) (-1794.598) [-1789.852] (-1790.259) -- 0:02:21
709000 -- (-1792.026) [-1791.658] (-1792.119) (-1798.884) * (-1791.396) (-1791.906) [-1792.321] (-1808.273) -- 0:02:21
709500 -- (-1804.034) (-1790.249) (-1800.096) [-1800.779] * (-1796.657) [-1792.424] (-1800.959) (-1799.288) -- 0:02:20
710000 -- (-1809.555) [-1794.639] (-1798.675) (-1786.908) * (-1796.958) (-1799.199) [-1789.631] (-1801.010) -- 0:02:20
Average standard deviation of split frequencies: 0.002472
710500 -- (-1799.562) [-1791.030] (-1788.412) (-1789.885) * (-1793.764) (-1799.529) [-1790.782] (-1794.048) -- 0:02:20
711000 -- (-1793.959) [-1788.334] (-1789.711) (-1788.231) * (-1803.318) (-1787.436) [-1787.342] (-1798.711) -- 0:02:20
711500 -- [-1793.859] (-1794.190) (-1799.108) (-1791.756) * [-1790.304] (-1788.265) (-1795.624) (-1797.078) -- 0:02:19
712000 -- [-1792.170] (-1785.556) (-1794.538) (-1795.778) * (-1795.647) (-1791.594) [-1784.705] (-1797.057) -- 0:02:19
712500 -- (-1790.699) (-1797.417) [-1792.989] (-1791.822) * [-1800.965] (-1795.170) (-1798.251) (-1796.456) -- 0:02:19
713000 -- [-1789.542] (-1795.775) (-1797.988) (-1800.324) * [-1802.683] (-1788.831) (-1797.163) (-1789.929) -- 0:02:19
713500 -- [-1788.154] (-1802.582) (-1795.900) (-1795.152) * (-1788.441) [-1792.410] (-1790.912) (-1797.067) -- 0:02:18
714000 -- [-1787.336] (-1788.566) (-1794.425) (-1797.712) * (-1800.536) [-1789.619] (-1799.249) (-1792.246) -- 0:02:18
714500 -- [-1793.373] (-1790.605) (-1793.646) (-1786.770) * (-1796.556) (-1803.533) (-1794.430) [-1790.428] -- 0:02:18
715000 -- (-1789.019) (-1790.886) [-1787.358] (-1791.368) * (-1796.364) [-1790.207] (-1791.659) (-1787.890) -- 0:02:18
Average standard deviation of split frequencies: 0.002394
715500 -- (-1803.604) [-1788.650] (-1791.726) (-1801.626) * [-1788.678] (-1787.356) (-1813.810) (-1789.664) -- 0:02:17
716000 -- [-1792.007] (-1801.171) (-1797.647) (-1792.871) * (-1803.663) [-1791.806] (-1798.268) (-1793.824) -- 0:02:18
716500 -- (-1793.344) (-1794.195) [-1793.680] (-1790.507) * (-1791.167) (-1786.559) (-1798.766) [-1788.926] -- 0:02:17
717000 -- (-1803.779) [-1792.896] (-1787.462) (-1789.094) * (-1795.862) [-1781.025] (-1794.393) (-1784.952) -- 0:02:17
717500 -- [-1792.528] (-1789.996) (-1792.851) (-1793.895) * (-1795.557) (-1790.945) (-1792.828) [-1790.601] -- 0:02:17
718000 -- (-1793.765) (-1802.624) [-1789.306] (-1786.576) * (-1794.165) [-1789.929] (-1794.255) (-1807.827) -- 0:02:17
718500 -- (-1791.244) [-1787.348] (-1789.269) (-1801.422) * (-1795.935) (-1794.830) [-1795.078] (-1793.230) -- 0:02:16
719000 -- (-1798.044) [-1792.650] (-1794.722) (-1793.608) * (-1791.526) (-1796.610) (-1793.160) [-1793.109] -- 0:02:16
719500 -- (-1793.860) (-1804.114) [-1792.299] (-1796.574) * (-1795.210) [-1788.309] (-1799.701) (-1795.247) -- 0:02:16
720000 -- (-1796.850) (-1799.188) [-1786.162] (-1809.787) * (-1784.282) [-1796.738] (-1799.860) (-1791.921) -- 0:02:16
Average standard deviation of split frequencies: 0.002735
720500 -- (-1797.114) [-1786.259] (-1799.400) (-1796.558) * (-1795.959) [-1787.271] (-1792.182) (-1788.569) -- 0:02:15
721000 -- [-1794.856] (-1798.823) (-1795.052) (-1790.462) * (-1796.450) (-1796.316) (-1793.930) [-1786.582] -- 0:02:15
721500 -- [-1788.470] (-1795.853) (-1794.041) (-1793.984) * (-1796.783) (-1792.640) [-1794.896] (-1795.661) -- 0:02:15
722000 -- [-1790.460] (-1786.070) (-1806.573) (-1794.394) * (-1795.503) (-1803.832) [-1792.680] (-1794.587) -- 0:02:15
722500 -- [-1788.450] (-1787.488) (-1786.936) (-1790.296) * (-1792.436) [-1794.492] (-1794.342) (-1788.721) -- 0:02:14
723000 -- (-1803.408) (-1792.632) [-1789.317] (-1794.640) * (-1792.564) (-1799.911) [-1796.842] (-1789.661) -- 0:02:14
723500 -- (-1788.105) [-1794.585] (-1801.654) (-1798.990) * (-1789.133) [-1794.055] (-1793.266) (-1799.602) -- 0:02:14
724000 -- (-1804.879) (-1797.814) [-1795.794] (-1784.526) * (-1787.147) (-1799.450) (-1799.914) [-1795.810] -- 0:02:14
724500 -- (-1800.060) (-1796.863) [-1788.948] (-1789.835) * [-1801.181] (-1794.399) (-1801.479) (-1788.136) -- 0:02:13
725000 -- (-1796.157) [-1787.617] (-1803.207) (-1799.148) * [-1795.174] (-1802.740) (-1790.787) (-1791.828) -- 0:02:13
Average standard deviation of split frequencies: 0.002656
725500 -- (-1793.058) (-1793.404) (-1789.981) [-1795.928] * (-1791.849) (-1803.706) [-1790.046] (-1799.724) -- 0:02:13
726000 -- (-1793.393) (-1794.377) [-1786.454] (-1793.910) * [-1790.901] (-1799.511) (-1803.796) (-1798.541) -- 0:02:13
726500 -- (-1786.585) (-1789.989) [-1787.647] (-1791.957) * (-1789.808) [-1798.770] (-1798.076) (-1792.773) -- 0:02:12
727000 -- (-1789.460) [-1791.640] (-1802.865) (-1789.533) * (-1795.046) (-1789.806) (-1797.271) [-1788.375] -- 0:02:12
727500 -- (-1788.955) [-1783.902] (-1792.271) (-1784.263) * (-1796.470) (-1795.362) (-1811.130) [-1794.941] -- 0:02:12
728000 -- (-1787.049) [-1791.973] (-1802.960) (-1798.340) * (-1790.543) (-1797.465) (-1793.077) [-1788.618] -- 0:02:11
728500 -- (-1799.062) (-1789.836) (-1796.296) [-1792.375] * (-1801.673) [-1791.462] (-1799.808) (-1795.204) -- 0:02:11
729000 -- [-1794.812] (-1791.986) (-1796.558) (-1791.068) * (-1795.987) [-1789.958] (-1796.548) (-1798.044) -- 0:02:11
729500 -- (-1798.833) (-1791.092) (-1790.258) [-1795.915] * (-1792.361) (-1793.864) [-1787.505] (-1797.701) -- 0:02:11
730000 -- (-1794.423) [-1795.001] (-1788.736) (-1789.725) * (-1791.417) (-1793.710) (-1795.952) [-1790.769] -- 0:02:10
Average standard deviation of split frequencies: 0.002287
730500 -- (-1789.869) (-1795.312) [-1788.004] (-1798.694) * (-1792.359) (-1785.081) (-1799.059) [-1786.187] -- 0:02:10
731000 -- (-1788.030) (-1796.249) (-1794.920) [-1795.977] * (-1800.073) (-1794.765) [-1791.296] (-1789.531) -- 0:02:10
731500 -- (-1790.871) (-1796.506) [-1790.773] (-1801.950) * (-1798.157) [-1790.802] (-1799.000) (-1792.690) -- 0:02:10
732000 -- [-1787.218] (-1791.262) (-1794.995) (-1801.655) * [-1796.270] (-1794.304) (-1800.077) (-1791.870) -- 0:02:09
732500 -- (-1806.257) (-1782.321) [-1791.278] (-1788.123) * (-1796.598) [-1788.881] (-1798.037) (-1796.276) -- 0:02:10
733000 -- (-1797.395) [-1796.497] (-1787.175) (-1800.686) * (-1794.348) (-1793.510) [-1788.134] (-1797.254) -- 0:02:09
733500 -- [-1791.732] (-1790.312) (-1789.371) (-1788.349) * (-1798.232) (-1794.940) [-1794.037] (-1793.719) -- 0:02:09
734000 -- (-1805.231) (-1793.313) (-1788.461) [-1791.981] * (-1786.724) (-1789.857) (-1802.207) [-1788.987] -- 0:02:09
734500 -- [-1793.923] (-1805.901) (-1788.469) (-1792.356) * [-1792.591] (-1802.908) (-1789.677) (-1790.839) -- 0:02:09
735000 -- [-1794.006] (-1799.163) (-1782.562) (-1790.575) * (-1787.562) (-1799.472) [-1785.461] (-1793.582) -- 0:02:08
Average standard deviation of split frequencies: 0.002050
735500 -- (-1787.988) (-1806.681) (-1789.449) [-1801.810] * (-1798.986) (-1797.305) (-1797.380) [-1794.864] -- 0:02:08
736000 -- (-1789.012) (-1794.816) (-1789.659) [-1791.877] * (-1791.320) [-1791.336] (-1794.004) (-1802.628) -- 0:02:08
736500 -- [-1790.944] (-1799.878) (-1790.282) (-1797.752) * (-1790.496) (-1792.015) [-1790.529] (-1796.321) -- 0:02:08
737000 -- (-1789.772) (-1795.977) (-1794.242) [-1788.866] * (-1802.482) [-1797.917] (-1805.001) (-1788.558) -- 0:02:07
737500 -- [-1787.494] (-1785.850) (-1790.192) (-1794.563) * (-1797.043) [-1793.695] (-1792.999) (-1793.928) -- 0:02:07
738000 -- (-1794.078) (-1789.789) (-1793.445) [-1792.628] * (-1782.837) [-1795.043] (-1795.317) (-1807.450) -- 0:02:07
738500 -- (-1789.183) [-1787.737] (-1799.038) (-1792.096) * (-1795.144) (-1798.403) [-1785.902] (-1799.498) -- 0:02:07
739000 -- (-1796.371) (-1796.564) (-1798.904) [-1794.718] * (-1804.636) (-1796.675) (-1785.323) [-1783.153] -- 0:02:06
739500 -- [-1792.701] (-1799.021) (-1793.561) (-1806.710) * (-1790.169) [-1789.998] (-1792.585) (-1793.753) -- 0:02:06
740000 -- [-1787.941] (-1794.499) (-1794.582) (-1794.008) * (-1791.009) (-1795.305) (-1788.611) [-1792.904] -- 0:02:06
Average standard deviation of split frequencies: 0.002314
740500 -- [-1790.763] (-1790.815) (-1790.825) (-1795.628) * (-1803.251) [-1789.772] (-1792.518) (-1795.582) -- 0:02:05
741000 -- [-1788.562] (-1784.319) (-1790.196) (-1807.197) * (-1790.976) (-1788.306) [-1791.183] (-1791.555) -- 0:02:05
741500 -- (-1796.380) [-1791.121] (-1795.984) (-1804.525) * [-1786.680] (-1786.673) (-1788.980) (-1800.475) -- 0:02:05
742000 -- (-1789.803) (-1790.686) (-1789.730) [-1784.450] * [-1790.714] (-1793.391) (-1801.576) (-1792.868) -- 0:02:05
742500 -- (-1795.934) [-1787.486] (-1803.050) (-1793.655) * (-1799.493) (-1796.890) (-1786.735) [-1795.325] -- 0:02:04
743000 -- (-1787.280) (-1790.525) (-1793.039) [-1789.458] * (-1797.670) (-1803.081) [-1794.191] (-1793.157) -- 0:02:04
743500 -- (-1788.963) (-1783.670) [-1795.192] (-1793.566) * [-1794.033] (-1798.026) (-1791.333) (-1798.943) -- 0:02:04
744000 -- (-1789.152) [-1785.644] (-1793.682) (-1800.183) * [-1789.157] (-1798.541) (-1789.035) (-1797.783) -- 0:02:04
744500 -- (-1795.445) (-1786.378) [-1789.942] (-1796.546) * (-1790.211) (-1798.181) [-1794.188] (-1791.535) -- 0:02:03
745000 -- (-1788.329) (-1794.779) [-1789.608] (-1791.376) * (-1798.923) (-1798.013) (-1794.757) [-1792.891] -- 0:02:03
Average standard deviation of split frequencies: 0.002212
745500 -- [-1797.178] (-1790.237) (-1797.958) (-1787.164) * (-1787.105) [-1790.665] (-1795.209) (-1796.212) -- 0:02:03
746000 -- (-1792.368) (-1794.223) (-1797.315) [-1788.887] * (-1797.034) (-1786.327) (-1794.394) [-1787.878] -- 0:02:03
746500 -- (-1794.546) [-1793.048] (-1794.175) (-1792.450) * (-1800.504) (-1794.225) (-1796.944) [-1788.356] -- 0:02:02
747000 -- [-1797.320] (-1797.411) (-1793.682) (-1791.819) * (-1796.402) (-1789.438) (-1790.631) [-1788.180] -- 0:02:02
747500 -- [-1789.017] (-1793.473) (-1797.434) (-1790.559) * (-1790.134) (-1790.269) (-1797.607) [-1789.008] -- 0:02:02
748000 -- (-1790.734) [-1789.512] (-1800.953) (-1789.664) * (-1786.022) (-1792.743) [-1788.177] (-1788.712) -- 0:02:02
748500 -- (-1788.864) [-1788.965] (-1793.195) (-1799.552) * (-1782.586) [-1786.964] (-1796.332) (-1807.191) -- 0:02:01
749000 -- (-1790.724) (-1792.255) [-1790.090] (-1802.354) * [-1786.351] (-1793.281) (-1792.509) (-1791.836) -- 0:02:01
749500 -- (-1794.707) [-1789.717] (-1800.044) (-1795.613) * (-1789.509) (-1789.163) [-1796.130] (-1790.605) -- 0:02:01
750000 -- [-1787.869] (-1788.586) (-1797.390) (-1801.472) * (-1800.678) [-1791.032] (-1789.699) (-1793.029) -- 0:02:01
Average standard deviation of split frequencies: 0.002455
750500 -- (-1790.242) (-1789.233) [-1794.579] (-1807.131) * (-1795.445) [-1790.518] (-1797.098) (-1798.405) -- 0:02:01
751000 -- (-1800.457) (-1796.648) [-1789.009] (-1801.500) * (-1790.578) (-1788.230) [-1801.041] (-1800.057) -- 0:02:00
751500 -- (-1797.362) [-1791.147] (-1795.281) (-1798.162) * (-1790.753) [-1791.852] (-1792.888) (-1807.819) -- 0:02:00
752000 -- (-1788.286) (-1796.486) [-1798.765] (-1791.690) * (-1792.881) [-1793.458] (-1804.472) (-1783.812) -- 0:02:00
752500 -- (-1787.468) [-1789.233] (-1808.987) (-1789.485) * [-1793.741] (-1802.095) (-1799.371) (-1792.258) -- 0:02:00
753000 -- (-1794.753) (-1795.472) [-1794.070] (-1796.100) * (-1795.348) [-1793.614] (-1798.967) (-1802.576) -- 0:01:59
753500 -- [-1794.407] (-1789.271) (-1805.513) (-1793.701) * (-1789.833) (-1793.451) [-1786.615] (-1788.862) -- 0:01:59
754000 -- (-1799.638) (-1792.334) [-1789.653] (-1794.205) * (-1787.263) [-1791.898] (-1790.537) (-1794.202) -- 0:01:59
754500 -- (-1798.341) (-1787.689) [-1790.032] (-1796.225) * (-1790.973) [-1797.465] (-1795.281) (-1793.269) -- 0:01:59
755000 -- (-1796.842) (-1787.391) [-1788.462] (-1801.559) * (-1800.116) (-1795.535) [-1790.484] (-1793.271) -- 0:01:58
Average standard deviation of split frequencies: 0.002557
755500 -- (-1797.331) (-1800.474) [-1787.013] (-1799.527) * [-1792.250] (-1802.608) (-1791.292) (-1786.339) -- 0:01:58
756000 -- (-1789.854) (-1787.271) [-1797.324] (-1790.338) * [-1789.185] (-1788.064) (-1790.089) (-1795.300) -- 0:01:58
756500 -- (-1789.613) [-1786.542] (-1800.631) (-1792.688) * (-1791.949) (-1790.672) (-1793.019) [-1788.798] -- 0:01:58
757000 -- (-1796.868) (-1789.215) [-1793.172] (-1798.138) * (-1796.215) (-1799.017) (-1792.622) [-1788.069] -- 0:01:57
757500 -- (-1797.114) (-1794.425) (-1793.897) [-1789.088] * (-1793.383) [-1791.437] (-1791.671) (-1795.486) -- 0:01:57
758000 -- [-1788.787] (-1795.630) (-1795.004) (-1797.786) * [-1794.274] (-1795.838) (-1789.160) (-1795.055) -- 0:01:57
758500 -- [-1791.337] (-1803.697) (-1787.855) (-1793.774) * (-1788.547) (-1798.529) [-1783.930] (-1799.581) -- 0:01:57
759000 -- (-1789.893) (-1790.083) (-1786.058) [-1793.962] * (-1795.394) [-1786.335] (-1788.266) (-1798.170) -- 0:01:56
759500 -- (-1796.150) (-1792.770) (-1793.171) [-1788.381] * (-1789.331) (-1790.159) (-1801.322) [-1786.919] -- 0:01:56
760000 -- (-1798.450) (-1792.441) [-1786.542] (-1800.725) * (-1788.133) [-1784.033] (-1798.102) (-1786.736) -- 0:01:56
Average standard deviation of split frequencies: 0.003161
760500 -- (-1793.226) (-1793.774) [-1800.257] (-1790.054) * (-1795.914) [-1796.150] (-1799.480) (-1786.912) -- 0:01:56
761000 -- [-1788.995] (-1793.041) (-1798.294) (-1787.248) * (-1792.134) (-1800.030) [-1794.519] (-1789.584) -- 0:01:55
761500 -- (-1805.802) (-1790.757) [-1801.335] (-1797.623) * (-1793.988) (-1802.403) [-1795.545] (-1794.355) -- 0:01:55
762000 -- (-1812.382) (-1794.708) [-1792.024] (-1789.928) * (-1792.702) (-1791.963) (-1807.828) [-1790.539] -- 0:01:55
762500 -- (-1801.296) (-1801.153) (-1795.930) [-1789.570] * [-1788.959] (-1787.026) (-1803.532) (-1789.083) -- 0:01:55
763000 -- (-1793.619) [-1786.278] (-1798.036) (-1786.894) * [-1788.833] (-1791.162) (-1792.204) (-1800.399) -- 0:01:54
763500 -- (-1795.794) (-1793.946) [-1788.491] (-1791.733) * (-1791.453) [-1789.348] (-1793.896) (-1794.172) -- 0:01:54
764000 -- (-1792.033) (-1804.266) (-1797.940) [-1789.504] * (-1798.292) [-1789.226] (-1802.022) (-1792.195) -- 0:01:54
764500 -- [-1782.805] (-1785.486) (-1797.258) (-1789.614) * [-1793.657] (-1793.200) (-1808.812) (-1789.205) -- 0:01:54
765000 -- [-1786.456] (-1789.523) (-1791.735) (-1794.645) * (-1808.574) (-1790.848) (-1796.126) [-1787.441] -- 0:01:53
Average standard deviation of split frequencies: 0.003077
765500 -- (-1791.597) (-1793.757) [-1783.907] (-1793.696) * [-1787.754] (-1795.813) (-1798.642) (-1791.207) -- 0:01:53
766000 -- (-1798.553) (-1802.941) (-1788.497) [-1787.848] * (-1797.438) [-1793.002] (-1793.047) (-1795.143) -- 0:01:53
766500 -- (-1795.853) [-1794.819] (-1807.813) (-1793.360) * (-1795.507) (-1785.384) [-1791.743] (-1793.712) -- 0:01:53
767000 -- (-1792.749) [-1795.026] (-1796.340) (-1800.631) * (-1794.981) [-1788.272] (-1802.271) (-1789.454) -- 0:01:53
767500 -- (-1789.677) (-1790.189) [-1794.633] (-1792.297) * (-1791.582) (-1787.664) [-1792.271] (-1793.166) -- 0:01:52
768000 -- (-1799.702) (-1798.139) (-1795.952) [-1792.862] * (-1792.710) (-1802.647) [-1786.783] (-1793.703) -- 0:01:52
768500 -- (-1787.457) (-1793.150) (-1793.409) [-1794.010] * [-1789.918] (-1794.339) (-1792.491) (-1793.315) -- 0:01:52
769000 -- (-1789.266) (-1789.198) [-1788.550] (-1791.558) * (-1789.112) (-1792.309) (-1800.667) [-1786.935] -- 0:01:52
769500 -- (-1789.951) (-1802.344) [-1786.431] (-1795.749) * (-1804.131) (-1798.034) [-1793.302] (-1784.660) -- 0:01:51
770000 -- (-1797.069) [-1790.749] (-1789.676) (-1792.772) * (-1794.461) [-1797.073] (-1788.011) (-1788.411) -- 0:01:51
Average standard deviation of split frequencies: 0.003058
770500 -- (-1790.599) (-1785.995) [-1790.063] (-1798.280) * (-1798.231) (-1801.905) (-1794.298) [-1792.119] -- 0:01:51
771000 -- (-1793.669) [-1787.071] (-1795.640) (-1791.316) * (-1796.496) (-1785.390) (-1789.759) [-1789.036] -- 0:01:51
771500 -- [-1789.983] (-1789.719) (-1797.672) (-1790.877) * [-1786.649] (-1784.405) (-1787.523) (-1789.886) -- 0:01:50
772000 -- (-1789.625) [-1788.899] (-1794.031) (-1790.434) * [-1783.289] (-1789.920) (-1798.965) (-1792.121) -- 0:01:50
772500 -- (-1792.920) [-1785.147] (-1792.855) (-1800.782) * (-1793.227) (-1797.409) [-1789.672] (-1793.839) -- 0:01:50
773000 -- (-1788.206) (-1795.850) [-1793.913] (-1795.401) * (-1788.283) (-1799.874) [-1799.456] (-1790.197) -- 0:01:50
773500 -- (-1791.556) (-1788.811) (-1785.886) [-1795.394] * (-1797.167) (-1803.280) [-1793.976] (-1787.923) -- 0:01:49
774000 -- (-1804.700) [-1792.242] (-1796.062) (-1803.077) * [-1792.034] (-1796.847) (-1791.712) (-1794.716) -- 0:01:49
774500 -- (-1796.630) (-1793.239) [-1797.448] (-1802.167) * [-1795.763] (-1786.429) (-1795.837) (-1794.336) -- 0:01:49
775000 -- (-1792.398) (-1798.743) [-1792.055] (-1788.999) * (-1791.028) (-1782.564) (-1805.697) [-1785.691] -- 0:01:48
Average standard deviation of split frequencies: 0.002916
775500 -- (-1796.826) (-1794.198) (-1798.886) [-1791.832] * (-1803.539) [-1789.573] (-1797.684) (-1788.274) -- 0:01:48
776000 -- (-1795.077) (-1798.629) (-1789.688) [-1795.413] * [-1797.978] (-1795.522) (-1794.119) (-1795.988) -- 0:01:48
776500 -- (-1790.123) [-1793.951] (-1799.377) (-1795.388) * [-1794.293] (-1794.272) (-1787.320) (-1791.682) -- 0:01:48
777000 -- (-1787.175) (-1799.183) [-1794.033] (-1791.109) * (-1797.063) [-1792.320] (-1785.928) (-1793.428) -- 0:01:47
777500 -- [-1792.025] (-1801.264) (-1799.147) (-1793.241) * (-1810.993) (-1787.473) [-1785.985] (-1802.025) -- 0:01:47
778000 -- [-1792.579] (-1793.815) (-1786.764) (-1799.179) * (-1801.412) (-1792.823) (-1793.742) [-1788.015] -- 0:01:47
778500 -- (-1800.150) [-1787.215] (-1794.259) (-1801.470) * (-1806.573) [-1789.213] (-1795.772) (-1795.249) -- 0:01:47
779000 -- [-1788.935] (-1790.158) (-1795.974) (-1802.980) * (-1791.601) (-1797.763) (-1790.322) [-1789.476] -- 0:01:46
779500 -- (-1791.515) [-1792.651] (-1800.684) (-1793.683) * [-1790.106] (-1782.327) (-1793.034) (-1784.923) -- 0:01:46
780000 -- (-1792.371) (-1796.553) (-1794.907) [-1787.235] * (-1796.720) [-1790.682] (-1799.017) (-1794.042) -- 0:01:46
Average standard deviation of split frequencies: 0.002717
780500 -- (-1796.368) (-1793.400) (-1790.264) [-1786.806] * (-1795.484) (-1791.715) [-1792.340] (-1793.133) -- 0:01:46
781000 -- (-1797.886) (-1801.156) (-1791.230) [-1795.387] * (-1801.272) (-1789.375) (-1793.642) [-1786.874] -- 0:01:45
781500 -- (-1784.951) (-1799.102) (-1794.725) [-1791.810] * [-1791.042] (-1793.898) (-1797.973) (-1797.507) -- 0:01:45
782000 -- [-1785.762] (-1791.400) (-1790.091) (-1797.686) * (-1789.053) (-1787.530) [-1784.230] (-1792.886) -- 0:01:45
782500 -- (-1798.457) (-1794.111) (-1797.333) [-1787.901] * (-1792.047) (-1790.338) (-1794.721) [-1785.559] -- 0:01:45
783000 -- (-1798.171) (-1789.100) [-1791.866] (-1791.405) * (-1785.847) (-1792.559) [-1791.503] (-1792.337) -- 0:01:45
783500 -- (-1792.669) [-1790.648] (-1792.385) (-1792.893) * (-1789.491) (-1800.199) (-1797.573) [-1787.700] -- 0:01:44
784000 -- [-1791.835] (-1802.033) (-1794.923) (-1792.250) * (-1794.847) (-1791.891) (-1790.356) [-1787.587] -- 0:01:44
784500 -- (-1792.192) (-1804.513) [-1787.086] (-1791.356) * [-1791.255] (-1794.825) (-1794.605) (-1795.683) -- 0:01:44
785000 -- [-1792.091] (-1812.521) (-1791.607) (-1789.774) * (-1794.352) (-1801.214) (-1802.858) [-1793.531] -- 0:01:44
Average standard deviation of split frequencies: 0.003119
785500 -- (-1790.742) (-1812.628) [-1790.117] (-1787.445) * [-1793.191] (-1798.349) (-1796.293) (-1793.451) -- 0:01:43
786000 -- [-1787.995] (-1800.802) (-1797.910) (-1800.421) * (-1792.090) (-1800.588) (-1790.101) [-1789.312] -- 0:01:43
786500 -- [-1790.195] (-1801.901) (-1795.638) (-1794.985) * (-1793.207) (-1798.253) [-1792.213] (-1786.458) -- 0:01:43
787000 -- [-1792.697] (-1809.486) (-1787.574) (-1787.066) * (-1791.559) (-1803.580) [-1788.754] (-1785.392) -- 0:01:43
787500 -- [-1791.952] (-1790.008) (-1787.386) (-1793.608) * [-1791.352] (-1791.565) (-1794.987) (-1795.443) -- 0:01:42
788000 -- (-1798.843) (-1794.296) (-1798.542) [-1795.898] * (-1801.266) (-1789.344) [-1791.888] (-1791.985) -- 0:01:42
788500 -- (-1797.025) [-1799.417] (-1799.537) (-1797.802) * (-1786.870) (-1793.760) (-1793.282) [-1796.550] -- 0:01:42
789000 -- (-1795.152) [-1785.957] (-1797.532) (-1797.955) * [-1787.099] (-1790.570) (-1792.664) (-1793.666) -- 0:01:42
789500 -- [-1800.679] (-1794.065) (-1797.892) (-1790.081) * [-1790.717] (-1807.410) (-1787.780) (-1793.206) -- 0:01:41
790000 -- (-1796.569) (-1795.386) (-1787.224) [-1788.205] * (-1794.484) [-1803.778] (-1807.226) (-1790.560) -- 0:01:41
Average standard deviation of split frequencies: 0.003875
790500 -- [-1790.363] (-1798.613) (-1795.958) (-1787.869) * (-1796.214) (-1795.623) (-1796.008) [-1799.222] -- 0:01:41
791000 -- (-1792.799) (-1804.198) (-1796.367) [-1789.331] * [-1804.248] (-1792.446) (-1796.758) (-1795.861) -- 0:01:41
791500 -- (-1796.969) (-1797.470) (-1809.863) [-1792.388] * (-1796.641) (-1801.646) [-1792.734] (-1788.523) -- 0:01:40
792000 -- (-1801.494) (-1800.981) [-1795.325] (-1788.895) * (-1808.758) [-1792.256] (-1794.430) (-1788.507) -- 0:01:40
792500 -- [-1796.480] (-1788.220) (-1795.425) (-1793.390) * (-1810.860) (-1799.529) (-1793.586) [-1794.896] -- 0:01:40
793000 -- (-1795.903) (-1792.936) [-1791.218] (-1802.601) * [-1788.004] (-1794.891) (-1794.077) (-1798.515) -- 0:01:40
793500 -- [-1792.974] (-1801.170) (-1795.241) (-1786.336) * [-1794.101] (-1786.319) (-1788.077) (-1793.991) -- 0:01:39
794000 -- (-1793.674) (-1808.417) (-1790.574) [-1787.565] * (-1795.256) (-1789.097) [-1788.909] (-1791.364) -- 0:01:39
794500 -- (-1785.023) (-1789.972) (-1791.524) [-1794.570] * (-1789.631) (-1790.096) (-1792.741) [-1796.534] -- 0:01:39
795000 -- (-1793.947) (-1800.031) (-1797.233) [-1791.542] * (-1785.882) (-1792.361) [-1789.317] (-1805.010) -- 0:01:39
Average standard deviation of split frequencies: 0.004146
795500 -- (-1795.032) [-1790.473] (-1805.431) (-1805.320) * (-1794.608) (-1793.647) (-1789.343) [-1790.798] -- 0:01:38
796000 -- (-1814.846) [-1787.256] (-1801.980) (-1796.925) * (-1793.941) [-1793.944] (-1793.921) (-1792.728) -- 0:01:38
796500 -- [-1788.009] (-1806.608) (-1807.958) (-1796.725) * [-1786.261] (-1800.070) (-1793.697) (-1794.114) -- 0:01:38
797000 -- (-1792.278) [-1791.978] (-1803.140) (-1791.459) * (-1788.169) (-1795.715) [-1788.593] (-1789.276) -- 0:01:38
797500 -- (-1785.801) (-1794.404) (-1795.024) [-1787.807] * [-1792.198] (-1793.517) (-1794.638) (-1791.318) -- 0:01:38
798000 -- (-1792.649) [-1791.464] (-1796.302) (-1795.976) * (-1788.709) (-1791.467) [-1787.607] (-1797.220) -- 0:01:37
798500 -- [-1798.868] (-1797.715) (-1797.942) (-1798.605) * (-1784.578) (-1799.259) (-1800.193) [-1800.600] -- 0:01:37
799000 -- (-1792.271) (-1799.155) (-1788.986) [-1790.799] * [-1786.463] (-1790.303) (-1791.412) (-1794.259) -- 0:01:37
799500 -- (-1801.493) [-1791.713] (-1790.851) (-1790.252) * [-1790.308] (-1794.376) (-1793.946) (-1800.774) -- 0:01:37
800000 -- (-1799.843) (-1804.367) (-1788.392) [-1793.322] * [-1802.018] (-1794.411) (-1788.604) (-1799.625) -- 0:01:36
Average standard deviation of split frequencies: 0.004533
800500 -- (-1798.028) (-1790.754) (-1802.258) [-1793.852] * [-1785.918] (-1793.546) (-1795.094) (-1803.541) -- 0:01:36
801000 -- (-1793.653) (-1806.088) (-1797.864) [-1791.608] * (-1788.908) (-1803.292) [-1794.759] (-1791.314) -- 0:01:36
801500 -- [-1792.544] (-1786.840) (-1796.726) (-1793.034) * (-1787.728) (-1794.901) (-1795.906) [-1792.887] -- 0:01:36
802000 -- (-1792.821) [-1791.963] (-1799.172) (-1792.175) * (-1794.146) (-1794.883) [-1786.288] (-1799.162) -- 0:01:35
802500 -- (-1789.810) [-1789.125] (-1802.977) (-1791.381) * (-1789.974) (-1797.138) [-1787.610] (-1789.863) -- 0:01:35
803000 -- (-1798.386) [-1785.950] (-1793.974) (-1793.299) * (-1786.721) (-1791.532) (-1788.930) [-1790.193] -- 0:01:35
803500 -- (-1801.174) (-1795.843) [-1786.307] (-1790.952) * (-1796.458) (-1790.409) [-1786.303] (-1796.821) -- 0:01:35
804000 -- (-1795.080) (-1796.397) [-1788.551] (-1793.483) * (-1795.055) (-1794.153) (-1794.330) [-1801.789] -- 0:01:34
804500 -- [-1789.844] (-1796.445) (-1791.449) (-1792.565) * (-1799.896) (-1800.148) [-1791.865] (-1785.980) -- 0:01:34
805000 -- [-1792.958] (-1794.712) (-1800.032) (-1789.287) * (-1799.897) (-1790.301) (-1794.072) [-1793.962] -- 0:01:34
Average standard deviation of split frequencies: 0.004854
805500 -- (-1804.779) (-1795.272) (-1791.727) [-1794.313] * (-1797.371) (-1788.320) (-1798.505) [-1790.039] -- 0:01:34
806000 -- (-1795.660) (-1791.273) (-1786.954) [-1793.674] * (-1787.344) (-1791.317) (-1789.627) [-1798.725] -- 0:01:33
806500 -- (-1788.593) (-1793.417) (-1788.734) [-1794.601] * (-1787.697) (-1795.813) [-1784.885] (-1799.754) -- 0:01:33
807000 -- (-1787.310) [-1792.301] (-1791.421) (-1791.694) * (-1790.503) [-1787.021] (-1793.717) (-1800.673) -- 0:01:33
807500 -- (-1790.328) (-1788.984) [-1794.990] (-1796.420) * (-1789.331) (-1799.595) [-1787.737] (-1791.100) -- 0:01:33
808000 -- [-1786.019] (-1793.712) (-1797.334) (-1794.421) * (-1791.053) (-1797.776) (-1796.078) [-1792.068] -- 0:01:32
808500 -- (-1787.780) (-1792.853) [-1793.554] (-1790.581) * (-1793.004) (-1786.889) (-1801.976) [-1790.769] -- 0:01:32
809000 -- (-1792.950) (-1795.708) [-1791.750] (-1793.271) * (-1791.275) (-1789.367) [-1794.255] (-1794.653) -- 0:01:32
809500 -- (-1790.758) (-1791.109) [-1793.485] (-1798.537) * (-1796.856) (-1804.564) [-1786.106] (-1793.348) -- 0:01:32
810000 -- (-1797.787) (-1792.925) [-1790.764] (-1796.444) * (-1798.584) [-1794.668] (-1789.182) (-1796.431) -- 0:01:31
Average standard deviation of split frequencies: 0.005175
810500 -- [-1789.665] (-1799.791) (-1796.495) (-1787.505) * (-1791.334) (-1789.277) [-1785.759] (-1796.357) -- 0:01:31
811000 -- (-1790.512) (-1803.435) (-1794.109) [-1788.581] * [-1789.479] (-1795.712) (-1787.821) (-1812.410) -- 0:01:31
811500 -- (-1791.233) (-1804.458) (-1802.129) [-1786.800] * (-1800.611) (-1800.288) (-1788.338) [-1796.865] -- 0:01:31
812000 -- (-1795.383) (-1808.756) (-1788.717) [-1791.744] * [-1793.563] (-1797.444) (-1792.461) (-1795.989) -- 0:01:31
812500 -- [-1792.327] (-1794.837) (-1798.162) (-1791.873) * (-1796.368) (-1798.691) (-1791.527) [-1801.275] -- 0:01:30
813000 -- (-1793.096) (-1790.048) (-1809.291) [-1786.826] * [-1790.038] (-1792.151) (-1798.644) (-1791.411) -- 0:01:30
813500 -- (-1791.917) [-1799.018] (-1794.366) (-1786.308) * (-1791.486) (-1789.783) (-1798.554) [-1785.616] -- 0:01:30
814000 -- (-1801.420) (-1794.156) [-1794.991] (-1791.637) * (-1799.798) (-1799.012) [-1788.616] (-1798.914) -- 0:01:30
814500 -- (-1795.603) (-1795.139) (-1794.472) [-1789.716] * (-1804.522) (-1795.154) [-1793.359] (-1793.905) -- 0:01:29
815000 -- (-1792.934) [-1792.026] (-1802.566) (-1787.535) * (-1802.524) [-1792.627] (-1790.660) (-1798.024) -- 0:01:29
Average standard deviation of split frequencies: 0.004679
815500 -- [-1791.400] (-1790.611) (-1797.977) (-1787.613) * (-1790.296) (-1791.390) (-1784.045) [-1784.835] -- 0:01:29
816000 -- (-1790.050) (-1789.768) [-1794.359] (-1793.673) * (-1796.955) [-1786.573] (-1789.122) (-1787.697) -- 0:01:29
816500 -- (-1787.486) (-1790.459) (-1789.811) [-1789.963] * (-1798.600) [-1796.119] (-1798.124) (-1786.317) -- 0:01:28
817000 -- [-1787.352] (-1793.892) (-1790.027) (-1798.185) * [-1794.910] (-1790.144) (-1790.557) (-1784.150) -- 0:01:28
817500 -- (-1789.446) [-1790.180] (-1790.722) (-1796.200) * [-1800.675] (-1790.600) (-1785.813) (-1799.324) -- 0:01:28
818000 -- (-1792.932) (-1789.596) (-1803.153) [-1800.925] * (-1791.587) (-1795.428) [-1789.279] (-1793.162) -- 0:01:28
818500 -- [-1781.574] (-1792.031) (-1795.085) (-1792.528) * (-1800.182) [-1789.044] (-1788.168) (-1792.567) -- 0:01:28
819000 -- (-1799.732) (-1798.594) [-1786.876] (-1795.821) * (-1790.338) [-1784.430] (-1785.341) (-1795.346) -- 0:01:27
819500 -- (-1786.869) (-1786.422) [-1786.205] (-1802.094) * [-1790.845] (-1803.706) (-1791.282) (-1797.888) -- 0:01:27
820000 -- [-1791.071] (-1785.413) (-1794.554) (-1799.200) * (-1792.959) [-1784.647] (-1804.365) (-1799.729) -- 0:01:27
Average standard deviation of split frequencies: 0.004648
820500 -- (-1795.105) (-1792.907) [-1789.716] (-1788.087) * (-1801.853) [-1789.779] (-1793.774) (-1793.611) -- 0:01:27
821000 -- (-1787.496) (-1789.431) (-1789.846) [-1785.590] * (-1794.142) (-1791.364) (-1803.783) [-1788.758] -- 0:01:26
821500 -- (-1800.897) (-1794.884) [-1790.489] (-1792.752) * [-1792.359] (-1795.844) (-1791.061) (-1786.080) -- 0:01:26
822000 -- (-1791.009) (-1797.154) [-1790.749] (-1792.622) * (-1794.981) (-1787.711) (-1794.485) [-1792.819] -- 0:01:26
822500 -- (-1796.420) (-1794.707) (-1793.408) [-1793.536] * (-1789.837) (-1794.141) (-1794.118) [-1791.926] -- 0:01:26
823000 -- [-1802.314] (-1796.869) (-1790.812) (-1790.132) * (-1796.965) [-1803.917] (-1793.395) (-1785.505) -- 0:01:25
823500 -- (-1796.552) [-1787.751] (-1790.686) (-1790.807) * (-1791.931) (-1793.203) [-1789.126] (-1789.143) -- 0:01:25
824000 -- [-1792.869] (-1788.440) (-1795.369) (-1800.928) * (-1801.772) (-1792.270) (-1785.252) [-1789.693] -- 0:01:25
824500 -- [-1787.424] (-1788.584) (-1795.737) (-1809.419) * (-1789.640) (-1786.467) (-1794.311) [-1789.080] -- 0:01:25
825000 -- (-1793.543) (-1793.916) (-1790.796) [-1792.696] * (-1794.743) (-1794.817) (-1800.188) [-1792.866] -- 0:01:24
Average standard deviation of split frequencies: 0.004509
825500 -- [-1794.595] (-1786.708) (-1802.608) (-1791.141) * (-1789.061) (-1798.517) [-1786.658] (-1791.907) -- 0:01:24
826000 -- (-1796.700) (-1787.606) [-1790.332] (-1804.068) * [-1793.927] (-1793.631) (-1790.864) (-1796.640) -- 0:01:24
826500 -- [-1783.209] (-1791.296) (-1788.892) (-1796.083) * (-1791.835) [-1790.343] (-1800.304) (-1789.664) -- 0:01:24
827000 -- [-1791.194] (-1796.019) (-1783.492) (-1799.173) * (-1789.634) (-1794.089) (-1798.253) [-1795.449] -- 0:01:23
827500 -- (-1803.259) [-1788.154] (-1790.246) (-1792.454) * (-1786.809) (-1787.969) [-1798.536] (-1787.035) -- 0:01:23
828000 -- (-1805.170) [-1794.963] (-1791.420) (-1788.524) * (-1792.366) [-1789.954] (-1789.032) (-1794.942) -- 0:01:23
828500 -- [-1788.828] (-1798.498) (-1785.543) (-1794.968) * [-1790.707] (-1798.103) (-1788.566) (-1790.869) -- 0:01:23
829000 -- (-1794.468) (-1798.401) (-1789.679) [-1787.344] * (-1791.868) (-1789.431) (-1791.237) [-1795.340] -- 0:01:22
829500 -- (-1795.420) (-1790.096) [-1788.000] (-1790.829) * [-1788.887] (-1799.358) (-1798.183) (-1788.522) -- 0:01:22
830000 -- [-1798.792] (-1786.220) (-1788.473) (-1793.269) * (-1795.652) (-1792.860) [-1795.339] (-1799.657) -- 0:01:22
Average standard deviation of split frequencies: 0.004427
830500 -- [-1782.253] (-1786.814) (-1798.582) (-1788.227) * [-1793.133] (-1793.020) (-1790.783) (-1794.598) -- 0:01:22
831000 -- (-1794.600) (-1795.432) [-1786.752] (-1790.954) * (-1795.086) (-1801.331) [-1796.084] (-1796.190) -- 0:01:21
831500 -- [-1792.557] (-1794.989) (-1792.726) (-1785.635) * (-1790.189) (-1797.833) [-1791.301] (-1788.608) -- 0:01:21
832000 -- (-1792.621) (-1788.804) (-1792.835) [-1790.046] * (-1789.393) (-1796.913) [-1788.928] (-1790.129) -- 0:01:21
832500 -- (-1795.558) [-1791.862] (-1786.907) (-1802.267) * (-1792.795) (-1788.887) [-1790.243] (-1790.742) -- 0:01:21
833000 -- [-1791.822] (-1790.694) (-1790.088) (-1792.499) * (-1798.327) [-1793.956] (-1792.909) (-1791.725) -- 0:01:20
833500 -- (-1791.418) [-1795.486] (-1789.764) (-1798.833) * (-1805.108) [-1800.123] (-1798.852) (-1794.191) -- 0:01:20
834000 -- (-1792.910) (-1797.213) (-1800.996) [-1786.523] * (-1787.780) (-1799.049) (-1803.198) [-1792.142] -- 0:01:20
834500 -- (-1791.059) (-1792.487) (-1797.411) [-1791.441] * [-1791.907] (-1791.688) (-1806.508) (-1791.526) -- 0:01:20
835000 -- (-1792.900) [-1791.751] (-1795.801) (-1794.820) * (-1798.509) (-1793.387) (-1791.774) [-1786.391] -- 0:01:20
Average standard deviation of split frequencies: 0.004460
835500 -- (-1784.467) (-1798.997) [-1789.932] (-1791.358) * (-1791.138) (-1788.603) [-1787.126] (-1805.632) -- 0:01:19
836000 -- (-1789.854) (-1797.306) [-1793.147] (-1792.638) * (-1794.172) (-1788.110) [-1784.459] (-1803.965) -- 0:01:19
836500 -- (-1796.556) (-1797.186) (-1791.608) [-1790.273] * [-1788.252] (-1805.642) (-1793.436) (-1797.274) -- 0:01:19
837000 -- (-1794.658) [-1798.823] (-1796.039) (-1789.064) * (-1793.488) [-1791.762] (-1797.246) (-1795.197) -- 0:01:19
837500 -- (-1793.238) [-1789.127] (-1793.598) (-1798.650) * (-1788.857) (-1809.866) [-1782.918] (-1791.364) -- 0:01:18
838000 -- (-1787.562) (-1785.890) (-1798.473) [-1790.815] * (-1793.249) (-1789.190) (-1787.973) [-1784.168] -- 0:01:18
838500 -- (-1792.356) (-1788.028) (-1795.754) [-1791.365] * [-1791.441] (-1784.059) (-1791.453) (-1793.676) -- 0:01:18
839000 -- (-1791.280) (-1789.204) [-1790.979] (-1790.183) * [-1797.316] (-1787.554) (-1807.335) (-1798.878) -- 0:01:18
839500 -- (-1798.915) (-1789.364) (-1793.041) [-1786.917] * (-1795.143) [-1787.349] (-1789.496) (-1790.255) -- 0:01:18
840000 -- (-1796.075) (-1798.210) [-1788.771] (-1788.980) * (-1799.014) [-1789.429] (-1797.116) (-1795.824) -- 0:01:17
Average standard deviation of split frequencies: 0.004374
840500 -- (-1798.057) (-1792.400) [-1800.911] (-1797.123) * (-1798.360) [-1790.589] (-1789.857) (-1794.171) -- 0:01:17
841000 -- [-1787.970] (-1801.631) (-1796.171) (-1807.541) * (-1791.634) [-1796.605] (-1788.284) (-1797.084) -- 0:01:17
841500 -- (-1791.248) [-1789.615] (-1797.171) (-1801.269) * (-1793.056) (-1797.176) (-1797.612) [-1788.823] -- 0:01:17
842000 -- (-1792.596) (-1786.065) [-1789.615] (-1788.235) * [-1790.515] (-1797.055) (-1783.462) (-1788.351) -- 0:01:16
842500 -- [-1784.330] (-1788.608) (-1798.055) (-1796.547) * (-1798.211) (-1795.052) (-1792.556) [-1785.785] -- 0:01:16
843000 -- (-1788.062) (-1794.338) (-1795.065) [-1785.582] * (-1798.325) (-1789.060) (-1785.362) [-1789.311] -- 0:01:16
843500 -- (-1794.077) (-1785.930) [-1791.409] (-1793.333) * [-1797.493] (-1804.923) (-1790.043) (-1795.734) -- 0:01:16
844000 -- (-1797.839) (-1802.737) [-1787.244] (-1790.060) * (-1798.783) (-1789.574) (-1790.461) [-1788.126] -- 0:01:15
844500 -- (-1801.385) (-1794.964) [-1794.107] (-1787.571) * [-1790.649] (-1792.989) (-1797.131) (-1799.666) -- 0:01:15
845000 -- (-1791.260) [-1790.063] (-1808.957) (-1796.743) * (-1795.881) (-1789.514) (-1792.420) [-1788.400] -- 0:01:15
Average standard deviation of split frequencies: 0.003956
845500 -- (-1800.450) (-1799.210) [-1798.145] (-1787.845) * (-1800.152) (-1792.918) [-1789.787] (-1798.995) -- 0:01:15
846000 -- (-1797.280) [-1785.894] (-1798.494) (-1787.604) * [-1789.174] (-1796.407) (-1788.378) (-1793.010) -- 0:01:14
846500 -- (-1793.286) [-1790.010] (-1795.114) (-1800.806) * (-1795.246) [-1791.411] (-1795.074) (-1785.097) -- 0:01:14
847000 -- (-1813.959) [-1795.069] (-1803.231) (-1794.843) * [-1793.039] (-1789.264) (-1794.573) (-1795.198) -- 0:01:14
847500 -- (-1797.702) (-1788.483) [-1791.635] (-1792.730) * (-1802.002) [-1785.318] (-1790.668) (-1796.144) -- 0:01:14
848000 -- [-1788.932] (-1787.602) (-1790.994) (-1798.649) * (-1792.548) [-1791.703] (-1801.735) (-1790.263) -- 0:01:13
848500 -- (-1800.966) [-1784.960] (-1790.388) (-1789.283) * (-1792.825) (-1794.138) (-1803.466) [-1790.180] -- 0:01:13
849000 -- (-1788.562) (-1798.240) [-1787.657] (-1793.794) * (-1792.662) (-1789.208) [-1798.256] (-1797.785) -- 0:01:13
849500 -- (-1797.799) (-1801.141) [-1791.002] (-1795.885) * (-1796.860) (-1794.591) [-1787.126] (-1795.936) -- 0:01:13
850000 -- (-1795.946) (-1796.213) (-1800.514) [-1786.404] * (-1788.255) (-1790.534) (-1791.231) [-1793.703] -- 0:01:12
Average standard deviation of split frequencies: 0.004584
850500 -- (-1789.091) (-1786.385) (-1808.696) [-1784.384] * (-1792.066) (-1801.356) [-1792.634] (-1797.873) -- 0:01:12
851000 -- (-1787.813) [-1787.552] (-1787.360) (-1793.506) * [-1791.312] (-1788.300) (-1810.755) (-1791.175) -- 0:01:12
851500 -- (-1789.079) (-1792.318) [-1799.115] (-1790.591) * (-1794.152) (-1801.084) [-1791.374] (-1795.899) -- 0:01:12
852000 -- (-1787.514) (-1789.383) (-1790.259) [-1799.440] * [-1793.259] (-1791.957) (-1797.047) (-1794.101) -- 0:01:11
852500 -- (-1800.721) (-1789.052) [-1791.324] (-1795.692) * [-1794.613] (-1791.337) (-1787.263) (-1797.776) -- 0:01:11
853000 -- [-1799.298] (-1795.414) (-1793.601) (-1794.853) * (-1790.040) [-1794.994] (-1787.326) (-1794.400) -- 0:01:11
853500 -- (-1793.697) [-1793.597] (-1807.092) (-1796.369) * [-1793.377] (-1800.358) (-1787.927) (-1790.857) -- 0:01:11
854000 -- [-1787.868] (-1801.634) (-1793.935) (-1793.880) * (-1792.590) [-1807.127] (-1804.359) (-1801.400) -- 0:01:10
854500 -- (-1789.424) (-1795.285) (-1798.573) [-1797.286] * [-1789.497] (-1796.297) (-1798.774) (-1804.873) -- 0:01:10
855000 -- (-1792.594) [-1788.574] (-1795.809) (-1787.478) * [-1797.760] (-1795.940) (-1793.065) (-1799.119) -- 0:01:10
Average standard deviation of split frequencies: 0.005006
855500 -- (-1797.609) [-1808.483] (-1784.636) (-1791.317) * (-1789.937) [-1789.829] (-1798.025) (-1797.668) -- 0:01:10
856000 -- (-1797.263) [-1790.809] (-1788.338) (-1785.283) * (-1792.836) [-1787.584] (-1798.478) (-1786.317) -- 0:01:09
856500 -- [-1799.589] (-1795.372) (-1791.044) (-1792.547) * (-1800.100) (-1796.436) (-1800.703) [-1785.373] -- 0:01:09
857000 -- (-1790.307) [-1787.894] (-1797.142) (-1799.208) * (-1790.118) (-1790.656) (-1793.022) [-1795.388] -- 0:01:09
857500 -- (-1785.360) [-1800.340] (-1795.991) (-1797.255) * (-1797.630) (-1789.068) (-1790.938) [-1791.811] -- 0:01:09
858000 -- (-1792.828) (-1796.796) (-1792.649) [-1790.469] * (-1787.964) (-1797.696) [-1795.585] (-1803.963) -- 0:01:09
858500 -- [-1791.160] (-1785.031) (-1795.729) (-1791.340) * [-1784.819] (-1794.719) (-1795.040) (-1794.312) -- 0:01:08
859000 -- (-1791.274) (-1799.170) (-1793.842) [-1788.048] * (-1791.907) (-1793.202) [-1784.572] (-1796.659) -- 0:01:08
859500 -- (-1792.606) (-1790.496) [-1793.506] (-1789.268) * (-1791.729) [-1799.570] (-1791.470) (-1795.068) -- 0:01:08
860000 -- (-1790.180) [-1784.968] (-1798.513) (-1793.269) * (-1789.371) [-1797.643] (-1790.643) (-1788.706) -- 0:01:07
Average standard deviation of split frequencies: 0.004830
860500 -- (-1791.506) [-1787.990] (-1808.963) (-1792.801) * (-1794.096) [-1788.996] (-1795.923) (-1785.372) -- 0:01:07
861000 -- [-1794.541] (-1791.903) (-1794.621) (-1805.531) * (-1800.765) (-1799.234) [-1790.437] (-1801.112) -- 0:01:07
861500 -- [-1788.334] (-1800.472) (-1792.125) (-1789.202) * (-1798.902) [-1791.841] (-1790.858) (-1787.806) -- 0:01:07
862000 -- (-1798.348) (-1805.769) [-1787.375] (-1805.506) * (-1796.328) [-1790.485] (-1796.404) (-1791.433) -- 0:01:06
862500 -- [-1788.850] (-1796.421) (-1791.747) (-1787.948) * (-1799.585) (-1785.627) [-1796.919] (-1790.347) -- 0:01:06
863000 -- (-1789.735) (-1796.676) (-1792.725) [-1786.329] * (-1801.984) [-1789.433] (-1795.996) (-1789.504) -- 0:01:06
863500 -- (-1789.279) (-1793.602) [-1790.021] (-1796.689) * (-1793.005) (-1785.231) [-1795.620] (-1790.815) -- 0:01:06
864000 -- (-1794.647) [-1792.799] (-1792.380) (-1803.423) * (-1788.990) [-1798.613] (-1789.665) (-1782.771) -- 0:01:05
864500 -- [-1791.944] (-1792.065) (-1798.339) (-1790.823) * (-1794.455) [-1788.530] (-1801.717) (-1790.681) -- 0:01:05
865000 -- [-1791.874] (-1792.177) (-1785.821) (-1798.866) * (-1788.430) (-1783.853) [-1793.052] (-1804.714) -- 0:01:05
Average standard deviation of split frequencies: 0.004850
865500 -- (-1787.225) (-1802.333) [-1792.328] (-1797.342) * (-1790.354) (-1785.955) (-1791.997) [-1801.773] -- 0:01:05
866000 -- (-1785.562) (-1794.211) [-1791.949] (-1793.135) * (-1788.134) (-1800.583) (-1788.734) [-1790.212] -- 0:01:04
866500 -- (-1788.190) (-1790.033) [-1789.102] (-1791.160) * (-1792.432) (-1801.087) [-1797.952] (-1801.747) -- 0:01:04
867000 -- (-1799.277) (-1792.865) (-1794.112) [-1790.755] * (-1794.884) [-1787.387] (-1792.156) (-1792.124) -- 0:01:04
867500 -- [-1793.497] (-1798.901) (-1798.468) (-1791.355) * (-1791.673) (-1791.704) (-1795.337) [-1785.120] -- 0:01:04
868000 -- (-1791.390) (-1788.777) [-1792.503] (-1796.071) * (-1797.773) [-1795.096] (-1798.174) (-1790.305) -- 0:01:04
868500 -- (-1798.655) [-1796.511] (-1794.064) (-1792.270) * (-1791.817) [-1794.834] (-1788.341) (-1798.006) -- 0:01:03
869000 -- [-1791.734] (-1801.690) (-1795.452) (-1794.169) * (-1788.664) (-1800.596) (-1803.123) [-1790.776] -- 0:01:03
869500 -- [-1788.094] (-1799.742) (-1802.872) (-1791.775) * (-1805.624) [-1794.499] (-1791.515) (-1791.056) -- 0:01:03
870000 -- (-1791.666) [-1786.497] (-1791.455) (-1790.616) * (-1800.889) [-1790.132] (-1786.375) (-1788.821) -- 0:01:03
Average standard deviation of split frequencies: 0.005021
870500 -- (-1789.545) (-1794.041) (-1803.585) [-1786.074] * (-1792.138) (-1807.124) (-1792.138) [-1793.319] -- 0:01:02
871000 -- (-1801.427) [-1787.963] (-1788.942) (-1787.730) * (-1792.900) (-1787.577) [-1782.554] (-1801.661) -- 0:01:02
871500 -- [-1795.029] (-1794.488) (-1790.289) (-1794.933) * [-1797.274] (-1795.802) (-1799.961) (-1791.836) -- 0:01:02
872000 -- [-1789.726] (-1790.664) (-1790.948) (-1801.866) * (-1799.075) (-1786.328) [-1795.178] (-1788.105) -- 0:01:02
872500 -- (-1795.251) (-1794.961) (-1785.758) [-1792.478] * (-1798.967) [-1790.568] (-1790.634) (-1796.971) -- 0:01:01
873000 -- (-1801.722) (-1793.691) [-1786.565] (-1788.608) * (-1806.000) (-1799.273) [-1797.979] (-1789.154) -- 0:01:01
873500 -- (-1795.102) (-1792.203) [-1785.357] (-1801.586) * (-1791.995) [-1790.481] (-1808.802) (-1791.518) -- 0:01:01
874000 -- (-1798.223) (-1808.684) (-1798.216) [-1799.850] * (-1795.113) [-1791.875] (-1789.816) (-1799.619) -- 0:01:01
874500 -- [-1798.961] (-1799.503) (-1792.428) (-1799.973) * (-1792.547) (-1795.571) [-1795.149] (-1792.615) -- 0:01:00
875000 -- (-1797.143) [-1803.352] (-1786.235) (-1812.574) * [-1789.649] (-1802.447) (-1796.177) (-1809.455) -- 0:01:00
Average standard deviation of split frequencies: 0.005088
875500 -- (-1791.075) [-1797.052] (-1794.674) (-1796.175) * (-1794.238) (-1796.296) [-1795.459] (-1788.060) -- 0:01:00
876000 -- (-1794.120) (-1790.270) [-1788.257] (-1794.994) * (-1789.903) [-1791.698] (-1788.242) (-1803.158) -- 0:01:00
876500 -- (-1797.704) [-1791.404] (-1787.185) (-1791.771) * [-1792.672] (-1795.013) (-1790.240) (-1795.487) -- 0:00:59
877000 -- (-1795.264) [-1792.975] (-1801.949) (-1793.920) * (-1793.564) (-1792.546) [-1788.694] (-1788.247) -- 0:00:59
877500 -- (-1789.699) [-1786.340] (-1802.031) (-1785.036) * (-1800.779) (-1798.839) [-1793.938] (-1795.506) -- 0:00:59
878000 -- [-1790.619] (-1787.652) (-1800.477) (-1791.147) * [-1788.482] (-1796.035) (-1795.568) (-1792.850) -- 0:00:59
878500 -- (-1794.570) [-1790.899] (-1791.371) (-1803.057) * (-1790.034) (-1792.909) [-1785.261] (-1789.876) -- 0:00:58
879000 -- (-1799.459) [-1788.383] (-1800.439) (-1797.213) * [-1785.624] (-1792.396) (-1796.992) (-1797.388) -- 0:00:58
879500 -- (-1790.861) [-1789.168] (-1791.163) (-1802.332) * (-1792.937) (-1792.102) (-1799.680) [-1789.677] -- 0:00:58
880000 -- [-1784.498] (-1792.109) (-1795.986) (-1798.581) * (-1784.893) [-1790.488] (-1787.462) (-1788.207) -- 0:00:58
Average standard deviation of split frequencies: 0.005207
880500 -- [-1790.195] (-1789.466) (-1795.190) (-1792.337) * (-1794.467) (-1796.498) [-1793.309] (-1791.628) -- 0:00:57
881000 -- [-1791.502] (-1794.005) (-1788.537) (-1789.928) * [-1795.436] (-1799.804) (-1797.240) (-1787.342) -- 0:00:57
881500 -- (-1794.235) (-1794.127) [-1785.323] (-1794.560) * (-1792.294) (-1793.274) [-1792.931] (-1794.489) -- 0:00:57
882000 -- (-1794.500) [-1797.695] (-1790.620) (-1799.780) * [-1793.005] (-1793.064) (-1802.114) (-1784.580) -- 0:00:57
882500 -- (-1795.032) (-1788.365) [-1785.891] (-1796.788) * (-1788.494) [-1789.471] (-1796.206) (-1789.664) -- 0:00:56
883000 -- (-1811.383) (-1789.683) (-1794.170) [-1787.234] * (-1792.268) (-1793.085) (-1808.027) [-1793.167] -- 0:00:56
883500 -- (-1795.058) (-1787.479) (-1792.055) [-1789.169] * (-1789.906) [-1785.962] (-1805.741) (-1791.191) -- 0:00:56
884000 -- [-1790.502] (-1795.652) (-1790.782) (-1787.391) * [-1788.628] (-1795.765) (-1795.762) (-1795.717) -- 0:00:56
884500 -- (-1798.282) (-1795.921) [-1789.249] (-1790.816) * [-1787.359] (-1796.193) (-1798.993) (-1797.877) -- 0:00:56
885000 -- (-1787.983) [-1789.421] (-1799.090) (-1805.867) * [-1785.313] (-1794.316) (-1789.116) (-1796.850) -- 0:00:55
Average standard deviation of split frequencies: 0.005369
885500 -- [-1786.773] (-1792.369) (-1802.301) (-1787.231) * [-1786.987] (-1799.895) (-1788.461) (-1795.006) -- 0:00:55
886000 -- (-1786.844) (-1796.947) [-1803.751] (-1790.745) * [-1788.675] (-1788.546) (-1791.404) (-1791.944) -- 0:00:55
886500 -- [-1789.792] (-1799.173) (-1809.690) (-1800.875) * (-1785.089) (-1794.364) [-1787.484] (-1793.454) -- 0:00:55
887000 -- [-1798.922] (-1788.581) (-1791.624) (-1788.643) * (-1793.993) (-1788.827) (-1791.804) [-1791.374] -- 0:00:54
887500 -- (-1788.185) (-1789.406) (-1799.661) [-1784.607] * (-1790.806) [-1794.052] (-1804.550) (-1790.741) -- 0:00:54
888000 -- (-1799.208) (-1800.119) [-1790.521] (-1789.988) * (-1788.618) (-1800.699) [-1795.561] (-1795.839) -- 0:00:54
888500 -- (-1795.052) [-1797.624] (-1788.855) (-1799.900) * (-1791.711) (-1800.173) [-1795.579] (-1803.454) -- 0:00:54
889000 -- (-1805.751) [-1795.711] (-1795.830) (-1790.326) * (-1787.455) (-1804.411) [-1795.151] (-1796.225) -- 0:00:53
889500 -- (-1796.559) (-1797.459) [-1793.753] (-1791.716) * (-1787.576) (-1802.745) [-1788.065] (-1790.893) -- 0:00:53
890000 -- (-1790.254) (-1789.536) (-1803.821) [-1798.468] * (-1792.948) (-1800.772) [-1784.853] (-1802.073) -- 0:00:53
Average standard deviation of split frequencies: 0.005389
890500 -- [-1784.554] (-1795.949) (-1790.273) (-1792.981) * (-1793.272) (-1797.478) (-1792.935) [-1791.723] -- 0:00:53
891000 -- (-1796.236) (-1787.178) (-1794.998) [-1788.537] * (-1788.873) (-1795.615) (-1793.384) [-1794.986] -- 0:00:52
891500 -- [-1789.250] (-1807.843) (-1790.407) (-1791.077) * (-1790.208) [-1791.563] (-1796.706) (-1791.094) -- 0:00:52
892000 -- (-1790.437) [-1788.258] (-1800.002) (-1792.924) * (-1790.256) [-1790.764] (-1804.649) (-1795.867) -- 0:00:52
892500 -- (-1791.376) (-1788.605) (-1800.680) [-1794.703] * [-1799.206] (-1790.184) (-1789.335) (-1808.412) -- 0:00:52
893000 -- (-1799.136) (-1790.643) [-1791.086] (-1796.372) * (-1790.400) (-1790.494) [-1789.192] (-1795.273) -- 0:00:51
893500 -- (-1795.185) (-1797.022) (-1796.165) [-1786.455] * [-1791.310] (-1799.293) (-1795.928) (-1799.780) -- 0:00:51
894000 -- (-1792.295) (-1808.729) (-1791.308) [-1795.234] * (-1792.936) (-1802.842) (-1793.421) [-1792.679] -- 0:00:51
894500 -- (-1793.227) (-1794.750) [-1796.891] (-1786.323) * (-1798.142) [-1790.141] (-1796.313) (-1796.388) -- 0:00:51
895000 -- [-1788.292] (-1790.145) (-1790.156) (-1791.759) * [-1799.409] (-1794.082) (-1798.125) (-1808.064) -- 0:00:50
Average standard deviation of split frequencies: 0.005524
895500 -- (-1783.277) (-1798.258) [-1789.473] (-1799.021) * (-1789.273) (-1791.854) [-1784.691] (-1794.642) -- 0:00:50
896000 -- (-1795.991) (-1797.394) (-1790.545) [-1790.613] * [-1788.070] (-1798.876) (-1801.380) (-1789.990) -- 0:00:50
896500 -- (-1797.342) (-1786.117) [-1782.687] (-1790.265) * [-1796.972] (-1802.646) (-1790.236) (-1790.797) -- 0:00:50
897000 -- (-1793.212) [-1783.039] (-1787.825) (-1794.491) * (-1792.963) [-1783.561] (-1791.598) (-1801.638) -- 0:00:49
897500 -- (-1799.841) (-1796.880) [-1789.507] (-1793.329) * [-1790.808] (-1790.344) (-1787.046) (-1797.685) -- 0:00:49
898000 -- (-1797.581) (-1789.185) [-1787.107] (-1793.873) * [-1791.346] (-1790.374) (-1791.885) (-1800.297) -- 0:00:49
898500 -- (-1786.092) [-1787.473] (-1783.900) (-1800.001) * [-1787.556] (-1789.598) (-1794.165) (-1786.398) -- 0:00:49
899000 -- [-1788.916] (-1788.155) (-1796.807) (-1791.112) * [-1791.461] (-1785.469) (-1798.329) (-1790.873) -- 0:00:49
899500 -- (-1798.526) (-1793.441) (-1796.577) [-1792.471] * (-1787.244) [-1797.514] (-1799.043) (-1792.153) -- 0:00:48
900000 -- [-1794.331] (-1785.135) (-1793.501) (-1793.630) * [-1783.520] (-1787.309) (-1787.929) (-1794.295) -- 0:00:48
Average standard deviation of split frequencies: 0.005710
900500 -- (-1792.627) [-1792.543] (-1792.804) (-1787.842) * [-1789.048] (-1792.724) (-1793.424) (-1791.550) -- 0:00:48
901000 -- (-1786.816) (-1795.485) (-1791.555) [-1789.372] * [-1796.227] (-1793.225) (-1790.887) (-1798.323) -- 0:00:48
901500 -- [-1797.466] (-1797.590) (-1792.908) (-1792.833) * [-1791.197] (-1798.762) (-1795.922) (-1803.873) -- 0:00:47
902000 -- (-1796.367) (-1803.347) [-1791.671] (-1795.504) * (-1799.079) (-1794.195) (-1789.495) [-1801.249] -- 0:00:47
902500 -- [-1784.880] (-1794.646) (-1791.582) (-1794.982) * [-1791.450] (-1788.106) (-1795.106) (-1792.236) -- 0:00:47
903000 -- (-1784.373) (-1799.410) (-1793.044) [-1791.828] * [-1789.789] (-1786.607) (-1784.925) (-1789.551) -- 0:00:47
903500 -- [-1788.159] (-1792.326) (-1794.012) (-1789.655) * (-1796.113) (-1792.724) [-1793.173] (-1798.050) -- 0:00:46
904000 -- [-1787.631] (-1791.264) (-1801.521) (-1801.843) * (-1786.564) [-1790.223] (-1793.994) (-1802.845) -- 0:00:46
904500 -- (-1794.957) [-1790.102] (-1799.286) (-1802.621) * [-1795.867] (-1793.725) (-1788.598) (-1792.041) -- 0:00:46
905000 -- [-1792.627] (-1802.080) (-1807.921) (-1796.933) * [-1789.565] (-1794.625) (-1796.486) (-1793.249) -- 0:00:46
Average standard deviation of split frequencies: 0.005392
905500 -- (-1796.163) [-1792.478] (-1804.858) (-1808.613) * [-1795.138] (-1789.990) (-1796.038) (-1797.544) -- 0:00:45
906000 -- (-1793.155) [-1789.206] (-1797.938) (-1797.218) * (-1800.719) [-1785.626] (-1797.154) (-1798.045) -- 0:00:45
906500 -- (-1799.814) [-1795.034] (-1795.280) (-1811.685) * [-1787.717] (-1788.598) (-1803.800) (-1789.670) -- 0:00:45
907000 -- (-1793.307) [-1789.093] (-1801.376) (-1806.281) * [-1794.577] (-1786.486) (-1796.881) (-1795.555) -- 0:00:45
907500 -- (-1805.314) (-1790.145) (-1805.011) [-1797.758] * (-1796.359) [-1791.412] (-1806.153) (-1794.340) -- 0:00:44
908000 -- [-1787.651] (-1787.339) (-1796.131) (-1796.201) * (-1792.901) (-1792.508) (-1800.402) [-1793.557] -- 0:00:44
908500 -- (-1799.721) (-1797.428) (-1797.120) [-1795.452] * (-1796.733) (-1792.306) [-1789.362] (-1791.427) -- 0:00:44
909000 -- [-1793.831] (-1796.574) (-1794.952) (-1794.913) * (-1793.941) (-1801.657) (-1789.127) [-1787.912] -- 0:00:44
909500 -- [-1784.999] (-1788.010) (-1803.265) (-1807.362) * (-1792.921) (-1795.839) [-1788.661] (-1796.681) -- 0:00:43
910000 -- (-1796.981) [-1797.569] (-1792.318) (-1802.639) * [-1790.994] (-1789.693) (-1801.012) (-1791.311) -- 0:00:43
Average standard deviation of split frequencies: 0.005318
910500 -- [-1799.706] (-1809.958) (-1794.247) (-1798.727) * (-1798.659) (-1792.347) [-1791.758] (-1802.561) -- 0:00:43
911000 -- [-1785.927] (-1790.122) (-1797.961) (-1782.371) * (-1788.795) (-1798.231) [-1793.043] (-1794.460) -- 0:00:43
911500 -- (-1791.686) [-1789.103] (-1797.157) (-1791.315) * (-1787.611) [-1787.087] (-1790.665) (-1792.362) -- 0:00:43
912000 -- (-1792.876) (-1788.518) [-1791.685] (-1787.491) * (-1797.311) (-1784.957) [-1783.597] (-1793.096) -- 0:00:42
912500 -- (-1803.813) (-1792.540) (-1809.190) [-1790.790] * (-1795.084) (-1784.948) (-1791.390) [-1794.261] -- 0:00:42
913000 -- (-1794.688) (-1790.875) [-1787.317] (-1791.251) * (-1793.603) (-1788.205) (-1788.352) [-1791.421] -- 0:00:42
913500 -- (-1791.528) (-1810.639) [-1794.065] (-1788.048) * (-1788.977) (-1800.898) (-1799.164) [-1790.485] -- 0:00:41
914000 -- [-1791.123] (-1791.356) (-1791.458) (-1788.071) * (-1794.656) (-1790.791) (-1790.283) [-1797.276] -- 0:00:41
914500 -- (-1793.173) [-1789.981] (-1791.771) (-1788.686) * (-1794.828) (-1790.394) [-1791.896] (-1788.781) -- 0:00:41
915000 -- (-1788.678) (-1799.590) (-1795.838) [-1789.023] * (-1789.166) (-1803.265) [-1790.090] (-1790.135) -- 0:00:41
Average standard deviation of split frequencies: 0.005053
915500 -- [-1787.675] (-1799.312) (-1791.895) (-1794.658) * (-1798.164) (-1792.017) [-1796.642] (-1790.157) -- 0:00:40
916000 -- [-1789.286] (-1794.289) (-1798.240) (-1798.767) * (-1796.747) (-1787.873) [-1789.824] (-1796.156) -- 0:00:40
916500 -- (-1799.717) (-1804.644) [-1788.126] (-1790.491) * (-1790.965) (-1788.056) [-1788.837] (-1789.715) -- 0:00:40
917000 -- (-1791.183) [-1792.595] (-1792.893) (-1798.988) * (-1793.317) [-1792.162] (-1788.645) (-1791.340) -- 0:00:40
917500 -- (-1795.397) [-1796.894] (-1786.035) (-1799.062) * [-1791.800] (-1800.694) (-1794.979) (-1797.029) -- 0:00:40
918000 -- (-1788.783) [-1792.527] (-1793.408) (-1791.558) * (-1794.461) [-1785.339] (-1795.173) (-1798.514) -- 0:00:39
918500 -- (-1789.345) (-1791.613) (-1786.856) [-1792.931] * (-1792.989) (-1794.205) (-1799.693) [-1788.762] -- 0:00:39
919000 -- (-1798.516) [-1794.852] (-1790.746) (-1784.832) * (-1800.136) (-1794.051) (-1792.926) [-1787.795] -- 0:00:39
919500 -- (-1805.854) [-1795.536] (-1796.349) (-1785.504) * (-1790.219) [-1787.424] (-1801.855) (-1791.969) -- 0:00:39
920000 -- [-1795.089] (-1797.397) (-1798.964) (-1789.804) * (-1798.158) [-1793.160] (-1787.083) (-1790.276) -- 0:00:38
Average standard deviation of split frequencies: 0.004888
920500 -- (-1796.668) (-1799.058) [-1786.127] (-1790.902) * [-1796.030] (-1790.466) (-1788.953) (-1799.480) -- 0:00:38
921000 -- [-1787.505] (-1794.906) (-1790.899) (-1793.554) * (-1797.163) [-1790.945] (-1795.760) (-1797.328) -- 0:00:38
921500 -- (-1793.436) [-1797.727] (-1799.706) (-1798.999) * (-1799.759) (-1798.601) [-1794.112] (-1794.288) -- 0:00:38
922000 -- (-1793.370) (-1795.953) [-1788.327] (-1793.862) * (-1795.925) [-1789.569] (-1801.478) (-1793.467) -- 0:00:37
922500 -- [-1787.260] (-1791.573) (-1793.702) (-1795.767) * (-1791.640) [-1784.503] (-1787.693) (-1795.053) -- 0:00:37
923000 -- (-1787.658) (-1792.650) (-1790.581) [-1790.699] * (-1798.017) (-1788.355) (-1794.821) [-1790.370] -- 0:00:37
923500 -- (-1790.868) (-1794.366) (-1803.022) [-1790.016] * [-1785.103] (-1800.776) (-1789.836) (-1786.985) -- 0:00:37
924000 -- [-1787.145] (-1800.622) (-1788.512) (-1792.816) * (-1787.042) (-1791.807) (-1794.112) [-1790.555] -- 0:00:36
924500 -- (-1789.956) (-1795.483) (-1797.609) [-1785.920] * [-1789.304] (-1794.442) (-1806.174) (-1790.440) -- 0:00:36
925000 -- (-1802.592) (-1796.502) (-1785.563) [-1784.674] * (-1791.781) [-1782.319] (-1793.998) (-1785.853) -- 0:00:36
Average standard deviation of split frequencies: 0.004906
925500 -- (-1794.980) [-1787.207] (-1792.437) (-1795.916) * (-1793.664) (-1786.144) (-1799.008) [-1792.383] -- 0:00:36
926000 -- [-1787.282] (-1786.058) (-1793.198) (-1791.758) * (-1791.488) (-1790.349) (-1790.724) [-1787.722] -- 0:00:35
926500 -- (-1791.389) (-1796.248) (-1786.734) [-1791.447] * [-1790.094] (-1792.813) (-1788.224) (-1797.834) -- 0:00:35
927000 -- [-1788.372] (-1797.106) (-1788.798) (-1787.719) * [-1789.113] (-1795.541) (-1789.231) (-1802.707) -- 0:00:35
927500 -- (-1795.109) [-1787.128] (-1805.709) (-1790.150) * (-1782.992) (-1796.393) (-1800.586) [-1793.637] -- 0:00:35
928000 -- (-1800.041) (-1788.035) (-1791.049) [-1787.600] * (-1786.220) (-1794.716) (-1789.641) [-1790.017] -- 0:00:34
928500 -- (-1792.730) [-1786.017] (-1792.155) (-1794.006) * (-1792.371) [-1787.744] (-1798.627) (-1795.388) -- 0:00:34
929000 -- [-1791.531] (-1803.775) (-1785.638) (-1800.030) * [-1794.798] (-1793.933) (-1796.438) (-1791.918) -- 0:00:34
929500 -- (-1789.997) (-1796.058) (-1806.864) [-1790.102] * [-1792.423] (-1788.945) (-1801.741) (-1793.551) -- 0:00:34
930000 -- (-1786.788) (-1795.023) [-1798.821] (-1786.219) * (-1786.955) [-1790.141] (-1795.184) (-1798.452) -- 0:00:34
Average standard deviation of split frequencies: 0.004743
930500 -- (-1799.263) (-1798.321) [-1794.500] (-1799.334) * (-1804.620) (-1785.776) [-1786.287] (-1792.301) -- 0:00:33
931000 -- (-1795.234) [-1782.794] (-1788.870) (-1793.988) * (-1788.642) [-1786.650] (-1789.692) (-1799.738) -- 0:00:33
931500 -- (-1797.191) [-1791.058] (-1786.039) (-1801.750) * (-1792.204) (-1788.524) [-1795.643] (-1795.391) -- 0:00:33
932000 -- (-1786.705) (-1790.906) (-1786.724) [-1790.934] * (-1790.814) (-1801.535) [-1795.190] (-1795.280) -- 0:00:33
932500 -- (-1792.448) (-1800.792) [-1786.677] (-1796.108) * (-1789.983) (-1784.599) (-1786.264) [-1794.128] -- 0:00:32
933000 -- [-1786.746] (-1798.085) (-1795.539) (-1792.531) * (-1791.110) (-1794.736) (-1792.772) [-1788.050] -- 0:00:32
933500 -- (-1794.710) (-1792.460) (-1799.396) [-1783.627] * (-1793.670) [-1795.191] (-1783.903) (-1802.757) -- 0:00:32
934000 -- [-1798.087] (-1794.820) (-1792.129) (-1792.022) * (-1798.516) (-1790.537) [-1789.580] (-1796.656) -- 0:00:32
934500 -- (-1795.146) (-1797.308) [-1793.143] (-1790.701) * (-1797.089) [-1794.396] (-1797.260) (-1788.485) -- 0:00:31
935000 -- (-1806.508) [-1797.567] (-1787.852) (-1794.297) * (-1798.561) (-1798.760) (-1793.667) [-1787.927] -- 0:00:31
Average standard deviation of split frequencies: 0.004670
935500 -- (-1793.722) [-1786.384] (-1793.125) (-1800.156) * (-1789.264) (-1789.045) [-1791.772] (-1791.128) -- 0:00:31
936000 -- [-1788.025] (-1796.341) (-1791.448) (-1791.942) * (-1791.280) [-1787.839] (-1805.767) (-1785.895) -- 0:00:31
936500 -- (-1791.581) [-1790.275] (-1789.736) (-1797.128) * (-1791.323) [-1788.281] (-1801.116) (-1785.179) -- 0:00:30
937000 -- [-1793.435] (-1796.547) (-1791.271) (-1795.940) * [-1789.690] (-1784.945) (-1793.413) (-1789.349) -- 0:00:30
937500 -- (-1802.246) (-1804.071) [-1784.954] (-1792.374) * [-1789.498] (-1789.678) (-1794.755) (-1791.026) -- 0:00:30
938000 -- (-1798.413) [-1786.974] (-1793.293) (-1792.793) * (-1803.150) (-1797.666) (-1787.548) [-1787.538] -- 0:00:30
938500 -- (-1789.441) [-1787.081] (-1790.859) (-1793.547) * (-1794.705) (-1788.319) (-1796.543) [-1804.504] -- 0:00:29
939000 -- (-1794.774) (-1792.966) [-1794.702] (-1790.876) * (-1796.953) (-1789.675) [-1797.055] (-1793.702) -- 0:00:29
939500 -- [-1792.909] (-1787.335) (-1791.742) (-1785.807) * [-1792.493] (-1793.992) (-1796.641) (-1788.904) -- 0:00:29
940000 -- (-1785.265) (-1793.049) [-1792.183] (-1794.428) * [-1786.278] (-1791.966) (-1797.431) (-1794.002) -- 0:00:29
Average standard deviation of split frequencies: 0.004419
940500 -- [-1785.372] (-1796.715) (-1792.352) (-1792.868) * (-1792.785) (-1791.913) (-1791.611) [-1788.450] -- 0:00:28
941000 -- (-1802.810) (-1797.326) (-1786.127) [-1786.522] * [-1796.699] (-1790.558) (-1791.771) (-1794.230) -- 0:00:28
941500 -- (-1786.344) (-1798.194) (-1793.058) [-1788.030] * (-1794.283) [-1789.776] (-1792.117) (-1796.331) -- 0:00:28
942000 -- (-1787.514) (-1795.734) (-1791.354) [-1804.262] * (-1796.891) (-1791.772) [-1789.986] (-1799.835) -- 0:00:28
942500 -- [-1785.907] (-1797.102) (-1793.375) (-1792.848) * (-1794.955) [-1787.721] (-1787.990) (-1793.811) -- 0:00:27
943000 -- [-1789.377] (-1796.887) (-1800.591) (-1799.120) * (-1797.734) [-1786.128] (-1800.975) (-1802.299) -- 0:00:27
943500 -- (-1791.391) (-1791.792) [-1792.384] (-1798.975) * (-1793.994) (-1796.776) [-1791.699] (-1796.088) -- 0:00:27
944000 -- (-1793.577) [-1797.288] (-1789.779) (-1799.628) * (-1801.354) (-1797.194) (-1795.131) [-1784.678] -- 0:00:27
944500 -- (-1802.219) (-1804.254) (-1794.694) [-1792.776] * (-1799.752) (-1799.371) [-1797.861] (-1789.338) -- 0:00:26
945000 -- (-1790.367) (-1800.944) (-1789.364) [-1795.331] * (-1798.023) (-1796.349) (-1799.672) [-1799.528] -- 0:00:26
Average standard deviation of split frequencies: 0.004575
945500 -- (-1789.265) (-1790.939) (-1790.088) [-1801.343] * (-1801.879) [-1787.380] (-1783.344) (-1805.978) -- 0:00:26
946000 -- [-1788.758] (-1799.580) (-1791.421) (-1790.111) * (-1801.448) (-1785.525) (-1798.150) [-1796.801] -- 0:00:26
946500 -- [-1785.966] (-1798.425) (-1792.753) (-1795.546) * (-1801.130) (-1791.133) [-1787.593] (-1800.530) -- 0:00:26
947000 -- [-1791.734] (-1792.397) (-1793.928) (-1799.411) * (-1793.970) (-1795.120) [-1790.060] (-1798.452) -- 0:00:25
947500 -- (-1790.656) (-1798.948) (-1790.204) [-1790.755] * (-1802.862) [-1794.740] (-1788.746) (-1790.221) -- 0:00:25
948000 -- (-1792.156) [-1792.322] (-1786.968) (-1794.259) * (-1800.539) (-1793.521) [-1787.068] (-1790.919) -- 0:00:25
948500 -- (-1793.281) (-1793.637) (-1796.447) [-1788.706] * (-1787.756) [-1794.986] (-1794.733) (-1794.190) -- 0:00:25
949000 -- (-1791.921) [-1787.290] (-1800.596) (-1789.325) * (-1795.537) (-1800.310) (-1793.854) [-1797.833] -- 0:00:24
949500 -- (-1793.181) [-1796.535] (-1787.332) (-1794.900) * (-1793.616) (-1800.157) [-1786.250] (-1793.904) -- 0:00:24
950000 -- (-1792.775) [-1794.247] (-1794.888) (-1789.218) * (-1811.389) (-1797.989) (-1798.201) [-1800.455] -- 0:00:24
Average standard deviation of split frequencies: 0.004959
950500 -- (-1798.708) (-1788.463) [-1789.892] (-1791.501) * [-1795.280] (-1794.555) (-1790.344) (-1790.054) -- 0:00:24
951000 -- (-1793.647) (-1797.331) (-1802.259) [-1792.227] * (-1795.425) (-1784.913) (-1787.748) [-1793.549] -- 0:00:23
951500 -- (-1790.140) (-1792.893) [-1788.964] (-1793.655) * (-1795.193) (-1799.552) (-1792.116) [-1787.170] -- 0:00:23
952000 -- (-1799.844) [-1789.314] (-1789.359) (-1790.866) * (-1794.989) (-1806.372) (-1791.053) [-1794.662] -- 0:00:23
952500 -- (-1798.613) (-1794.555) [-1798.495] (-1794.470) * [-1788.656] (-1789.929) (-1791.161) (-1791.405) -- 0:00:23
953000 -- (-1796.817) [-1788.670] (-1794.874) (-1789.013) * (-1794.613) (-1798.824) [-1788.198] (-1794.770) -- 0:00:22
953500 -- (-1783.735) (-1787.073) [-1789.063] (-1794.410) * (-1790.975) (-1795.267) [-1797.584] (-1790.171) -- 0:00:22
954000 -- (-1788.679) (-1787.692) (-1788.814) [-1786.386] * (-1788.767) (-1796.301) (-1818.062) [-1793.094] -- 0:00:22
954500 -- (-1792.969) (-1791.367) (-1794.777) [-1800.195] * (-1793.688) (-1794.988) [-1796.385] (-1801.052) -- 0:00:22
955000 -- (-1794.632) (-1797.944) (-1799.573) [-1788.856] * (-1792.354) (-1793.564) [-1788.828] (-1789.264) -- 0:00:21
Average standard deviation of split frequencies: 0.004886
955500 -- (-1792.686) [-1797.197] (-1807.768) (-1790.989) * (-1794.268) (-1796.732) (-1792.154) [-1791.363] -- 0:00:21
956000 -- (-1795.191) [-1790.152] (-1793.869) (-1802.433) * (-1793.654) (-1791.222) (-1798.213) [-1788.514] -- 0:00:21
956500 -- (-1792.185) [-1787.438] (-1789.542) (-1792.459) * (-1793.970) (-1799.992) [-1787.990] (-1791.182) -- 0:00:21
957000 -- (-1789.968) (-1792.519) [-1789.225] (-1806.359) * (-1799.244) (-1799.233) [-1787.569] (-1799.601) -- 0:00:20
957500 -- (-1799.446) (-1789.432) [-1792.036] (-1797.539) * (-1787.859) (-1789.992) [-1797.738] (-1790.060) -- 0:00:20
958000 -- (-1789.123) [-1788.881] (-1797.923) (-1805.472) * (-1793.119) [-1790.835] (-1791.125) (-1807.269) -- 0:00:20
958500 -- (-1794.813) (-1790.616) [-1796.731] (-1805.854) * [-1789.176] (-1792.967) (-1794.227) (-1795.020) -- 0:00:20
959000 -- (-1785.386) [-1792.780] (-1796.682) (-1807.713) * [-1799.615] (-1795.767) (-1799.932) (-1798.690) -- 0:00:19
959500 -- (-1792.220) [-1792.219] (-1799.119) (-1795.503) * [-1794.107] (-1798.871) (-1785.939) (-1791.290) -- 0:00:19
960000 -- (-1790.122) (-1794.954) (-1792.419) [-1792.867] * [-1802.736] (-1800.768) (-1786.991) (-1795.911) -- 0:00:19
Average standard deviation of split frequencies: 0.004372
960500 -- (-1788.711) (-1793.498) (-1799.491) [-1789.601] * (-1798.726) [-1793.561] (-1791.930) (-1789.486) -- 0:00:19
961000 -- [-1788.522] (-1793.934) (-1789.009) (-1806.457) * [-1784.749] (-1796.315) (-1808.683) (-1792.668) -- 0:00:18
961500 -- (-1792.129) (-1795.716) [-1792.660] (-1787.358) * [-1788.366] (-1794.389) (-1797.995) (-1819.906) -- 0:00:18
962000 -- [-1786.389] (-1788.931) (-1786.793) (-1796.853) * (-1791.982) (-1798.181) (-1796.304) [-1790.798] -- 0:00:18
962500 -- (-1789.641) (-1784.630) (-1803.730) [-1788.015] * (-1791.713) (-1798.834) [-1794.043] (-1794.788) -- 0:00:18
963000 -- (-1793.083) (-1800.233) [-1785.804] (-1787.692) * [-1782.599] (-1794.113) (-1791.478) (-1794.101) -- 0:00:17
963500 -- [-1785.283] (-1799.683) (-1792.442) (-1787.771) * (-1795.842) (-1788.242) (-1796.147) [-1790.271] -- 0:00:17
964000 -- (-1792.079) [-1791.343] (-1788.466) (-1795.941) * (-1788.352) (-1793.534) [-1787.229] (-1800.696) -- 0:00:17
964500 -- (-1795.366) [-1785.983] (-1791.742) (-1790.313) * (-1789.972) (-1799.580) [-1790.434] (-1795.087) -- 0:00:17
965000 -- (-1795.496) [-1788.568] (-1793.532) (-1798.777) * (-1792.605) (-1795.874) (-1791.790) [-1790.957] -- 0:00:16
Average standard deviation of split frequencies: 0.004685
965500 -- (-1794.867) (-1797.621) (-1794.504) [-1789.907] * [-1792.373] (-1794.241) (-1793.353) (-1792.805) -- 0:00:16
966000 -- (-1793.176) (-1792.293) [-1787.436] (-1792.086) * (-1791.177) [-1787.297] (-1802.039) (-1794.463) -- 0:00:16
966500 -- (-1787.625) (-1789.579) (-1792.100) [-1786.981] * (-1804.007) [-1790.452] (-1798.093) (-1791.854) -- 0:00:16
967000 -- (-1791.668) (-1790.933) (-1790.584) [-1786.530] * (-1790.715) [-1797.779] (-1798.520) (-1785.212) -- 0:00:16
967500 -- (-1792.803) [-1794.744] (-1800.211) (-1800.253) * (-1786.383) [-1791.407] (-1794.347) (-1788.274) -- 0:00:15
968000 -- (-1795.649) (-1796.545) (-1795.908) [-1790.294] * (-1795.911) [-1788.780] (-1792.222) (-1796.268) -- 0:00:15
968500 -- (-1799.753) [-1788.562] (-1793.945) (-1793.891) * (-1793.758) [-1788.580] (-1792.013) (-1809.599) -- 0:00:15
969000 -- [-1786.429] (-1793.971) (-1792.790) (-1792.472) * (-1792.169) [-1788.319] (-1790.345) (-1795.224) -- 0:00:15
969500 -- (-1796.016) [-1785.490] (-1802.345) (-1792.328) * (-1791.455) (-1791.421) [-1788.470] (-1794.549) -- 0:00:14
970000 -- (-1795.865) [-1792.031] (-1795.821) (-1794.967) * [-1787.541] (-1798.395) (-1789.213) (-1793.475) -- 0:00:14
Average standard deviation of split frequencies: 0.004759
970500 -- (-1789.739) [-1800.762] (-1793.652) (-1794.460) * [-1787.604] (-1791.789) (-1793.305) (-1794.035) -- 0:00:14
971000 -- (-1790.737) (-1794.663) (-1800.465) [-1792.192] * (-1789.082) (-1789.607) [-1790.045] (-1796.271) -- 0:00:14
971500 -- (-1791.554) (-1795.001) [-1789.471] (-1796.762) * [-1795.029] (-1792.457) (-1794.291) (-1803.864) -- 0:00:13
972000 -- (-1796.745) (-1807.911) [-1799.341] (-1800.450) * (-1788.926) (-1801.028) [-1796.299] (-1797.408) -- 0:00:13
972500 -- (-1803.130) [-1812.360] (-1794.288) (-1798.015) * (-1788.077) (-1791.674) (-1787.999) [-1788.459] -- 0:00:13
973000 -- [-1791.600] (-1796.830) (-1792.669) (-1789.622) * (-1786.925) (-1793.676) [-1785.415] (-1794.533) -- 0:00:13
973500 -- (-1794.217) (-1793.949) [-1784.852] (-1790.661) * (-1803.358) (-1791.804) (-1798.088) [-1790.808] -- 0:00:12
974000 -- [-1795.558] (-1790.007) (-1793.072) (-1791.340) * (-1801.659) (-1790.345) (-1796.860) [-1792.575] -- 0:00:12
974500 -- (-1798.481) (-1796.755) (-1795.306) [-1791.610] * (-1803.868) (-1789.520) (-1789.803) [-1789.627] -- 0:00:12
975000 -- [-1787.643] (-1791.538) (-1788.174) (-1795.514) * (-1798.232) (-1797.167) [-1790.700] (-1801.557) -- 0:00:12
Average standard deviation of split frequencies: 0.004685
975500 -- (-1785.722) [-1785.465] (-1790.044) (-1812.567) * (-1798.822) (-1800.069) (-1793.265) [-1792.121] -- 0:00:11
976000 -- (-1796.112) (-1793.874) [-1790.962] (-1800.533) * (-1786.906) (-1788.174) (-1793.028) [-1791.227] -- 0:00:11
976500 -- (-1798.986) [-1787.091] (-1786.966) (-1797.666) * (-1793.509) (-1793.479) (-1801.264) [-1791.513] -- 0:00:11
977000 -- (-1798.849) (-1793.661) [-1786.126] (-1793.315) * (-1794.982) (-1799.033) (-1796.061) [-1787.445] -- 0:00:11
977500 -- (-1793.940) (-1793.073) (-1795.117) [-1795.671] * (-1806.533) [-1795.416] (-1793.047) (-1790.515) -- 0:00:10
978000 -- (-1798.259) [-1789.889] (-1800.933) (-1805.703) * (-1793.910) (-1793.369) (-1797.005) [-1789.946] -- 0:00:10
978500 -- (-1793.161) [-1790.839] (-1800.815) (-1812.938) * (-1792.994) (-1790.662) (-1790.538) [-1791.816] -- 0:00:10
979000 -- (-1796.640) (-1799.148) [-1791.803] (-1800.039) * (-1789.698) (-1794.920) (-1796.256) [-1794.177] -- 0:00:10
979500 -- (-1796.168) (-1796.894) (-1795.606) [-1787.044] * (-1803.054) [-1789.029] (-1796.468) (-1798.283) -- 0:00:09
980000 -- [-1787.846] (-1795.077) (-1786.266) (-1795.561) * (-1796.560) [-1791.470] (-1789.007) (-1789.637) -- 0:00:09
Average standard deviation of split frequencies: 0.004759
980500 -- (-1795.505) (-1802.596) (-1803.448) [-1785.526] * [-1789.785] (-1792.647) (-1790.770) (-1796.147) -- 0:00:09
981000 -- (-1791.806) (-1796.796) [-1796.213] (-1801.076) * (-1786.254) (-1792.063) [-1793.120] (-1796.265) -- 0:00:09
981500 -- (-1796.700) (-1807.326) (-1802.581) [-1790.618] * [-1788.933] (-1789.138) (-1801.532) (-1798.285) -- 0:00:08
982000 -- (-1792.299) (-1797.238) (-1799.556) [-1787.881] * (-1790.450) (-1798.618) [-1797.032] (-1806.718) -- 0:00:08
982500 -- (-1797.598) (-1801.808) (-1801.044) [-1793.442] * (-1790.555) [-1785.970] (-1813.523) (-1791.164) -- 0:00:08
983000 -- (-1788.953) (-1792.994) [-1793.568] (-1789.014) * (-1790.877) (-1786.342) (-1798.429) [-1792.402] -- 0:00:08
983500 -- (-1799.541) [-1796.118] (-1796.716) (-1786.975) * (-1785.640) [-1783.636] (-1800.357) (-1787.476) -- 0:00:08
984000 -- [-1788.812] (-1786.173) (-1795.609) (-1793.489) * (-1786.002) [-1791.184] (-1792.027) (-1791.296) -- 0:00:07
984500 -- (-1798.541) [-1785.927] (-1794.398) (-1791.561) * (-1799.964) (-1789.154) [-1784.947] (-1792.894) -- 0:00:07
985000 -- (-1802.786) (-1795.902) (-1802.421) [-1795.058] * (-1805.716) (-1797.856) [-1789.471] (-1793.961) -- 0:00:07
Average standard deviation of split frequencies: 0.003868
985500 -- (-1795.554) (-1797.196) [-1794.416] (-1791.579) * (-1794.213) (-1795.140) [-1785.319] (-1796.952) -- 0:00:07
986000 -- (-1791.126) (-1798.493) (-1797.524) [-1791.672] * (-1798.915) (-1801.555) (-1788.149) [-1794.347] -- 0:00:06
986500 -- (-1788.149) (-1803.358) [-1789.860] (-1791.063) * (-1794.833) (-1795.000) [-1788.225] (-1789.335) -- 0:00:06
987000 -- (-1791.089) [-1790.756] (-1789.829) (-1790.052) * [-1789.100] (-1791.978) (-1794.958) (-1787.437) -- 0:00:06
987500 -- (-1796.597) (-1794.877) (-1796.339) [-1789.806] * (-1794.445) (-1789.243) (-1790.903) [-1788.604] -- 0:00:06
988000 -- (-1796.362) (-1794.165) [-1789.121] (-1809.516) * [-1790.329] (-1790.334) (-1783.147) (-1793.085) -- 0:00:05
988500 -- [-1787.591] (-1789.509) (-1802.211) (-1789.062) * (-1794.365) (-1786.420) (-1786.531) [-1791.657] -- 0:00:05
989000 -- (-1792.491) [-1793.066] (-1790.959) (-1790.032) * (-1796.275) (-1801.949) [-1789.612] (-1792.201) -- 0:00:05
989500 -- (-1815.916) (-1790.187) (-1785.037) [-1788.084] * [-1795.157] (-1787.439) (-1788.404) (-1806.959) -- 0:00:05
990000 -- [-1791.979] (-1794.521) (-1791.018) (-1785.191) * [-1798.182] (-1782.482) (-1803.149) (-1788.634) -- 0:00:04
Average standard deviation of split frequencies: 0.003893
990500 -- (-1795.782) (-1792.906) (-1801.843) [-1794.366] * (-1804.915) (-1790.753) (-1791.156) [-1788.401] -- 0:00:04
991000 -- (-1792.562) [-1788.528] (-1802.770) (-1790.042) * (-1797.489) [-1790.530] (-1785.214) (-1791.806) -- 0:00:04
991500 -- (-1788.169) [-1784.938] (-1801.183) (-1794.411) * (-1794.844) (-1795.636) [-1789.119] (-1796.044) -- 0:00:04
992000 -- (-1797.171) (-1786.229) [-1787.057] (-1800.207) * (-1805.176) (-1794.991) [-1792.947] (-1790.653) -- 0:00:03
992500 -- (-1787.550) (-1799.472) (-1790.747) [-1805.768] * (-1800.375) (-1791.022) (-1795.567) [-1789.807] -- 0:00:03
993000 -- [-1793.819] (-1798.996) (-1786.392) (-1787.866) * (-1801.140) (-1799.030) (-1794.781) [-1796.933] -- 0:00:03
993500 -- (-1789.929) (-1798.532) [-1786.697] (-1798.303) * (-1794.104) (-1800.731) (-1793.931) [-1796.202] -- 0:00:03
994000 -- (-1788.761) (-1803.883) (-1797.265) [-1795.151] * (-1789.679) (-1796.129) (-1796.059) [-1788.329] -- 0:00:02
994500 -- (-1789.778) (-1794.213) (-1788.794) [-1791.105] * (-1791.193) (-1794.090) (-1796.202) [-1789.128] -- 0:00:02
995000 -- (-1800.420) [-1791.052] (-1786.592) (-1789.158) * (-1791.361) (-1796.405) [-1792.616] (-1791.777) -- 0:00:02
Average standard deviation of split frequencies: 0.003743
995500 -- (-1790.142) (-1786.939) [-1791.393] (-1787.970) * (-1799.087) (-1791.518) (-1792.425) [-1791.433] -- 0:00:02
996000 -- [-1786.872] (-1793.932) (-1797.992) (-1792.121) * (-1801.068) [-1797.391] (-1801.220) (-1801.538) -- 0:00:01
996500 -- (-1794.837) (-1795.596) (-1793.898) [-1790.531] * (-1799.790) (-1792.877) (-1791.824) [-1794.094] -- 0:00:01
997000 -- (-1793.769) (-1801.544) [-1789.145] (-1792.170) * (-1801.282) (-1788.006) [-1790.426] (-1794.301) -- 0:00:01
997500 -- (-1797.467) (-1797.701) (-1796.496) [-1789.710] * (-1795.876) [-1787.822] (-1791.356) (-1793.784) -- 0:00:01
998000 -- (-1786.976) (-1798.759) (-1786.232) [-1785.677] * (-1795.081) (-1792.750) (-1784.053) [-1794.088] -- 0:00:00
998500 -- (-1800.999) (-1787.439) (-1779.838) [-1783.349] * (-1795.974) (-1792.757) [-1791.242] (-1797.459) -- 0:00:00
999000 -- (-1793.567) (-1788.313) [-1788.174] (-1805.844) * [-1789.720] (-1788.942) (-1793.284) (-1798.729) -- 0:00:00
999500 -- (-1791.590) (-1795.359) [-1787.556] (-1796.301) * (-1797.115) (-1795.914) [-1789.036] (-1788.047) -- 0:00:00
1000000 -- [-1794.342] (-1794.676) (-1798.785) (-1789.357) * (-1804.557) (-1788.510) [-1791.589] (-1792.479) -- 0:00:00
Average standard deviation of split frequencies: 0.003910
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1794.342239 -- 26.628554
Chain 1 -- -1794.342236 -- 26.628554
Chain 2 -- -1794.676347 -- 23.784801
Chain 2 -- -1794.676346 -- 23.784801
Chain 3 -- -1798.785026 -- 23.351317
Chain 3 -- -1798.785015 -- 23.351317
Chain 4 -- -1789.357147 -- 24.515919
Chain 4 -- -1789.357142 -- 24.515919
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1804.556977 -- 22.683641
Chain 1 -- -1804.556970 -- 22.683641
Chain 2 -- -1788.509659 -- 23.403382
Chain 2 -- -1788.509659 -- 23.403382
Chain 3 -- -1791.589264 -- 24.939562
Chain 3 -- -1791.589288 -- 24.939562
Chain 4 -- -1792.479449 -- 25.352219
Chain 4 -- -1792.479456 -- 25.352219
Analysis completed in 8 mins 6 seconds
Analysis used 485.27 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1779.16
Likelihood of best state for "cold" chain of run 2 was -1779.10
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.8 % ( 31 %) Dirichlet(Revmat{all})
64.0 % ( 57 %) Slider(Revmat{all})
27.1 % ( 21 %) Dirichlet(Pi{all})
29.1 % ( 30 %) Slider(Pi{all})
39.7 % ( 37 %) Multiplier(Alpha{1,2})
48.3 % ( 29 %) Multiplier(Alpha{3})
57.7 % ( 31 %) Slider(Pinvar{all})
9.9 % ( 20 %) ExtSPR(Tau{all},V{all})
3.5 % ( 5 %) ExtTBR(Tau{all},V{all})
13.8 % ( 9 %) NNI(Tau{all},V{all})
15.3 % ( 16 %) ParsSPR(Tau{all},V{all})
26.6 % ( 31 %) Multiplier(V{all})
34.6 % ( 36 %) Nodeslider(V{all})
25.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
50.6 % ( 48 %) Dirichlet(Revmat{all})
63.9 % ( 47 %) Slider(Revmat{all})
27.0 % ( 24 %) Dirichlet(Pi{all})
28.6 % ( 22 %) Slider(Pi{all})
40.0 % ( 19 %) Multiplier(Alpha{1,2})
47.9 % ( 34 %) Multiplier(Alpha{3})
57.3 % ( 28 %) Slider(Pinvar{all})
10.2 % ( 7 %) ExtSPR(Tau{all},V{all})
3.5 % ( 2 %) ExtTBR(Tau{all},V{all})
14.0 % ( 18 %) NNI(Tau{all},V{all})
15.2 % ( 12 %) ParsSPR(Tau{all},V{all})
26.6 % ( 28 %) Multiplier(V{all})
34.6 % ( 36 %) Nodeslider(V{all})
25.4 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.76 0.56 0.41
2 | 166701 0.78 0.59
3 | 166658 167200 0.80
4 | 166853 166066 166522
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.76 0.56 0.40
2 | 166925 0.78 0.59
3 | 166294 167016 0.79
4 | 166458 167064 166243
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1789.27
| 1 2 1 1 |
| 1 2 1 |
| 12 2 1 1 1 2 2 |
| 2 22 1 1 1 1 * 1 2 1|
| 1 2 2 12 1 1 1 * 2 * |
| 1 2 2 1 2 2 21 * |
| 1 1 1 1 2 21 211 11 2 1 |
| 1 11 2 2 2 22 2 1 1 1 12 11 11 |
| 22 2 1 2 12 2 2 2 2 |
| 1 2 1 2 1 2 2|
|1 21 2 1 1 2 |
|22 2 1 1 |
| 1 2 2 2 2 |
| 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1793.12
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1785.88 -1805.10
2 -1786.22 -1800.54
--------------------------------------
TOTAL -1786.04 -1804.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.530088 0.004835 0.403199 0.667286 0.524719 1367.97 1434.48 1.000
r(A<->C){all} 0.109125 0.000744 0.060501 0.165976 0.107008 907.22 928.42 1.000
r(A<->G){all} 0.298140 0.002371 0.202032 0.391325 0.295551 672.20 865.96 1.000
r(A<->T){all} 0.149480 0.001422 0.084352 0.231199 0.147057 813.86 887.90 1.001
r(C<->G){all} 0.041833 0.000257 0.013233 0.073625 0.040456 1011.97 1127.27 1.000
r(C<->T){all} 0.315283 0.002761 0.217455 0.419486 0.314308 785.07 788.13 1.000
r(G<->T){all} 0.086139 0.000715 0.037154 0.139213 0.083836 782.68 868.13 1.000
pi(A){all} 0.245665 0.000261 0.215420 0.278346 0.245287 1261.20 1314.32 1.000
pi(C){all} 0.268605 0.000270 0.236705 0.300437 0.268575 1244.16 1291.45 1.000
pi(G){all} 0.323025 0.000312 0.289214 0.356867 0.323014 1122.66 1162.57 1.000
pi(T){all} 0.162705 0.000187 0.136799 0.188804 0.162380 1166.64 1182.10 1.000
alpha{1,2} 0.283340 0.016542 0.069697 0.538693 0.262590 982.88 1061.26 1.000
alpha{3} 1.512922 0.641747 0.297740 3.105311 1.363477 947.97 1029.31 1.000
pinvar{all} 0.374348 0.017496 0.079813 0.580735 0.400021 625.82 713.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....*****
12 -- ...*******
13 -- .**.......
14 -- ........**
15 -- ...*.*****
16 -- .....***..
17 -- .....*.*..
18 -- .....**...
19 -- ......*.**
20 -- ......**..
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3002 1.000000 0.000000 1.000000 1.000000 2
15 2756 0.918055 0.009422 0.911392 0.924717 2
16 2225 0.741173 0.008009 0.735510 0.746835 2
17 1241 0.413391 0.000471 0.413058 0.413724 2
18 988 0.329114 0.003769 0.326449 0.331779 2
19 505 0.168221 0.006124 0.163891 0.172552 2
20 440 0.146569 0.011306 0.138574 0.154564 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.011941 0.000035 0.002179 0.023280 0.011076 1.002 2
length{all}[2] 0.002023 0.000004 0.000000 0.005866 0.001468 1.000 2
length{all}[3] 0.001981 0.000004 0.000001 0.005867 0.001441 1.000 2
length{all}[4] 0.020543 0.000076 0.005688 0.037477 0.019217 1.000 2
length{all}[5] 0.032954 0.000116 0.014309 0.053966 0.031786 1.000 2
length{all}[6] 0.035702 0.000143 0.015411 0.059928 0.034265 1.000 2
length{all}[7] 0.084881 0.000445 0.046352 0.125779 0.082663 1.000 2
length{all}[8] 0.072812 0.000322 0.040335 0.106685 0.070995 1.000 2
length{all}[9] 0.029393 0.000127 0.009088 0.051874 0.028058 1.000 2
length{all}[10] 0.025431 0.000112 0.005847 0.045131 0.024245 1.000 2
length{all}[11] 0.043975 0.000264 0.015729 0.077956 0.042497 1.000 2
length{all}[12] 0.029908 0.000103 0.012033 0.049773 0.028736 1.000 2
length{all}[13] 0.018278 0.000054 0.005672 0.032813 0.017238 1.000 2
length{all}[14] 0.078395 0.000470 0.040219 0.121670 0.075554 1.000 2
length{all}[15] 0.015145 0.000083 0.000004 0.032541 0.013635 1.001 2
length{all}[16] 0.022161 0.000157 0.000683 0.044479 0.020400 1.000 2
length{all}[17] 0.009822 0.000064 0.000014 0.024990 0.007887 1.000 2
length{all}[18] 0.008273 0.000043 0.000003 0.021013 0.006731 1.003 2
length{all}[19] 0.012224 0.000083 0.000037 0.028193 0.010296 1.004 2
length{all}[20] 0.005347 0.000024 0.000008 0.014782 0.004094 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003910
Maximum standard deviation of split frequencies = 0.011306
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /-------------- C2 (2)
|--------------------------100--------------------------+
| \-------------- C3 (3)
|
| /------------------------------------------ C4 (4)
+ |
| | /-------------- C6 (6)
| | |
| /------92-----+ /------74-----+-------------- C7 (7)
| | | | |
| | | | \-------------- C8 (8)
| | \-----100-----+
\-----100-----+ | /-------------- C9 (9)
| \-----100-----+
| \-------------- C10 (10)
|
\-------------------------------------------------------- C5 (5)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
| / C2 (2)
|------+
| \ C3 (3)
|
| /------- C4 (4)
+ |
| | /------------- C6 (6)
| | |
| /----+ /-------+------------------------------- C7 (7)
| | | | |
| | | | \--------------------------- C8 (8)
| | \---------------+
\----------+ | /---------- C9 (9)
| \----------------------------+
| \--------- C10 (10)
|
\------------ C5 (5)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (35 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 10 trees
95 % credible set contains 14 trees
99 % credible set contains 24 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 654
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
78 ambiguity characters in seq. 1
63 ambiguity characters in seq. 2
63 ambiguity characters in seq. 3
63 ambiguity characters in seq. 4
81 ambiguity characters in seq. 5
72 ambiguity characters in seq. 6
69 ambiguity characters in seq. 7
84 ambiguity characters in seq. 8
102 ambiguity characters in seq. 9
93 ambiguity characters in seq. 10
44 sites are removed. 108 112 113 114 115 116 125 126 127 132 133 134 135 136 137 138 171 178 179 180 181 182 183 184 185 186 187 188 189 190 191 206 207 208 209 210 211 212 213 214 215 216 217 218
Sequences read..
Counting site patterns.. 0:00
104 patterns at 174 / 174 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
101504 bytes for conP
14144 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
355264 bytes for conP, adjusted
0.025465 0.040370 0.000001 0.000000 0.045207 0.007996 0.038656 0.047415 0.011016 0.067583 0.130853 0.115443 0.107663 0.046075 0.031913 0.052879 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -1534.313993
Iterating by ming2
Initial: fx= 1534.313993
x= 0.02546 0.04037 0.00000 0.00000 0.04521 0.00800 0.03866 0.04742 0.01102 0.06758 0.13085 0.11544 0.10766 0.04607 0.03191 0.05288 0.30000 1.30000
1 h-m-p 0.0000 0.0000 334.9029 ++ 1534.313470 m 0.0000 23 | 2/18
2 h-m-p 0.0000 0.0002 148.9132 ++YCYCCC 1533.095552 5 0.0001 54 | 2/18
3 h-m-p 0.0000 0.0002 668.2076 +YYCCC 1530.111847 4 0.0001 82 | 2/18
4 h-m-p 0.0002 0.0010 307.4709 +CCCC 1523.446291 3 0.0006 110 | 2/18
5 h-m-p 0.0004 0.0020 253.7733 CCCC 1518.578595 3 0.0007 137 | 2/18
6 h-m-p 0.0002 0.0009 254.3690 YCYCCC 1514.714495 5 0.0004 166 | 2/18
7 h-m-p 0.0004 0.0022 157.1014 CCCCC 1512.289022 4 0.0006 195 | 2/18
8 h-m-p 0.0004 0.0022 32.8393 YC 1512.193867 1 0.0002 217 | 2/18
9 h-m-p 0.0020 0.0473 3.7851 CC 1512.190055 1 0.0004 240 | 2/18
10 h-m-p 0.0005 0.0334 3.3392 CC 1512.184768 1 0.0007 263 | 2/18
11 h-m-p 0.0015 0.0451 1.6213 CC 1512.174138 1 0.0016 286 | 2/18
12 h-m-p 0.0011 0.0760 2.2734 +YC 1511.811201 1 0.0105 309 | 2/18
13 h-m-p 0.0004 0.0038 57.7617 +CCYC 1509.993347 3 0.0016 336 | 2/18
14 h-m-p 0.0001 0.0005 121.5177 +YCYCC 1509.293158 4 0.0003 364 | 2/18
15 h-m-p 0.0008 0.0080 42.4977 CYC 1509.158101 2 0.0003 388 | 2/18
16 h-m-p 0.0008 0.0082 14.5469 YC 1509.107904 1 0.0006 410 | 2/18
17 h-m-p 0.0032 0.0387 2.6113 YC 1509.105189 1 0.0005 432 | 2/18
18 h-m-p 0.0054 2.1983 0.2562 +++CCC 1507.638181 2 0.4908 460 | 2/18
19 h-m-p 1.1271 8.0000 0.1116 YCCC 1506.664412 3 1.7704 502 | 2/18
20 h-m-p 1.6000 8.0000 0.0353 CCCC 1505.920755 3 2.7339 545 | 2/18
21 h-m-p 1.6000 8.0000 0.0175 +CCC 1504.229328 2 5.8977 587 | 2/18
22 h-m-p 1.3821 8.0000 0.0747 ++ 1483.988941 m 8.0000 624 | 2/18
23 h-m-p 0.0000 0.0000 23881.3766 ++ 1470.458152 m 0.0000 661 | 2/18
24 h-m-p 0.0000 0.0000 12.2013
h-m-p: 2.29903622e-18 1.14951811e-17 1.22012994e+01 1470.458152
.. | 2/18
25 h-m-p 0.0000 0.0005 2376.9446 CYYYYC 1466.725165 5 0.0000 706 | 2/18
26 h-m-p 0.0001 0.0005 171.6291 +CYCCC 1460.907345 4 0.0003 735 | 2/18
27 h-m-p 0.0003 0.0014 133.1947 CCC 1459.480000 2 0.0003 760 | 2/18
28 h-m-p 0.0002 0.0014 155.1991 YCCCC 1456.913235 4 0.0005 788 | 2/18
29 h-m-p 0.0003 0.0022 229.7157 +YYCCC 1448.979858 4 0.0011 816 | 2/18
30 h-m-p 0.0003 0.0013 701.7539 +YYYYCCC 1413.129977 6 0.0010 846 | 2/18
31 h-m-p 0.0001 0.0003 679.0904 YCCCCC 1411.699779 5 0.0001 876 | 2/18
32 h-m-p 0.0007 0.0033 29.8954 CCC 1411.414980 2 0.0008 901 | 2/18
33 h-m-p 0.0004 0.0096 62.5353 ++YYCCC 1407.774896 4 0.0050 930 | 2/18
34 h-m-p 0.0001 0.0007 1470.7978 YCCC 1403.438112 3 0.0003 956 | 2/18
35 h-m-p 0.0003 0.0017 385.6101 CCC 1401.848146 2 0.0004 981 | 2/18
36 h-m-p 0.0015 0.0076 42.5964 YCC 1401.603431 2 0.0007 1005 | 2/18
37 h-m-p 0.0018 0.0113 16.6818 CC 1401.548258 1 0.0006 1028 | 2/18
38 h-m-p 0.0114 0.1894 0.9024 YCC 1401.507405 2 0.0070 1052 | 2/18
39 h-m-p 0.0011 0.0691 5.5730 ++YCCCC 1397.802789 4 0.0393 1098 | 2/18
40 h-m-p 0.0005 0.0026 74.1948 YYC 1397.345574 2 0.0004 1121 | 2/18
41 h-m-p 0.0025 0.0124 6.8131 YC 1397.336442 1 0.0004 1143 | 2/18
42 h-m-p 0.0143 4.6539 0.1879 +++CCCC 1396.218284 3 1.4056 1173 | 2/18
43 h-m-p 1.6000 8.0000 0.0992 YC 1396.028002 1 1.1038 1211 | 2/18
44 h-m-p 1.6000 8.0000 0.0340 YC 1396.007916 1 1.0586 1249 | 2/18
45 h-m-p 1.6000 8.0000 0.0056 CC 1396.001451 1 1.4952 1288 | 2/18
46 h-m-p 1.6000 8.0000 0.0030 YC 1395.999792 1 1.1794 1326 | 2/18
47 h-m-p 1.6000 8.0000 0.0015 CC 1395.999371 1 2.2469 1365 | 2/18
48 h-m-p 1.6000 8.0000 0.0006 +YC 1395.998425 1 4.2797 1404 | 2/18
49 h-m-p 1.6000 8.0000 0.0010 YC 1395.998152 1 1.2477 1442 | 2/18
50 h-m-p 0.9120 8.0000 0.0013 YC 1395.998049 1 1.5350 1480 | 2/18
51 h-m-p 1.6000 8.0000 0.0006 C 1395.998042 0 1.2861 1517 | 2/18
52 h-m-p 1.6000 8.0000 0.0001 C 1395.998041 0 1.3812 1554 | 2/18
53 h-m-p 1.6000 8.0000 0.0000 Y 1395.998041 0 1.1981 1591 | 2/18
54 h-m-p 1.6000 8.0000 0.0000 Y 1395.998041 0 1.1785 1628 | 2/18
55 h-m-p 1.6000 8.0000 0.0000 Y 1395.998041 0 1.6000 1665 | 2/18
56 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/18
57 h-m-p 0.0160 8.0000 0.0008 ------------- | 2/18
58 h-m-p 0.0160 8.0000 0.0008 -------------
Out..
lnL = -1395.998041
1813 lfun, 1813 eigenQcodon, 29008 P(t)
Time used: 0:09
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
0.025466 0.040370 0.000001 0.000000 0.045207 0.007995 0.038655 0.047415 0.011015 0.067584 0.130854 0.115444 0.107664 0.046075 0.031914 0.052878 2.448223 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.341983
np = 19
lnL0 = -1385.567666
Iterating by ming2
Initial: fx= 1385.567666
x= 0.02547 0.04037 0.00000 0.00000 0.04521 0.00800 0.03866 0.04741 0.01101 0.06758 0.13085 0.11544 0.10766 0.04607 0.03191 0.05288 2.44822 0.81675 0.13654
1 h-m-p 0.0000 0.0000 194.1840 ++ 1385.567205 m 0.0000 43 | 2/19
2 h-m-p 0.0000 0.0001 371.5019 ++ 1382.373686 m 0.0001 84 | 2/19
3 h-m-p 0.0000 0.0002 362.3785 +YCCC 1378.674798 3 0.0002 129 | 2/19
4 h-m-p 0.0001 0.0005 152.9268 CCCC 1377.982586 3 0.0001 174 | 2/19
5 h-m-p 0.0004 0.0022 24.0983 YCCC 1377.907666 3 0.0003 218 | 2/19
6 h-m-p 0.0009 0.0184 7.3445 YC 1377.889565 1 0.0007 258 | 2/19
7 h-m-p 0.0011 0.0368 4.4029 YC 1377.882554 1 0.0007 298 | 2/19
8 h-m-p 0.0007 0.0133 4.7938 YC 1377.877990 1 0.0005 338 | 2/19
9 h-m-p 0.0006 0.0492 3.9719 YC 1377.866229 1 0.0013 378 | 2/19
10 h-m-p 0.0010 0.0138 5.0531 YC 1377.857953 1 0.0006 418 | 2/19
11 h-m-p 0.0006 0.0340 5.3640 +CC 1377.800491 1 0.0027 460 | 2/19
12 h-m-p 0.0004 0.0413 39.8145 +YCCC 1377.333887 3 0.0029 505 | 2/19
13 h-m-p 0.0010 0.0112 114.6195 YCCC 1377.009807 3 0.0007 549 | 2/19
14 h-m-p 0.0038 0.0200 21.0708 CC 1376.928127 1 0.0011 590 | 2/19
15 h-m-p 0.0051 0.0257 3.2767 -YC 1376.924843 1 0.0006 631 | 2/19
16 h-m-p 0.0025 1.0026 0.7931 ++YC 1376.908990 1 0.0305 673 | 2/19
17 h-m-p 0.0006 0.0395 38.6979 +YC 1376.859037 1 0.0020 714 | 2/19
18 h-m-p 0.0015 0.0593 50.0794 CCC 1376.800804 2 0.0018 757 | 2/19
19 h-m-p 1.6000 8.0000 0.0447 CCC 1376.618938 2 1.4676 800 | 2/19
20 h-m-p 1.6000 8.0000 0.0053 YC 1376.577050 1 1.0889 840 | 2/19
21 h-m-p 0.8371 8.0000 0.0070 CC 1376.567826 1 1.1863 881 | 2/19
22 h-m-p 1.6000 8.0000 0.0009 C 1376.565879 0 1.5958 920 | 2/19
23 h-m-p 1.6000 8.0000 0.0004 CC 1376.565182 1 2.0088 961 | 2/19
24 h-m-p 1.6000 8.0000 0.0004 Y 1376.565132 0 1.0931 1000 | 2/19
25 h-m-p 1.6000 8.0000 0.0001 Y 1376.565131 0 1.0624 1039 | 2/19
26 h-m-p 1.6000 8.0000 0.0000 Y 1376.565131 0 1.0598 1078 | 2/19
27 h-m-p 1.6000 8.0000 0.0000 C 1376.565131 0 1.6000 1117 | 2/19
28 h-m-p 1.6000 8.0000 0.0000 -------------C 1376.565131 0 0.0000 1169
Out..
lnL = -1376.565131
1170 lfun, 3510 eigenQcodon, 37440 P(t)
Time used: 0:20
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
initial w for M2:NSpselection reset.
0.025466 0.040371 0.000000 0.000001 0.045206 0.007996 0.038655 0.047415 0.011015 0.067583 0.130854 0.115444 0.107664 0.046075 0.031914 0.052879 2.339364 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.515193
np = 21
lnL0 = -1428.631740
Iterating by ming2
Initial: fx= 1428.631740
x= 0.02547 0.04037 0.00000 0.00000 0.04521 0.00800 0.03866 0.04741 0.01101 0.06758 0.13085 0.11544 0.10766 0.04608 0.03191 0.05288 2.33936 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0000 194.1040 ++ 1428.631258 m 0.0000 47 | 2/21
2 h-m-p 0.0000 0.0002 223.6440 ++YYCCC 1426.661761 4 0.0001 100 | 2/21
3 h-m-p 0.0001 0.0003 133.5526 +CYC 1424.842168 2 0.0003 148 | 2/21
4 h-m-p 0.0002 0.0021 183.2723 +CYCCC 1418.158727 4 0.0012 200 | 2/21
5 h-m-p 0.0001 0.0003 965.1485 +CCCC 1411.721374 3 0.0002 250 | 2/21
6 h-m-p 0.0000 0.0001 724.8048 ++ 1409.568220 m 0.0001 293 | 3/21
7 h-m-p 0.0004 0.0055 53.9643 CCC 1409.400708 2 0.0005 340 | 3/21
8 h-m-p 0.0003 0.0046 78.7290 +YYC 1408.790306 2 0.0010 385 | 3/21
9 h-m-p 0.0002 0.0012 238.6409 YYC 1408.397159 2 0.0002 429 | 3/21
10 h-m-p 0.0003 0.0016 112.6770 YY 1408.058957 1 0.0003 472 | 3/21
11 h-m-p 0.0004 0.0034 78.0711 +YCCC 1406.843398 3 0.0013 520 | 3/21
12 h-m-p 0.0020 0.0119 48.6998 YCCCCC 1402.685777 5 0.0046 571 | 3/21
13 h-m-p 0.0005 0.0024 93.9303 YCCC 1402.161416 3 0.0004 618 | 3/21
14 h-m-p 0.0007 0.0059 46.5718 YCCCC 1400.978880 4 0.0015 667 | 3/21
15 h-m-p 0.0015 0.0073 41.6233 YCC 1400.566365 2 0.0009 712 | 3/21
16 h-m-p 0.0032 0.1190 11.4278 +YCCC 1398.739547 3 0.0273 760 | 2/21
17 h-m-p 0.0020 0.0190 153.8346 YCCC 1394.329751 3 0.0050 807 | 2/21
18 h-m-p 0.0002 0.0012 288.4342 ++ 1392.233582 m 0.0012 850 | 3/21
19 h-m-p 0.1829 2.2242 1.8309 +YCYC 1386.400847 3 0.4630 898 | 2/21
20 h-m-p 0.0004 0.0022 1480.2044 YCYC 1384.774159 3 0.0003 944 | 2/21
21 h-m-p 0.1375 1.4075 2.7592 YCCC 1382.499656 3 0.3091 992 | 2/21
22 h-m-p 0.4055 2.0276 0.7004 +YCYCCC 1377.186498 5 1.2240 1044 | 2/21
23 h-m-p 1.0059 5.0295 0.3873 CYCC 1375.974626 3 0.9781 1092 | 2/21
24 h-m-p 1.1616 5.8080 0.2498 YCC 1375.411723 2 0.7644 1138 | 2/21
25 h-m-p 1.0840 8.0000 0.1761 CCC 1375.106506 2 1.1873 1185 | 2/21
26 h-m-p 0.7007 5.0138 0.2984 CYC 1374.996221 2 0.6206 1231 | 2/21
27 h-m-p 1.4464 8.0000 0.1281 YCC 1374.937060 2 0.7623 1277 | 2/21
28 h-m-p 1.0677 8.0000 0.0914 CCC 1374.898792 2 1.3167 1324 | 2/21
29 h-m-p 0.9305 8.0000 0.1294 CC 1374.873218 1 1.3855 1369 | 2/21
30 h-m-p 1.6000 8.0000 0.0985 CCC 1374.859945 2 1.8564 1416 | 2/21
31 h-m-p 1.1646 8.0000 0.1570 CCC 1374.848260 2 1.6766 1463 | 2/21
32 h-m-p 1.6000 8.0000 0.1099 YCCC 1374.827848 3 3.5090 1511 | 2/21
33 h-m-p 1.6000 8.0000 0.0567 CC 1374.816203 1 1.9745 1556 | 2/21
34 h-m-p 0.4490 8.0000 0.2494 +YC 1374.808456 1 1.1510 1601 | 2/21
35 h-m-p 1.6000 8.0000 0.1490 CCC 1374.796711 2 1.3869 1648 | 2/21
36 h-m-p 0.9596 8.0000 0.2154 CCC 1374.784653 2 1.5629 1695 | 2/21
37 h-m-p 1.6000 8.0000 0.1257 YCC 1374.769788 2 2.5447 1741 | 2/21
38 h-m-p 0.3690 6.5419 0.8669 YYC 1374.764565 2 0.3009 1786 | 2/21
39 h-m-p 1.2576 8.0000 0.2074 CC 1374.758160 1 1.3021 1831 | 2/21
40 h-m-p 1.6000 8.0000 0.0298 CC 1374.755317 1 1.3944 1876 | 2/21
41 h-m-p 0.1577 8.0000 0.2637 +YC 1374.750691 1 1.5619 1921 | 2/21
42 h-m-p 1.6000 8.0000 0.1773 CC 1374.747479 1 1.8039 1966 | 2/21
43 h-m-p 1.6000 8.0000 0.1079 CC 1374.745003 1 1.9872 2011 | 2/21
44 h-m-p 0.8412 8.0000 0.2550 CCC 1374.743293 2 1.3388 2058 | 2/21
45 h-m-p 1.6000 8.0000 0.1987 YC 1374.741328 1 0.9534 2102 | 2/21
46 h-m-p 0.8690 8.0000 0.2179 YC 1374.739784 1 1.7218 2146 | 2/21
47 h-m-p 1.6000 8.0000 0.0613 CC 1374.738901 1 1.8951 2191 | 2/21
48 h-m-p 0.3794 8.0000 0.3061 +CC 1374.737776 1 1.7450 2237 | 2/21
49 h-m-p 1.6000 8.0000 0.1391 CC 1374.737096 1 2.1908 2282 | 2/21
50 h-m-p 1.2765 8.0000 0.2387 YC 1374.736612 1 2.2648 2326 | 2/21
51 h-m-p 1.6000 8.0000 0.1393 C 1374.736337 0 1.8714 2369 | 2/21
52 h-m-p 0.7057 8.0000 0.3694 +YC 1374.736027 1 2.1809 2414 | 2/21
53 h-m-p 1.6000 8.0000 0.2912 YC 1374.735805 1 2.6239 2458 | 2/21
54 h-m-p 1.6000 8.0000 0.3670 C 1374.735736 0 1.8541 2501 | 2/21
55 h-m-p 1.6000 8.0000 0.2060 Y 1374.735710 0 2.5924 2544 | 2/21
56 h-m-p 1.6000 8.0000 0.3005 Y 1374.735686 0 3.1055 2587 | 2/21
57 h-m-p 1.6000 8.0000 0.3269 C 1374.735674 0 2.2158 2630 | 2/21
58 h-m-p 1.6000 8.0000 0.3202 C 1374.735670 0 2.2383 2673 | 2/21
59 h-m-p 1.6000 8.0000 0.3034 Y 1374.735668 0 3.1120 2716 | 2/21
60 h-m-p 1.6000 8.0000 0.3534 C 1374.735667 0 2.1868 2759 | 2/21
61 h-m-p 1.6000 8.0000 0.3358 Y 1374.735667 0 2.8660 2802 | 2/21
62 h-m-p 1.6000 8.0000 0.3346 C 1374.735666 0 2.2309 2845 | 2/21
63 h-m-p 1.6000 8.0000 0.3426 Y 1374.735666 0 2.9894 2888 | 2/21
64 h-m-p 1.6000 8.0000 0.3427 C 1374.735666 0 2.1338 2931 | 2/21
65 h-m-p 1.6000 8.0000 0.4093 Y 1374.735666 0 3.5398 2974 | 2/21
66 h-m-p 1.6000 8.0000 0.3358 C 1374.735666 0 1.6000 3017 | 2/21
67 h-m-p 1.6000 8.0000 0.2846 +Y 1374.735666 0 4.5083 3061 | 2/21
68 h-m-p 0.3572 8.0000 3.5920 Y 1374.735666 0 0.2455 3104 | 2/21
69 h-m-p 1.6000 8.0000 0.1531 C 1374.735666 0 1.6000 3147 | 2/21
70 h-m-p 0.7062 8.0000 0.3468 C 1374.735666 0 0.7062 3190 | 2/21
71 h-m-p 1.0439 8.0000 0.2346 Y 1374.735666 0 2.1400 3233 | 2/21
72 h-m-p 1.6000 8.0000 0.1750 ----C 1374.735666 0 0.0015 3280 | 2/21
73 h-m-p 0.1917 8.0000 0.0013 Y 1374.735666 0 0.1917 3323 | 2/21
74 h-m-p 1.6000 8.0000 0.0002 Y 1374.735666 0 1.6000 3366 | 2/21
75 h-m-p 1.6000 8.0000 0.0001 C 1374.735666 0 0.4000 3409 | 2/21
76 h-m-p 1.6000 8.0000 0.0000 -------------C 1374.735666 0 0.0000 3465
Out..
lnL = -1374.735666
3466 lfun, 13864 eigenQcodon, 166368 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1382.650647 S = -1305.295786 -70.063985
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 104 patterns 1:09
did 20 / 104 patterns 1:09
did 30 / 104 patterns 1:09
did 40 / 104 patterns 1:09
did 50 / 104 patterns 1:09
did 60 / 104 patterns 1:09
did 70 / 104 patterns 1:10
did 80 / 104 patterns 1:10
did 90 / 104 patterns 1:10
did 100 / 104 patterns 1:10
did 104 / 104 patterns 1:10
Time used: 1:10
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
0.025466 0.040370 0.000002 0.000000 0.045205 0.007995 0.038657 0.047415 0.011017 0.067584 0.130852 0.115441 0.107662 0.046075 0.031916 0.052880 2.408974 0.923969 0.634343 0.092876 0.232429 0.324665
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 8.886095
np = 22
lnL0 = -1392.979436
Iterating by ming2
Initial: fx= 1392.979436
x= 0.02547 0.04037 0.00000 0.00000 0.04521 0.00799 0.03866 0.04742 0.01102 0.06758 0.13085 0.11544 0.10766 0.04607 0.03192 0.05288 2.40897 0.92397 0.63434 0.09288 0.23243 0.32467
1 h-m-p 0.0000 0.0000 170.2014 ++ 1392.979060 m 0.0000 49 | 2/22
2 h-m-p 0.0000 0.0002 179.1411 ++YCYC 1391.934819 3 0.0001 102 | 2/22
3 h-m-p 0.0000 0.0002 190.3904 +YYYC 1390.467797 3 0.0002 151 | 2/22
4 h-m-p 0.0000 0.0002 270.4281 ++ 1387.274899 m 0.0002 196 | 3/22
5 h-m-p 0.0005 0.0027 56.8307 CCCC 1386.873569 3 0.0007 247 | 3/22
6 h-m-p 0.0004 0.0020 109.4656 YCC 1386.090734 2 0.0008 294 | 3/22
7 h-m-p 0.0000 0.0002 268.1370 ++ 1385.203849 m 0.0002 338 | 3/22
8 h-m-p 0.0000 0.0000 217.1456
h-m-p: 6.82683583e-21 3.41341791e-20 2.17145560e+02 1385.203849
.. | 3/22
9 h-m-p 0.0000 0.0011 249.6212 +YYCCC 1383.733203 4 0.0001 430 | 3/22
10 h-m-p 0.0001 0.0007 68.3320 YCCC 1383.224408 3 0.0003 479 | 3/22
11 h-m-p 0.0003 0.0052 54.0219 +YCCC 1382.332402 3 0.0009 529 | 3/22
12 h-m-p 0.0005 0.0027 57.5514 CCCC 1381.888327 3 0.0006 579 | 3/22
13 h-m-p 0.0005 0.0038 71.1965 YCCC 1381.019837 3 0.0011 628 | 3/22
14 h-m-p 0.0002 0.0010 194.2190 YCCCC 1379.862129 4 0.0005 679 | 3/22
15 h-m-p 0.0001 0.0007 149.6714 CCCC 1379.497873 3 0.0002 729 | 3/22
16 h-m-p 0.0014 0.0119 25.4934 YCC 1379.311319 2 0.0011 776 | 2/22
17 h-m-p 0.0004 0.0072 68.2655 YCCC 1378.728654 3 0.0007 825 | 2/22
18 h-m-p 0.0011 0.0067 43.5119 YCCC 1378.529356 3 0.0007 875 | 2/22
19 h-m-p 0.0004 0.0035 72.5892 ++ 1377.860521 m 0.0035 920 | 3/22
20 h-m-p 0.0006 0.0028 94.4667 YYC 1377.715502 2 0.0005 967 | 3/22
21 h-m-p 0.0065 0.0442 6.6031 CC 1377.697348 1 0.0014 1013 | 2/22
22 h-m-p 0.0009 0.0378 10.7845 CCC 1377.658401 2 0.0008 1061 | 2/22
23 h-m-p 0.0012 0.0726 6.8805 +YC 1377.617892 1 0.0032 1108 | 2/22
24 h-m-p 0.0004 0.0692 50.6887 ++CCCC 1376.646176 3 0.0112 1161 | 2/22
25 h-m-p 0.0007 0.0035 327.2131 YYC 1376.331312 2 0.0006 1208 | 2/22
26 h-m-p 0.0085 0.0425 12.0138 -CC 1376.318122 1 0.0008 1256 | 2/22
27 h-m-p 0.0026 0.0775 3.7104 YC 1376.312968 1 0.0011 1302 | 2/22
28 h-m-p 0.0107 5.3520 2.1655 ++CCC 1375.757326 2 0.2195 1353 | 2/22
29 h-m-p 1.4642 8.0000 0.3247 YC 1375.508389 1 0.8314 1399 | 2/22
30 h-m-p 0.5568 6.0691 0.4848 YYC 1375.372338 2 0.4450 1446 | 2/22
31 h-m-p 1.0093 8.0000 0.2138 CCC 1375.110055 2 1.4468 1495 | 2/22
32 h-m-p 1.4892 8.0000 0.2077 CCC 1374.925343 2 1.7489 1544 | 2/22
33 h-m-p 1.6000 8.0000 0.2188 YYC 1374.857020 2 1.2915 1591 | 2/22
34 h-m-p 1.6000 8.0000 0.1388 YCC 1374.833886 2 1.2200 1639 | 2/22
35 h-m-p 1.6000 8.0000 0.1040 CCC 1374.810418 2 2.3341 1688 | 2/22
36 h-m-p 1.6000 8.0000 0.1497 CCCC 1374.783564 3 2.1238 1739 | 2/22
37 h-m-p 1.6000 8.0000 0.0970 CC 1374.767887 1 1.3548 1786 | 2/22
38 h-m-p 0.4839 8.0000 0.2714 CCC 1374.761394 2 0.7469 1835 | 2/22
39 h-m-p 1.6000 8.0000 0.1139 YC 1374.751703 1 2.7064 1881 | 2/22
40 h-m-p 1.6000 8.0000 0.1398 YC 1374.743629 1 2.6458 1927 | 2/22
41 h-m-p 1.6000 8.0000 0.1401 YC 1374.739141 1 3.0418 1973 | 2/22
42 h-m-p 1.6000 8.0000 0.2227 CC 1374.737484 1 1.3596 2020 | 2/22
43 h-m-p 1.6000 8.0000 0.1473 CC 1374.736879 1 0.5661 2067 | 2/22
44 h-m-p 0.3692 8.0000 0.2258 +C 1374.736265 0 1.2629 2113 | 2/22
45 h-m-p 1.6000 8.0000 0.1742 CY 1374.735826 1 2.1949 2160 | 2/22
46 h-m-p 1.6000 8.0000 0.0910 C 1374.735701 0 1.6000 2205 | 2/22
47 h-m-p 1.3546 8.0000 0.1075 C 1374.735675 0 1.6433 2250 | 2/22
48 h-m-p 1.6000 8.0000 0.0421 C 1374.735667 0 1.4016 2295 | 2/22
49 h-m-p 1.6000 8.0000 0.0218 Y 1374.735666 0 1.1496 2340 | 2/22
50 h-m-p 1.6000 8.0000 0.0031 Y 1374.735666 0 1.0578 2385 | 2/22
51 h-m-p 1.6000 8.0000 0.0003 Y 1374.735666 0 0.8758 2430 | 2/22
52 h-m-p 1.6000 8.0000 0.0000 ---C 1374.735666 0 0.0063 2478 | 2/22
53 h-m-p 0.0008 0.4049 3.8870 ---------C 1374.735666 0 0.0000 2532 | 2/22
54 h-m-p 0.0160 8.0000 0.0000 -------------.. | 2/22
55 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1374.735666
2645 lfun, 10580 eigenQcodon, 126960 P(t)
Time used: 1:47
Model 7: beta
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
0.025466 0.040372 0.000000 0.000002 0.045205 0.007995 0.038656 0.047415 0.011017 0.067584 0.130854 0.115443 0.107662 0.046074 0.031915 0.052879 2.408974 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.798326
np = 19
lnL0 = -1404.340765
Iterating by ming2
Initial: fx= 1404.340765
x= 0.02547 0.04037 0.00000 0.00000 0.04521 0.00799 0.03866 0.04741 0.01102 0.06758 0.13085 0.11544 0.10766 0.04607 0.03192 0.05288 2.40897 1.09130 1.18071
1 h-m-p 0.0000 0.0000 168.6942 ++ 1404.340387 m 0.0000 43 | 2/19
2 h-m-p 0.0000 0.0003 136.9110 ++YYCC 1403.591216 3 0.0001 90 | 2/19
3 h-m-p 0.0001 0.0004 74.4540 +YCYC 1403.119207 3 0.0002 134 | 2/19
4 h-m-p 0.0003 0.0064 62.5924 +YCCC 1402.256680 3 0.0009 179 | 2/19
5 h-m-p 0.0007 0.0061 81.7429 +YYCCC 1399.855819 4 0.0020 225 | 2/19
6 h-m-p 0.0003 0.0020 563.3423 +YYYYYYYCCC 1385.967363 10 0.0012 277 | 2/19
7 h-m-p 0.0001 0.0007 286.1126 CCCCC 1385.215278 4 0.0002 324 | 2/19
8 h-m-p 0.0010 0.0051 26.0391 CC 1385.150750 1 0.0003 365 | 2/19
9 h-m-p 0.0008 0.0162 9.7480 CCC 1385.101951 2 0.0012 408 | 2/19
10 h-m-p 0.0006 0.0149 19.3631 YC 1385.082698 1 0.0003 448 | 2/19
11 h-m-p 0.0007 0.0255 7.5785 YC 1385.047235 1 0.0016 488 | 2/19
12 h-m-p 0.0004 0.0133 33.8925 +CY 1384.913411 1 0.0014 530 | 2/19
13 h-m-p 0.0004 0.0052 117.5333 CCC 1384.741400 2 0.0005 573 | 2/19
14 h-m-p 0.0034 0.0171 7.4612 YC 1384.731459 1 0.0005 613 | 2/19
15 h-m-p 0.0007 0.0225 5.2458 CC 1384.722921 1 0.0006 654 | 2/19
16 h-m-p 0.0009 0.0873 3.3725 +CC 1384.679739 1 0.0032 696 | 2/19
17 h-m-p 0.0038 0.5613 2.8393 ++YCCC 1382.116767 3 0.0932 742 | 2/19
18 h-m-p 0.2743 4.4577 0.9642 YCCC 1381.707671 3 0.4734 786 | 2/19
19 h-m-p 0.4669 2.3344 0.6504 +YCYCCC 1379.367566 5 1.4883 835 | 2/19
20 h-m-p 0.0399 0.1995 3.3464 YCYCCC 1378.573702 5 0.1064 883 | 2/19
21 h-m-p 1.3246 8.0000 0.2687 YYCCC 1378.154619 4 0.4848 928 | 2/19
22 h-m-p 0.5629 4.2578 0.2314 CYC 1377.835043 2 0.5274 970 | 2/19
23 h-m-p 1.6000 8.0000 0.0417 YCC 1377.794458 2 1.1186 1012 | 2/19
24 h-m-p 1.6000 8.0000 0.0227 YC 1377.784817 1 1.0346 1052 | 2/19
25 h-m-p 0.6742 8.0000 0.0348 C 1377.778127 0 0.6742 1091 | 2/19
26 h-m-p 1.6000 8.0000 0.0035 YC 1377.776331 1 1.2426 1131 | 2/19
27 h-m-p 1.6000 8.0000 0.0004 YC 1377.776205 1 1.1942 1171 | 2/19
28 h-m-p 1.6000 8.0000 0.0002 Y 1377.776196 0 1.1968 1210 | 2/19
29 h-m-p 1.6000 8.0000 0.0001 Y 1377.776196 0 1.2733 1249 | 2/19
30 h-m-p 1.6000 8.0000 0.0001 Y 1377.776196 0 1.1936 1288 | 2/19
31 h-m-p 1.6000 8.0000 0.0000 C 1377.776196 0 1.3149 1327 | 2/19
32 h-m-p 1.6000 8.0000 0.0000 C 1377.776196 0 1.5196 1366 | 2/19
33 h-m-p 1.6000 8.0000 0.0000 --C 1377.776196 0 0.0250 1407
Out..
lnL = -1377.776196
1408 lfun, 15488 eigenQcodon, 225280 P(t)
Time used: 2:53
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
initial w for M8:NSbetaw>1 reset.
0.025466 0.040372 0.000001 0.000000 0.045206 0.007997 0.038655 0.047415 0.011016 0.067584 0.130852 0.115443 0.107663 0.046075 0.031914 0.052878 2.320888 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.380381
np = 21
lnL0 = -1383.306550
Iterating by ming2
Initial: fx= 1383.306550
x= 0.02547 0.04037 0.00000 0.00000 0.04521 0.00800 0.03866 0.04741 0.01102 0.06758 0.13085 0.11544 0.10766 0.04608 0.03191 0.05288 2.32089 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0000 227.5540 ++ 1383.305930 m 0.0000 47 | 2/21
2 h-m-p 0.0000 0.0001 416.4436 ++ 1380.561812 m 0.0001 92 | 2/21
3 h-m-p 0.0000 0.0002 175.7415 +CCY 1378.834454 2 0.0001 140 | 2/21
4 h-m-p 0.0001 0.0006 115.0324 CCCC 1378.000895 3 0.0002 189 | 2/21
5 h-m-p 0.0006 0.0028 35.4101 CCC 1377.896317 2 0.0002 236 | 2/21
6 h-m-p 0.0004 0.0062 20.9699 YCCC 1377.785309 3 0.0007 284 | 2/21
7 h-m-p 0.0003 0.0050 41.4123 YC 1377.562919 1 0.0008 328 | 2/21
8 h-m-p 0.0007 0.0055 46.7301 YCC 1377.424690 2 0.0005 374 | 2/21
9 h-m-p 0.0017 0.0112 13.6367 CC 1377.395159 1 0.0005 419 | 2/21
10 h-m-p 0.0008 0.0198 9.0213 YC 1377.383602 1 0.0004 463 | 2/21
11 h-m-p 0.0010 0.0224 3.7290 YC 1377.377460 1 0.0006 507 | 2/21
12 h-m-p 0.0010 0.1396 2.1394 +YC 1377.345128 1 0.0029 552 | 2/21
13 h-m-p 0.0005 0.0450 12.1153 +CYC 1377.151660 2 0.0021 599 | 2/21
14 h-m-p 0.0010 0.0156 25.7584 +YCCC 1376.437035 3 0.0033 648 | 2/21
15 h-m-p 0.0008 0.0132 104.6942 CYCC 1375.848544 3 0.0007 696 | 2/21
16 h-m-p 0.0051 0.0254 12.8747 YCC 1375.798462 2 0.0008 742 | 2/21
17 h-m-p 0.0014 0.0188 7.2256 YC 1375.786349 1 0.0006 786 | 2/21
18 h-m-p 0.0089 4.4554 0.4983 +++YCCC 1375.411077 3 1.0652 837 | 2/21
19 h-m-p 0.4004 2.0019 0.9916 YC 1375.286876 1 0.2725 881 | 2/21
20 h-m-p 1.4252 8.0000 0.1896 CYC 1375.172317 2 1.8460 927 | 2/21
21 h-m-p 1.6000 8.0000 0.1321 CCC 1375.094439 2 2.3784 974 | 2/21
22 h-m-p 1.2148 8.0000 0.2586 C 1375.067615 0 1.2148 1017 | 2/21
23 h-m-p 1.6000 8.0000 0.1359 CCC 1375.053257 2 2.0938 1064 | 2/21
24 h-m-p 1.3523 8.0000 0.2105 YC 1375.024867 1 3.1375 1108 | 2/21
25 h-m-p 1.6000 8.0000 0.3759 YC 1374.971532 1 3.5197 1152 | 2/21
26 h-m-p 1.6000 8.0000 0.5305 CCC 1374.929767 2 2.2369 1199 | 2/21
27 h-m-p 1.6000 8.0000 0.6135 CYC 1374.900989 2 1.7698 1245 | 2/21
28 h-m-p 0.7767 8.0000 1.3981 CC 1374.880950 1 1.2169 1290 | 2/21
29 h-m-p 1.6000 8.0000 0.8188 YCC 1374.856200 2 2.8089 1336 | 2/21
30 h-m-p 1.5493 8.0000 1.4844 YC 1374.824291 1 3.8469 1380 | 2/21
31 h-m-p 1.6000 8.0000 2.0420 YCC 1374.802282 2 2.9041 1426 | 2/21
32 h-m-p 1.5174 8.0000 3.9082 CC 1374.790118 1 2.2009 1471 | 2/21
33 h-m-p 1.6000 8.0000 4.4099 CCC 1374.780053 2 2.2909 1518 | 2/21
34 h-m-p 1.3603 7.7800 7.4265 YC 1374.770778 1 2.2526 1562 | 2/21
35 h-m-p 0.9321 4.6604 8.8081 +YC 1374.764203 1 3.1285 1607 | 2/21
36 h-m-p 0.2144 1.0722 12.5842 ++ 1374.761176 m 1.0722 1650 | 3/21
37 h-m-p 0.1537 8.0000 6.7672 ---------------.. | 3/21
38 h-m-p 0.0001 0.0437 0.9182 +Y 1374.761060 0 0.0003 1749 | 3/21
39 h-m-p 0.0005 0.2343 0.5520 C 1374.761040 0 0.0002 1791 | 3/21
40 h-m-p 0.0004 0.1945 0.3501 Y 1374.761029 0 0.0003 1833 | 3/21
41 h-m-p 0.0014 0.6827 0.1139 C 1374.761026 0 0.0005 1875 | 3/21
42 h-m-p 0.0040 1.9980 0.1295 Y 1374.761024 0 0.0006 1917 | 3/21
43 h-m-p 0.0060 2.9880 0.1780 Y 1374.761006 0 0.0035 1959 | 3/21
44 h-m-p 0.0035 1.7578 1.2864 C 1374.760973 0 0.0010 2001 | 3/21
45 h-m-p 0.0004 0.1247 2.8886 YC 1374.760901 1 0.0009 2044 | 3/21
46 h-m-p 0.0012 0.6200 5.9520 +C 1374.760079 0 0.0052 2087 | 3/21
47 h-m-p 0.0007 0.0798 45.8765 YC 1374.758188 1 0.0015 2130 | 3/21
48 h-m-p 0.0013 0.0667 54.0712 CC 1374.755990 1 0.0015 2174 | 3/21
49 h-m-p 0.0019 0.0815 43.6022 C 1374.755386 0 0.0005 2216 | 3/21
50 h-m-p 0.0020 0.0483 11.5511 YC 1374.755304 1 0.0003 2259 | 3/21
51 h-m-p 0.0071 2.7238 0.4346 C 1374.755212 0 0.0084 2301 | 3/21
52 h-m-p 0.0023 1.1291 6.0392 +YC 1374.754316 1 0.0059 2345 | 3/21
53 h-m-p 0.0009 0.1521 37.9918 YC 1374.752540 1 0.0019 2388 | 3/21
54 h-m-p 0.0010 0.1050 71.4924 CC 1374.750328 1 0.0012 2432 | 3/21
55 h-m-p 1.6000 8.0000 0.0519 YC 1374.750132 1 0.2194 2475 | 3/21
56 h-m-p 1.6000 8.0000 0.0048 Y 1374.750130 0 0.9596 2517 | 3/21
57 h-m-p 1.6000 8.0000 0.0001 Y 1374.750130 0 0.9709 2559 | 3/21
58 h-m-p 1.6000 8.0000 0.0000 ---------Y 1374.750130 0 0.0000 2610
Out..
lnL = -1374.750130
2611 lfun, 31332 eigenQcodon, 459536 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1381.728191 S = -1305.301253 -69.716690
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 104 patterns 5:12
did 20 / 104 patterns 5:12
did 30 / 104 patterns 5:12
did 40 / 104 patterns 5:13
did 50 / 104 patterns 5:13
did 60 / 104 patterns 5:13
did 70 / 104 patterns 5:13
did 80 / 104 patterns 5:13
did 90 / 104 patterns 5:14
did 100 / 104 patterns 5:14
did 104 / 104 patterns 5:14
Time used: 5:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=218
D_melanogaster_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_sechellia_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_simulans_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_yakuba_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_erecta_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_takahashii_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_biarmipes_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_eugracilis_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_rhopaloa_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
D_elegans_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE
**************************************************
D_melanogaster_bun-PO EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
D_sechellia_bun-PO EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
D_simulans_bun-PO EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT
D_yakuba_bun-PO EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
D_erecta_bun-PO EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
D_takahashii_bun-PO EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
D_biarmipes_bun-PO EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
D_eugracilis_bun-PO EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT
D_rhopaloa_bun-PO EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
D_elegans_bun-PO EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT
*************:*********.***************:***:******
D_melanogaster_bun-PO PAIQAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASA
D_sechellia_bun-PO PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
D_simulans_bun-PO PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA
D_yakuba_bun-PO PAIQAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASA
D_erecta_bun-PO PAIQAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASA
D_takahashii_bun-PO PAIQAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASA
D_biarmipes_bun-PO PAIQAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASA
D_eugracilis_bun-PO PAIQAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASA
D_rhopaloa_bun-PO PAIQAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASA
D_elegans_bun-PO PAIQAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASA
******* *. :***** * * * **:*:*******
D_melanogaster_bun-PO VVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTA
D_sechellia_bun-PO VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
D_simulans_bun-PO VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA
D_yakuba_bun-PO VVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTA
D_erecta_bun-PO AVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTA
D_takahashii_bun-PO VIPTIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTT
D_biarmipes_bun-PO VVPTIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTT
D_eugracilis_bun-PO VVPTSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTT
D_rhopaloa_bun-PO VAPTTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTA
D_elegans_bun-PO VAPTTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTA
. ** *********.***: ..:.** ::* :. *:
D_melanogaster_bun-PO NGPMSooooo--------
D_sechellia_bun-PO NGPMS-------------
D_simulans_bun-PO NGPMS-------------
D_yakuba_bun-PO NGPMS-------------
D_erecta_bun-PO NGPMSoooooo-------
D_takahashii_bun-PO NGPMSooo----------
D_biarmipes_bun-PO NGPMSoo-----------
D_eugracilis_bun-PO NGPMSooooooo------
D_rhopaloa_bun-PO NGPMSooooooooooooo
D_elegans_bun-PO NGPMSoooooooooo---
*****
>D_melanogaster_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA CACTGCAGCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACG CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGA---- --------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG GTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC AGTCGAGTCAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT CA---------------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCC AATGGTCCCATGTCC----------------------------------- ---- >D_sechellia_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACG CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC TGCCGCGGGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA---- --------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG GTGGTACCCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGC AGTCGAGACAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT CAGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCC AATGGTCCCATGTCC----------------------------------- ---- >D_simulans_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCG AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACG CCCGCCATTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGC TGCCGCGGGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA---- --------GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG GTGGTACCCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGC AGTCGAGACAGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT CAGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCC AATGGTCCCATGTCC----------------------------------- ---- >D_yakuba_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGA CACTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACG CCCGCCATTCAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGC TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGG TTGCGGTAGCGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG GTGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC AGTCGAGTCA---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACTT CAGCA------------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCA AACGGTCCCATGTCC----------------------------------- ---- >D_erecta_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA CACTGCAGCAGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACG CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGC TGCCGCGGGTCAGGCAGTTCAG---------CAGCAGCAGGCC------G CTGGAGGAGCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCG GCGGTACCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGC AGTCGAGTCA---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACAT CA---------------------GCAGCGGCGGCAGCAGTGGTCACAGCC AATGGTCCCATGTCC----------------------------------- ---- >D_takahashii_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACG CCCGCCATCCAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGC TGCCGCGGGTCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT---- --------GCGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCG GTGATCCCAACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGC TGTCGAGTCAGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG---- --------------GTGACGTCAGCAGCGGCAACAGCGGTAACCACGACC AACGGTCCCATGTCC----------------------------------- ---- >D_biarmipes_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT CATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACG CCCGCCATCCAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGC TGCCGCGGGTCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGG TGGCGGTGGCGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCG GTGGTCCCCACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC AGTCGAGCTGTCAGCGGCAGCGGCGGAGCAGCAGCAG------------- --------------GTGGCGTCGGCAGCGGCTGGAGCGGCAACCACGACC AACGGCCCCATGTCC----------------------------------- ---- >D_eugracilis_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCG AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAA CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACG CCAGCCATTCAAGCGGCGCCG---GCGGCAACG---------------AC TGCCGCGGGTCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA---- --------ACGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCG GTGGTCCCCACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGC AGTCGAGTCAGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAG- --------------GTGACGTCAGCAGCGGCAACAGCGGTAACCACAACC AATGGTCCCATGTCC----------------------------------- ---- >D_rhopaloa_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCG AGCAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACG CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GC TGCCGCGGGTCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA---- --------------GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCA GTGGCGCCCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC AGTCAAGTCA---GCGGTGGCGGTGGAGCAG------CAGCAGGTG---- -----------------------ACGTCAGCAGCAGCGGTACCCACAGCA AACGGTCCCATGTCC----------------------------------- ---- >D_elegans_bun-PO ATGGAAAACAAAAACAATTTAGAAATCGCTTTTAATAACGGAAATATTTT TATTAAAAGTGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCG AACAGGCAATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAG GAGGTGGAAGTTCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAA CAAGCTGGAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGA CGCTGCAGCAGTTGCAGATGCAGCTCCAAGTGGCCGCTCCCCCGGCCACG CCCGCCATTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GC TGCCGCGGGTCAGGCAGGGCAGGGTGGT---CAGGTGGCCGCCGGT---- --------------GCGGTGACGGGAGTTGCCACCAGTCCAGCGTCCGCA GTGGCGCCCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGC AGTCGAGTCA---GCGGTAGCGGTGGAGCAG------CAGCATGTGGCGG CAGCA------------------ACAGCAGCAGCAGCGGTACCCACAGCC AACGGACCTATGTCC----------------------------------- ----
>D_melanogaster_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT PAIQAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASA VVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTA NGPMS >D_sechellia_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA NGPMS >D_simulans_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPAT PAIQAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASA VVPTSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTA NGPMS >D_yakuba_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT PAIQAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASA VVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTA NGPMS >D_erecta_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT PAIQAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASA AVPTSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTA NGPMS >D_takahashii_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT PAIQAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASA VIPTIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTT NGPMS >D_biarmipes_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT PAIQAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASA VVPTIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTT NGPMS >D_eugracilis_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPAT PAIQAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASA VVPTSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTT NGPMS >D_rhopaloa_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT PAIQAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASA VAPTTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTA NGPMS >D_elegans_bun-PO MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVRE EVEVLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPAT PAIQAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASA VAPTTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTA NGPMS
#NEXUS
[ID: 2730358986]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_bun-PO
D_sechellia_bun-PO
D_simulans_bun-PO
D_yakuba_bun-PO
D_erecta_bun-PO
D_takahashii_bun-PO
D_biarmipes_bun-PO
D_eugracilis_bun-PO
D_rhopaloa_bun-PO
D_elegans_bun-PO
;
end;
begin trees;
translate
1 D_melanogaster_bun-PO,
2 D_sechellia_bun-PO,
3 D_simulans_bun-PO,
4 D_yakuba_bun-PO,
5 D_erecta_bun-PO,
6 D_takahashii_bun-PO,
7 D_biarmipes_bun-PO,
8 D_eugracilis_bun-PO,
9 D_rhopaloa_bun-PO,
10 D_elegans_bun-PO
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01107619,(2:0.001468162,3:0.001440856)1.000:0.01723794,((4:0.01921681,((6:0.03426519,7:0.08266262,8:0.07099527)0.741:0.02040011,(9:0.02805799,10:0.02424458)1.000:0.07555416)1.000:0.04249746)0.918:0.01363505,5:0.03178553)1.000:0.02873552);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01107619,(2:0.001468162,3:0.001440856):0.01723794,((4:0.01921681,((6:0.03426519,7:0.08266262,8:0.07099527):0.02040011,(9:0.02805799,10:0.02424458):0.07555416):0.04249746):0.01363505,5:0.03178553):0.02873552);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1785.88 -1805.10
2 -1786.22 -1800.54
--------------------------------------
TOTAL -1786.04 -1804.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.530088 0.004835 0.403199 0.667286 0.524719 1367.97 1434.48 1.000
r(A<->C){all} 0.109125 0.000744 0.060501 0.165976 0.107008 907.22 928.42 1.000
r(A<->G){all} 0.298140 0.002371 0.202032 0.391325 0.295551 672.20 865.96 1.000
r(A<->T){all} 0.149480 0.001422 0.084352 0.231199 0.147057 813.86 887.90 1.001
r(C<->G){all} 0.041833 0.000257 0.013233 0.073625 0.040456 1011.97 1127.27 1.000
r(C<->T){all} 0.315283 0.002761 0.217455 0.419486 0.314308 785.07 788.13 1.000
r(G<->T){all} 0.086139 0.000715 0.037154 0.139213 0.083836 782.68 868.13 1.000
pi(A){all} 0.245665 0.000261 0.215420 0.278346 0.245287 1261.20 1314.32 1.000
pi(C){all} 0.268605 0.000270 0.236705 0.300437 0.268575 1244.16 1291.45 1.000
pi(G){all} 0.323025 0.000312 0.289214 0.356867 0.323014 1122.66 1162.57 1.000
pi(T){all} 0.162705 0.000187 0.136799 0.188804 0.162380 1166.64 1182.10 1.000
alpha{1,2} 0.283340 0.016542 0.069697 0.538693 0.262590 982.88 1061.26 1.000
alpha{3} 1.512922 0.641747 0.297740 3.105311 1.363477 947.97 1029.31 1.000
pinvar{all} 0.374348 0.017496 0.079813 0.580735 0.400021 625.82 713.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/28/bun-PO/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 174
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 3 4 4 3 3 3 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 1 0 0 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 0 0 0 | TCG 4 4 4 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 0 1 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 4 3 3 4 3 4 | CCC 4 4 4 4 4 4 | CAC 0 0 0 0 0 0 | CGC 2 2 2 2 2 2
CTA 2 1 1 0 0 0 | CCA 1 1 1 1 1 2 | Gln CAA 3 4 4 1 0 1 | CGA 0 0 0 0 0 0
CTG 5 6 6 6 6 6 | CCG 4 4 4 4 4 3 | CAG 11 10 10 13 15 13 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 6 6 6 6 5 | Thr ACT 1 1 1 1 0 0 | Asn AAT 4 4 4 3 4 4 | Ser AGT 4 5 5 4 4 4
ATC 5 5 5 5 6 8 | ACC 1 1 1 1 1 4 | AAC 9 9 9 11 10 10 | AGC 4 3 3 3 3 1
ATA 1 1 1 2 1 2 | ACA 2 2 2 2 3 3 | Lys AAA 4 4 4 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 6 6 6 | ACG 3 4 4 3 3 4 | AAG 4 4 4 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 2 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 3 3 3 3 3 2
GTC 3 3 3 3 3 2 | GCC 8 8 8 8 9 7 | GAC 1 1 1 1 1 1 | GGC 2 2 2 2 2 3
GTA 5 4 4 4 4 4 | GCA 11 9 9 10 8 6 | Glu GAA 3 3 3 3 3 4 | GGA 2 2 2 2 2 3
GTG 6 7 7 6 6 6 | GCG 9 10 10 12 13 12 | GAG 11 11 11 11 11 10 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 1 2 2 2 | Ser TCT 1 1 1 1 | Tyr TAT 0 0 0 0 | Cys TGT 0 0 0 0
TTC 1 0 0 0 | TCC 3 2 3 3 | TAC 0 0 0 0 | TGC 0 0 0 0
Leu TTA 1 2 1 1 | TCA 0 2 2 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 0 1 1 1 | TCG 2 3 2 2 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 0 0 0 1 | His CAT 1 1 1 1 | Arg CGT 0 0 0 0
CTC 3 2 3 3 | CCC 6 4 6 5 | CAC 0 0 0 0 | CGC 2 2 2 2
CTA 0 2 0 0 | CCA 0 2 1 1 | Gln CAA 0 1 1 1 | CGA 0 0 0 0
CTG 8 5 6 6 | CCG 3 3 3 3 | CAG 14 12 12 12 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 5 7 6 6 | Thr ACT 0 1 0 0 | Asn AAT 3 4 3 3 | Ser AGT 3 4 3 4
ATC 8 5 4 5 | ACC 3 4 2 2 | AAC 11 10 11 11 | AGC 2 2 2 1
ATA 1 1 2 1 | ACA 1 3 2 3 | Lys AAA 3 4 3 3 | Arg AGA 0 0 0 0
Met ATG 6 6 6 6 | ACG 4 5 5 4 | AAG 5 4 6 5 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 2 1 3 3 | Ala GCT 4 2 2 3 | Asp GAT 2 2 1 1 | Gly GGT 1 3 2 1
GTC 3 3 2 2 | GCC 9 7 9 9 | GAC 1 0 2 2 | GGC 5 2 3 3
GTA 0 5 3 3 | GCA 8 8 9 9 | Glu GAA 4 5 3 4 | GGA 3 3 3 4
GTG 7 5 7 7 | GCG 14 11 13 12 | GAG 10 10 10 10 | GGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_bun-PO
position 1: T:0.07471 C:0.21264 A:0.30460 G:0.40805
position 2: T:0.27586 C:0.32184 A:0.30460 G:0.09770
position 3: T:0.16667 C:0.26437 A:0.20690 G:0.36207
Average T:0.17241 C:0.26628 A:0.27203 G:0.28927
#2: D_sechellia_bun-PO
position 1: T:0.07471 C:0.21264 A:0.31034 G:0.40230
position 2: T:0.27586 C:0.32184 A:0.30460 G:0.09770
position 3: T:0.17816 C:0.25862 A:0.18391 G:0.37931
Average T:0.17625 C:0.26437 A:0.26628 G:0.29310
#3: D_simulans_bun-PO
position 1: T:0.07471 C:0.21264 A:0.31034 G:0.40230
position 2: T:0.27586 C:0.32184 A:0.30460 G:0.09770
position 3: T:0.17816 C:0.25862 A:0.18391 G:0.37931
Average T:0.17625 C:0.26437 A:0.26628 G:0.29310
#4: D_yakuba_bun-PO
position 1: T:0.06322 C:0.20690 A:0.31609 G:0.41379
position 2: T:0.27011 C:0.32759 A:0.31034 G:0.09195
position 3: T:0.16092 C:0.27011 A:0.17241 G:0.39655
Average T:0.16475 C:0.26820 A:0.26628 G:0.30077
#5: D_erecta_bun-PO
position 1: T:0.06322 C:0.21264 A:0.31609 G:0.40805
position 2: T:0.27011 C:0.32184 A:0.31609 G:0.09195
position 3: T:0.16092 C:0.27011 A:0.15517 G:0.41379
Average T:0.16475 C:0.26820 A:0.26245 G:0.30460
#6: D_takahashii_bun-PO
position 1: T:0.06322 C:0.20690 A:0.33908 G:0.39080
position 2: T:0.27586 C:0.32759 A:0.31034 G:0.08621
position 3: T:0.15517 C:0.28161 A:0.17241 G:0.39080
Average T:0.16475 C:0.27203 A:0.27395 G:0.28927
#7: D_biarmipes_bun-PO
position 1: T:0.05172 C:0.21264 A:0.31609 G:0.41954
position 2: T:0.26437 C:0.33333 A:0.31034 G:0.09195
position 3: T:0.13218 C:0.32759 A:0.12069 G:0.41954
Average T:0.14943 C:0.29119 A:0.24904 G:0.31034
#8: D_eugracilis_bun-PO
position 1: T:0.07471 C:0.19540 A:0.34483 G:0.38506
position 2: T:0.27011 C:0.33333 A:0.30460 G:0.09195
position 3: T:0.16092 C:0.24713 A:0.21839 G:0.37356
Average T:0.16858 C:0.25862 A:0.28927 G:0.28352
#9: D_rhopaloa_bun-PO
position 1: T:0.06897 C:0.20115 A:0.31609 G:0.41379
position 2: T:0.26437 C:0.34483 A:0.30460 G:0.08621
position 3: T:0.13793 C:0.28161 A:0.17241 G:0.40805
Average T:0.15709 C:0.27586 A:0.26437 G:0.30268
#10: D_elegans_bun-PO
position 1: T:0.06322 C:0.20115 A:0.31034 G:0.42529
position 2: T:0.26437 C:0.33908 A:0.30460 G:0.09195
position 3: T:0.14943 C:0.27586 A:0.17816 G:0.39655
Average T:0.15900 C:0.27203 A:0.26437 G:0.30460
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 19 | Ser S TCT 10 | Tyr Y TAT 0 | Cys C TGT 0
TTC 1 | TCC 31 | TAC 0 | TGC 0
Leu L TTA 11 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 30 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 3 | Pro P CCT 1 | His H CAT 10 | Arg R CGT 0
CTC 32 | CCC 45 | CAC 0 | CGC 20
CTA 6 | CCA 11 | Gln Q CAA 16 | CGA 0
CTG 60 | CCG 35 | CAG 122 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 59 | Thr T ACT 5 | Asn N AAT 36 | Ser S AGT 40
ATC 56 | ACC 20 | AAC 101 | AGC 24
ATA 13 | ACA 23 | Lys K AAA 34 | Arg R AGA 0
Met M ATG 57 | ACG 39 | AAG 47 | AGG 0
------------------------------------------------------------------------------
Val V GTT 21 | Ala A GCT 29 | Asp D GAT 18 | Gly G GGT 24
GTC 27 | GCC 82 | GAC 11 | GGC 26
GTA 36 | GCA 87 | Glu E GAA 35 | GGA 26
GTG 64 | GCG 116 | GAG 105 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06724 C:0.20747 A:0.31839 G:0.40690
position 2: T:0.27069 C:0.32931 A:0.30747 G:0.09253
position 3: T:0.15805 C:0.27356 A:0.17644 G:0.39195
Average T:0.16533 C:0.27011 A:0.26743 G:0.29713
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_bun-PO
D_sechellia_bun-PO 0.0693 (0.0051 0.0736)
D_simulans_bun-PO 0.0693 (0.0051 0.0736)-1.0000 (0.0000 0.0000)
D_yakuba_bun-PO 0.1170 (0.0128 0.1094) 0.1406 (0.0180 0.1278) 0.1406 (0.0180 0.1278)
D_erecta_bun-PO 0.1561 (0.0193 0.1234) 0.1912 (0.0219 0.1143) 0.1912 (0.0219 0.1143) 0.1084 (0.0115 0.1058)
D_takahashii_bun-PO 0.1595 (0.0311 0.1950) 0.1730 (0.0337 0.1951) 0.1730 (0.0337 0.1951) 0.1685 (0.0232 0.1375) 0.1577 (0.0271 0.1717)
D_biarmipes_bun-PO 0.1642 (0.0432 0.2629) 0.1863 (0.0476 0.2557) 0.1863 (0.0476 0.2557) 0.1482 (0.0298 0.2007) 0.2020 (0.0417 0.2064) 0.1801 (0.0271 0.1508)
D_eugracilis_bun-PO 0.2551 (0.0445 0.1744) 0.2427 (0.0472 0.1945) 0.2427 (0.0472 0.1945) 0.1767 (0.0364 0.2059) 0.2005 (0.0404 0.2013) 0.1326 (0.0232 0.1750) 0.1990 (0.0458 0.2304)
D_rhopaloa_bun-PO 0.1703 (0.0418 0.2457) 0.1840 (0.0472 0.2568) 0.1840 (0.0472 0.2568) 0.1987 (0.0377 0.1900) 0.2055 (0.0444 0.2162) 0.2005 (0.0414 0.2062) 0.1923 (0.0472 0.2457) 0.2717 (0.0582 0.2141)
D_elegans_bun-PO 0.1552 (0.0365 0.2351) 0.1629 (0.0418 0.2569) 0.1629 (0.0418 0.2569) 0.1401 (0.0324 0.2314) 0.1806 (0.0390 0.2162) 0.1745 (0.0360 0.2063) 0.1954 (0.0418 0.2142) 0.2718 (0.0527 0.1938) 0.0939 (0.0077 0.0817)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
check convergence..
lnL(ntime: 16 np: 18): -1395.998041 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.023262 0.043113 0.000004 0.000004 0.051485 0.010619 0.031875 0.059255 0.014470 0.065991 0.137481 0.133735 0.132297 0.052079 0.027075 0.060351 2.448223 0.185753
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.84309
(1: 0.023262, (2: 0.000004, 3: 0.000004): 0.043113, ((4: 0.031875, ((6: 0.065991, 7: 0.137481, 8: 0.133735): 0.014470, (9: 0.052079, 10: 0.027075): 0.132297): 0.059255): 0.010619, 5: 0.060351): 0.051485);
(D_melanogaster_bun-PO: 0.023262, (D_sechellia_bun-PO: 0.000004, D_simulans_bun-PO: 0.000004): 0.043113, ((D_yakuba_bun-PO: 0.031875, ((D_takahashii_bun-PO: 0.065991, D_biarmipes_bun-PO: 0.137481, D_eugracilis_bun-PO: 0.133735): 0.014470, (D_rhopaloa_bun-PO: 0.052079, D_elegans_bun-PO: 0.027075): 0.132297): 0.059255): 0.010619, D_erecta_bun-PO: 0.060351): 0.051485);
Detailed output identifying parameters
kappa (ts/tv) = 2.44822
omega (dN/dS) = 0.18575
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.023 380.6 141.4 0.1858 0.0035 0.0191 1.3 2.7
11..12 0.043 380.6 141.4 0.1858 0.0066 0.0354 2.5 5.0
12..2 0.000 380.6 141.4 0.1858 0.0000 0.0000 0.0 0.0
12..3 0.000 380.6 141.4 0.1858 0.0000 0.0000 0.0 0.0
11..13 0.051 380.6 141.4 0.1858 0.0078 0.0422 3.0 6.0
13..14 0.011 380.6 141.4 0.1858 0.0016 0.0087 0.6 1.2
14..4 0.032 380.6 141.4 0.1858 0.0049 0.0262 1.8 3.7
14..15 0.059 380.6 141.4 0.1858 0.0090 0.0486 3.4 6.9
15..16 0.014 380.6 141.4 0.1858 0.0022 0.0119 0.8 1.7
16..6 0.066 380.6 141.4 0.1858 0.0101 0.0541 3.8 7.7
16..7 0.137 380.6 141.4 0.1858 0.0210 0.1128 8.0 15.9
16..8 0.134 380.6 141.4 0.1858 0.0204 0.1097 7.8 15.5
15..17 0.132 380.6 141.4 0.1858 0.0202 0.1085 7.7 15.3
17..9 0.052 380.6 141.4 0.1858 0.0079 0.0427 3.0 6.0
17..10 0.027 380.6 141.4 0.1858 0.0041 0.0222 1.6 3.1
13..5 0.060 380.6 141.4 0.1858 0.0092 0.0495 3.5 7.0
tree length for dN: 0.1285
tree length for dS: 0.6917
Time used: 0:09
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
lnL(ntime: 16 np: 19): -1376.565131 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.024105 0.044897 0.000004 0.000004 0.053538 0.010957 0.032717 0.062901 0.012627 0.068131 0.144413 0.138818 0.139968 0.052948 0.027232 0.062305 2.339364 0.857898 0.044416
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87556
(1: 0.024105, (2: 0.000004, 3: 0.000004): 0.044897, ((4: 0.032717, ((6: 0.068131, 7: 0.144413, 8: 0.138818): 0.012627, (9: 0.052948, 10: 0.027232): 0.139968): 0.062901): 0.010957, 5: 0.062305): 0.053538);
(D_melanogaster_bun-PO: 0.024105, (D_sechellia_bun-PO: 0.000004, D_simulans_bun-PO: 0.000004): 0.044897, ((D_yakuba_bun-PO: 0.032717, ((D_takahashii_bun-PO: 0.068131, D_biarmipes_bun-PO: 0.144413, D_eugracilis_bun-PO: 0.138818): 0.012627, (D_rhopaloa_bun-PO: 0.052948, D_elegans_bun-PO: 0.027232): 0.139968): 0.062901): 0.010957, D_erecta_bun-PO: 0.062305): 0.053538);
Detailed output identifying parameters
kappa (ts/tv) = 2.33936
dN/dS (w) for site classes (K=2)
p: 0.85790 0.14210
w: 0.04442 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 381.1 140.9 0.1802 0.0036 0.0200 1.4 2.8
11..12 0.045 381.1 140.9 0.1802 0.0067 0.0373 2.6 5.3
12..2 0.000 381.1 140.9 0.1802 0.0000 0.0000 0.0 0.0
12..3 0.000 381.1 140.9 0.1802 0.0000 0.0000 0.0 0.0
11..13 0.054 381.1 140.9 0.1802 0.0080 0.0444 3.1 6.3
13..14 0.011 381.1 140.9 0.1802 0.0016 0.0091 0.6 1.3
14..4 0.033 381.1 140.9 0.1802 0.0049 0.0272 1.9 3.8
14..15 0.063 381.1 140.9 0.1802 0.0094 0.0522 3.6 7.4
15..16 0.013 381.1 140.9 0.1802 0.0019 0.0105 0.7 1.5
16..6 0.068 381.1 140.9 0.1802 0.0102 0.0566 3.9 8.0
16..7 0.144 381.1 140.9 0.1802 0.0216 0.1199 8.2 16.9
16..8 0.139 381.1 140.9 0.1802 0.0208 0.1152 7.9 16.2
15..17 0.140 381.1 140.9 0.1802 0.0209 0.1162 8.0 16.4
17..9 0.053 381.1 140.9 0.1802 0.0079 0.0440 3.0 6.2
17..10 0.027 381.1 140.9 0.1802 0.0041 0.0226 1.6 3.2
13..5 0.062 381.1 140.9 0.1802 0.0093 0.0517 3.6 7.3
Time used: 0:20
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
lnL(ntime: 16 np: 21): -1374.735666 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.024885 0.045977 0.000004 0.000004 0.054923 0.011446 0.033415 0.064261 0.013437 0.069048 0.149468 0.141267 0.143522 0.053613 0.027452 0.063551 2.408974 0.912987 0.000000 0.067961 1.928745
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89627
(1: 0.024885, (2: 0.000004, 3: 0.000004): 0.045977, ((4: 0.033415, ((6: 0.069048, 7: 0.149468, 8: 0.141267): 0.013437, (9: 0.053613, 10: 0.027452): 0.143522): 0.064261): 0.011446, 5: 0.063551): 0.054923);
(D_melanogaster_bun-PO: 0.024885, (D_sechellia_bun-PO: 0.000004, D_simulans_bun-PO: 0.000004): 0.045977, ((D_yakuba_bun-PO: 0.033415, ((D_takahashii_bun-PO: 0.069048, D_biarmipes_bun-PO: 0.149468, D_eugracilis_bun-PO: 0.141267): 0.013437, (D_rhopaloa_bun-PO: 0.053613, D_elegans_bun-PO: 0.027452): 0.143522): 0.064261): 0.011446, D_erecta_bun-PO: 0.063551): 0.054923);
Detailed output identifying parameters
kappa (ts/tv) = 2.40897
dN/dS (w) for site classes (K=3)
p: 0.91299 0.00000 0.08701
w: 0.06796 1.00000 1.92875
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 380.8 141.2 0.2299 0.0044 0.0189 1.7 2.7
11..12 0.046 380.8 141.2 0.2299 0.0080 0.0350 3.1 4.9
12..2 0.000 380.8 141.2 0.2299 0.0000 0.0000 0.0 0.0
12..3 0.000 380.8 141.2 0.2299 0.0000 0.0000 0.0 0.0
11..13 0.055 380.8 141.2 0.2299 0.0096 0.0418 3.7 5.9
13..14 0.011 380.8 141.2 0.2299 0.0020 0.0087 0.8 1.2
14..4 0.033 380.8 141.2 0.2299 0.0058 0.0254 2.2 3.6
14..15 0.064 380.8 141.2 0.2299 0.0112 0.0489 4.3 6.9
15..16 0.013 380.8 141.2 0.2299 0.0023 0.0102 0.9 1.4
16..6 0.069 380.8 141.2 0.2299 0.0121 0.0525 4.6 7.4
16..7 0.149 380.8 141.2 0.2299 0.0261 0.1137 10.0 16.1
16..8 0.141 380.8 141.2 0.2299 0.0247 0.1075 9.4 15.2
15..17 0.144 380.8 141.2 0.2299 0.0251 0.1092 9.6 15.4
17..9 0.054 380.8 141.2 0.2299 0.0094 0.0408 3.6 5.8
17..10 0.027 380.8 141.2 0.2299 0.0048 0.0209 1.8 2.9
13..5 0.064 380.8 141.2 0.2299 0.0111 0.0483 4.2 6.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
94 L 0.926 1.790
110 Q 0.893 1.730
117 V 0.923 1.785
120 Q 0.864 1.676
121 A 1.000** 1.929
136 V 0.849 1.648
139 S 0.996** 1.921
154 S 0.995** 1.920
157 S 0.870 1.686
164 A 0.998** 1.925
166 V 0.918 1.775
167 V 0.995** 1.919
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
121 A 0.904 3.108 +- 1.849
139 S 0.502 1.831 +- 1.156
154 S 0.728 2.625 +- 1.772
164 A 0.646 2.308 +- 1.556
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.993 0.007 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.245 0.331 0.188 0.097 0.055 0.033 0.021 0.014 0.010 0.007
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.013 0.495
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.059 0.317 0.107
sum of density on p0-p1 = 1.000000
Time used: 1:10
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
check convergence..
lnL(ntime: 16 np: 22): -1374.735666 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.024885 0.045977 0.000004 0.000004 0.054923 0.011446 0.033415 0.064260 0.013437 0.069048 0.149468 0.141267 0.143522 0.053613 0.027452 0.063551 2.408974 0.004838 0.908149 0.067961 0.067962 1.928745
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89627
(1: 0.024885, (2: 0.000004, 3: 0.000004): 0.045977, ((4: 0.033415, ((6: 0.069048, 7: 0.149468, 8: 0.141267): 0.013437, (9: 0.053613, 10: 0.027452): 0.143522): 0.064260): 0.011446, 5: 0.063551): 0.054923);
(D_melanogaster_bun-PO: 0.024885, (D_sechellia_bun-PO: 0.000004, D_simulans_bun-PO: 0.000004): 0.045977, ((D_yakuba_bun-PO: 0.033415, ((D_takahashii_bun-PO: 0.069048, D_biarmipes_bun-PO: 0.149468, D_eugracilis_bun-PO: 0.141267): 0.013437, (D_rhopaloa_bun-PO: 0.053613, D_elegans_bun-PO: 0.027452): 0.143522): 0.064260): 0.011446, D_erecta_bun-PO: 0.063551): 0.054923);
Detailed output identifying parameters
kappa (ts/tv) = 2.40897
dN/dS (w) for site classes (K=3)
p: 0.00484 0.90815 0.08701
w: 0.06796 0.06796 1.92874
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 380.8 141.2 0.2299 0.0044 0.0189 1.7 2.7
11..12 0.046 380.8 141.2 0.2299 0.0080 0.0350 3.1 4.9
12..2 0.000 380.8 141.2 0.2299 0.0000 0.0000 0.0 0.0
12..3 0.000 380.8 141.2 0.2299 0.0000 0.0000 0.0 0.0
11..13 0.055 380.8 141.2 0.2299 0.0096 0.0418 3.7 5.9
13..14 0.011 380.8 141.2 0.2299 0.0020 0.0087 0.8 1.2
14..4 0.033 380.8 141.2 0.2299 0.0058 0.0254 2.2 3.6
14..15 0.064 380.8 141.2 0.2299 0.0112 0.0489 4.3 6.9
15..16 0.013 380.8 141.2 0.2299 0.0023 0.0102 0.9 1.4
16..6 0.069 380.8 141.2 0.2299 0.0121 0.0525 4.6 7.4
16..7 0.149 380.8 141.2 0.2299 0.0261 0.1137 10.0 16.1
16..8 0.141 380.8 141.2 0.2299 0.0247 0.1075 9.4 15.2
15..17 0.144 380.8 141.2 0.2299 0.0251 0.1092 9.6 15.4
17..9 0.054 380.8 141.2 0.2299 0.0094 0.0408 3.6 5.8
17..10 0.027 380.8 141.2 0.2299 0.0048 0.0209 1.8 2.9
13..5 0.064 380.8 141.2 0.2299 0.0111 0.0483 4.2 6.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
94 L 0.926 1.790
110 Q 0.893 1.730
117 V 0.923 1.785
120 Q 0.864 1.676
121 A 1.000** 1.929
136 V 0.849 1.648
139 S 0.996** 1.921
154 S 0.995** 1.920
157 S 0.870 1.686
164 A 0.998** 1.925
166 V 0.918 1.775
167 V 0.995** 1.919
Time used: 1:47
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
lnL(ntime: 16 np: 19): -1377.776196 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.023975 0.044579 0.000004 0.000004 0.053079 0.010891 0.032358 0.062787 0.011715 0.067751 0.142496 0.137822 0.139068 0.052624 0.027277 0.061725 2.320888 0.077690 0.342207
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86816
(1: 0.023975, (2: 0.000004, 3: 0.000004): 0.044579, ((4: 0.032358, ((6: 0.067751, 7: 0.142496, 8: 0.137822): 0.011715, (9: 0.052624, 10: 0.027277): 0.139068): 0.062787): 0.010891, 5: 0.061725): 0.053079);
(D_melanogaster_bun-PO: 0.023975, (D_sechellia_bun-PO: 0.000004, D_simulans_bun-PO: 0.000004): 0.044579, ((D_yakuba_bun-PO: 0.032358, ((D_takahashii_bun-PO: 0.067751, D_biarmipes_bun-PO: 0.142496, D_eugracilis_bun-PO: 0.137822): 0.011715, (D_rhopaloa_bun-PO: 0.052624, D_elegans_bun-PO: 0.027277): 0.139068): 0.062787): 0.010891, D_erecta_bun-PO: 0.061725): 0.053079);
Detailed output identifying parameters
kappa (ts/tv) = 2.32089
Parameters in M7 (beta):
p = 0.07769 q = 0.34221
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00001 0.00031 0.00409 0.03449 0.19521 0.63672 0.98047
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 381.2 140.8 0.1851 0.0037 0.0197 1.4 2.8
11..12 0.045 381.2 140.8 0.1851 0.0068 0.0367 2.6 5.2
12..2 0.000 381.2 140.8 0.1851 0.0000 0.0000 0.0 0.0
12..3 0.000 381.2 140.8 0.1851 0.0000 0.0000 0.0 0.0
11..13 0.053 381.2 140.8 0.1851 0.0081 0.0437 3.1 6.2
13..14 0.011 381.2 140.8 0.1851 0.0017 0.0090 0.6 1.3
14..4 0.032 381.2 140.8 0.1851 0.0049 0.0266 1.9 3.8
14..15 0.063 381.2 140.8 0.1851 0.0096 0.0517 3.6 7.3
15..16 0.012 381.2 140.8 0.1851 0.0018 0.0096 0.7 1.4
16..6 0.068 381.2 140.8 0.1851 0.0103 0.0558 3.9 7.9
16..7 0.142 381.2 140.8 0.1851 0.0217 0.1173 8.3 16.5
16..8 0.138 381.2 140.8 0.1851 0.0210 0.1134 8.0 16.0
15..17 0.139 381.2 140.8 0.1851 0.0212 0.1145 8.1 16.1
17..9 0.053 381.2 140.8 0.1851 0.0080 0.0433 3.1 6.1
17..10 0.027 381.2 140.8 0.1851 0.0042 0.0225 1.6 3.2
13..5 0.062 381.2 140.8 0.1851 0.0094 0.0508 3.6 7.2
Time used: 2:53
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 124
lnL(ntime: 16 np: 21): -1374.750130 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.024882 0.045967 0.000004 0.000004 0.054911 0.011446 0.033408 0.064262 0.013414 0.069038 0.149446 0.141233 0.143528 0.053621 0.027459 0.063537 2.407524 0.914012 7.377025 99.000000 1.939633
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89616
(1: 0.024882, (2: 0.000004, 3: 0.000004): 0.045967, ((4: 0.033408, ((6: 0.069038, 7: 0.149446, 8: 0.141233): 0.013414, (9: 0.053621, 10: 0.027459): 0.143528): 0.064262): 0.011446, 5: 0.063537): 0.054911);
(D_melanogaster_bun-PO: 0.024882, (D_sechellia_bun-PO: 0.000004, D_simulans_bun-PO: 0.000004): 0.045967, ((D_yakuba_bun-PO: 0.033408, ((D_takahashii_bun-PO: 0.069038, D_biarmipes_bun-PO: 0.149446, D_eugracilis_bun-PO: 0.141233): 0.013414, (D_rhopaloa_bun-PO: 0.053621, D_elegans_bun-PO: 0.027459): 0.143528): 0.064262): 0.011446, D_erecta_bun-PO: 0.063537): 0.054911);
Detailed output identifying parameters
kappa (ts/tv) = 2.40752
Parameters in M8 (beta&w>1):
p0 = 0.91401 p = 7.37702 q = 99.00000
(p1 = 0.08599) w = 1.93963
dN/dS (w) for site classes (K=11)
p: 0.09140 0.09140 0.09140 0.09140 0.09140 0.09140 0.09140 0.09140 0.09140 0.09140 0.08599
w: 0.03411 0.04450 0.05159 0.05775 0.06366 0.06974 0.07637 0.08420 0.09464 0.11378 1.93963
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 380.8 141.2 0.2299 0.0044 0.0189 1.7 2.7
11..12 0.046 380.8 141.2 0.2299 0.0080 0.0350 3.1 4.9
12..2 0.000 380.8 141.2 0.2299 0.0000 0.0000 0.0 0.0
12..3 0.000 380.8 141.2 0.2299 0.0000 0.0000 0.0 0.0
11..13 0.055 380.8 141.2 0.2299 0.0096 0.0418 3.7 5.9
13..14 0.011 380.8 141.2 0.2299 0.0020 0.0087 0.8 1.2
14..4 0.033 380.8 141.2 0.2299 0.0058 0.0254 2.2 3.6
14..15 0.064 380.8 141.2 0.2299 0.0112 0.0489 4.3 6.9
15..16 0.013 380.8 141.2 0.2299 0.0023 0.0102 0.9 1.4
16..6 0.069 380.8 141.2 0.2299 0.0121 0.0525 4.6 7.4
16..7 0.149 380.8 141.2 0.2299 0.0261 0.1137 10.0 16.1
16..8 0.141 380.8 141.2 0.2299 0.0247 0.1074 9.4 15.2
15..17 0.144 380.8 141.2 0.2299 0.0251 0.1092 9.6 15.4
17..9 0.054 380.8 141.2 0.2299 0.0094 0.0408 3.6 5.8
17..10 0.027 380.8 141.2 0.2299 0.0048 0.0209 1.8 2.9
13..5 0.064 380.8 141.2 0.2299 0.0111 0.0483 4.2 6.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
94 L 0.915 1.783
110 Q 0.880 1.717
117 V 0.913 1.778
120 Q 0.848 1.658
121 A 1.000** 1.940
136 V 0.832 1.628
139 S 0.994** 1.929
154 S 0.995** 1.929
157 S 0.854 1.669
164 A 0.997** 1.934
166 V 0.907 1.767
167 V 0.993** 1.927
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
117 V 0.543 1.692 +- 1.235
121 A 0.982* 2.761 +- 1.007
139 S 0.774 2.255 +- 1.146
154 S 0.898 2.593 +- 1.128
164 A 0.870 2.517 +- 1.133
166 V 0.516 1.616 +- 1.208
167 V 0.751 2.205 +- 1.165
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.031 0.969
p : 0.924 0.076 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.020 0.084 0.136 0.155 0.154 0.150 0.148 0.152
ws: 0.167 0.517 0.227 0.061 0.017 0.006 0.002 0.001 0.001 0.000
Time used: 5:14
Model 1: NearlyNeutral -1376.565131
Model 2: PositiveSelection -1374.735666
Model 0: one-ratio -1395.998041
Model 3: discrete -1374.735666
Model 7: beta -1377.776196
Model 8: beta&w>1 -1374.75013
Model 0 vs 1 38.865819999999985
Model 2 vs 1 3.658930000000055
Model 8 vs 7 6.052132000000256
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
94 L 0.915 1.783
110 Q 0.880 1.717
117 V 0.913 1.778
120 Q 0.848 1.658
121 A 1.000** 1.940
136 V 0.832 1.628
139 S 0.994** 1.929
154 S 0.995** 1.929
157 S 0.854 1.669
164 A 0.997** 1.934
166 V 0.907 1.767
167 V 0.993** 1.927
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PO)
Pr(w>1) post mean +- SE for w
117 V 0.543 1.692 +- 1.235
121 A 0.982* 2.761 +- 1.007
139 S 0.774 2.255 +- 1.146
154 S 0.898 2.593 +- 1.128
164 A 0.870 2.517 +- 1.133
166 V 0.516 1.616 +- 1.208
167 V 0.751 2.205 +- 1.165
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
