--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 16 09:44:25 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/236/ect-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/236/ect-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/236/ect-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/236/ect-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -6113.36         -6127.30
2      -6113.24         -6127.43
--------------------------------------
TOTAL    -6113.30         -6127.37
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/236/ect-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/236/ect-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/236/ect-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.867616    0.003632    0.753112    0.988209    0.864777   1501.00   1501.00    1.000
r(A<->C){all}   0.093501    0.000191    0.066417    0.121634    0.093108    913.67   1005.02    1.000
r(A<->G){all}   0.206470    0.000475    0.161472    0.246386    0.206414   1006.17   1070.12    1.001
r(A<->T){all}   0.086129    0.000327    0.053729    0.123855    0.085279    961.19    974.01    1.000
r(C<->G){all}   0.065188    0.000093    0.047447    0.085090    0.065005   1106.84   1107.00    1.000
r(C<->T){all}   0.423956    0.000771    0.372615    0.481670    0.424218   1060.12   1060.18    1.001
r(G<->T){all}   0.124756    0.000271    0.093244    0.157505    0.124159   1001.47   1082.07    1.000
pi(A){all}      0.235212    0.000096    0.216982    0.255163    0.234997   1095.25   1256.67    1.000
pi(C){all}      0.285077    0.000101    0.266282    0.304940    0.285176   1087.90   1129.73    1.000
pi(G){all}      0.313885    0.000114    0.294158    0.335384    0.313729   1068.52   1070.74    1.000
pi(T){all}      0.165826    0.000061    0.149831    0.180046    0.165595   1143.18   1205.16    1.000
alpha{1,2}      0.186867    0.000386    0.149901    0.225040    0.185417    990.58   1002.40    1.000
alpha{3}        3.452108    0.761518    2.018243    5.314581    3.336705   1408.10   1454.55    1.000
pinvar{all}     0.441017    0.001018    0.379320    0.502699    0.442173   1355.81   1418.43    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-5416.111009
Model 2: PositiveSelection	-5416.111009
Model 0: one-ratio	-5545.578044
Model 3: discrete	-5407.896979
Model 7: beta	-5412.102139
Model 8: beta&w>1	-5409.069917


Model 0 vs 1	258.93406999999934

Model 2 vs 1	0.0

Model 8 vs 7	6.064443999999639

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_ect-PA)

            Pr(w>1)     post mean +- SE for w

   186 V      0.679         1.591
   293 S      0.951*        2.013
   296 P      0.564         1.409
   362 P      0.734         1.677
   365 E      0.839         1.840
   366 S      0.752         1.705
   367 E      0.839         1.839
   383 S      0.893         1.923
   386 G      0.765         1.725
   418 S      0.760         1.717
   419 G      0.977*        2.054

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_ect-PA)

            Pr(w>1)     post mean +- SE for w

   147 V      0.526         1.027 +- 0.548
   186 V      0.883         1.428 +- 0.335
   204 N      0.755         1.295 +- 0.446
   293 S      0.965*        1.503 +- 0.235
   296 P      0.810         1.347 +- 0.427
   312 S      0.761         1.301 +- 0.437
   331 V      0.608         1.138 +- 0.496
   332 N      0.533         1.036 +- 0.542
   333 S      0.682         1.206 +- 0.501
   362 P      0.892         1.434 +- 0.334
   363 A      0.537         1.041 +- 0.543
   365 E      0.928         1.471 +- 0.286
   366 S      0.899         1.441 +- 0.326
   367 E      0.924         1.465 +- 0.297
   383 S      0.940         1.480 +- 0.276
   386 G      0.912         1.455 +- 0.304
   418 S      0.903         1.445 +- 0.320
   419 G      0.978*        1.514 +- 0.213

>C1
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDETPAATAQQSAVAAA
PAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEVLAAGNAADESVSAA
VAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARD
LKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSENYDPYVVNLTGRSVLP
NAASGSNVKAANKKQSTSSKVGGHKKLKNTRSEPRSVNSNQEAREAAVKL
QEQLTQLQSELAIKAVEKRPSPTSPATESESDSGSPKAETRTVSGSKTGQ
KKSSNKQNTKKASGLKSGNYNQPAGASKAGASSAGAVEKLQKAEGRLSGL
ASLKRVGNVKVISDAEGRNSTIKAKFTLGPLVLRVEKSFKKGSVRSVKSA
TARTNEMMGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTREFVWR
RTPKIAKLVNEKLKLAAESLFAPQGVEVVRLoooooooooo
>C2
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
TASDNDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEAPAATAQQSAAAAA
PAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAELLAAGNAADESVSAA
VAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARD
LKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSENYDPYVVNLTGRSALP
NAASGSAVKGTNKKQSTSSKVGGHKKLKNTRSEPRSANPNQEAREAAVKL
QEQLTQLQSELGIKAVEKRPRGPATSPASPATESESDSGSPKAETRTVSG
AKTGQKKSSNKQNTNKASSLKSGNYNQPAGASKAGAAGGGAVEKLQKAEG
RLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLGPLVLRVEKSFKKGSVR
SVKSATARTNEMMGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTR
EFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVVRLooooo
>C3
MKFVILLCVLSALLLQIEASPLKQLSRSERAVSRQQTVNNEVAPAVAPAS
EDDDDDDDEDDDDEPDLGDLIDDDEDDDEEEDDDDDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAATAQQSAVAA
APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAADVVAAGNAADESVSA
AVAPAQAAAASNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARDL
KNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRWASPN
AASGSTVKAANKKQTTTSKVGGHKKLKNTRSEPRSGHSNQEAREAAVKLQ
EQLTQLQSELAIKAVEKRPSEALTSDPAAPAASQSDAESPKAETRTVSGP
KTSQKNKSSNKQNTKKASGVKSGNYNQPAGASKAGASSGAAVEKLQKAEG
RLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLGPLVLRVEKSFKKGSVR
SVKSATARTNEMIGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTR
EFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVVRLooooo
>C4
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
EDDDDDDDEDDDDEPDLGDLIDDDEDDDEEEDDDDDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAAAAQQSPVAA
APAQTLDEVAPAAASSVGAGISDGVDLPAESGNAADAVAAGNAADESVSA
AVAPAQSAAASNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARDL
KNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRTAAPN
AAGSTVKAANKKQSTTSKVGGHKKLKNTRSEPRSVSGNQAAREAAVKLQE
QLTQLQSELAIKAVEKRAGEAATSDPAAPAADASDSESPKAETRTVSSPK
TGQKKSSNKANTKKAAGLKSGNYNQPAGSSKAGASGSGVQVEKLQKAEGR
LSGLASLKRVGNVKVISDAEGRNSTIKAKFTLGPLVLRVEKSFKKGSVRS
VKSATARTNEMMGRIKFSVHDDRATLMSIKVQQPKQVEVESKDNHDRTRE
FVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVVRLoooooo
>C5
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
EDDDDDDDEDDDDEPDLGDLIDDDEDDDEEEDDDDDEEDDTPQGQAAPAA
AASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAATAQQSAVAA
APAQTLDEVAPAAASSVGAGISDGVDLPAESGNAADAVAAGNAADESVSA
AVAPAQAAAASNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARDL
KNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRTAATN
AAGGSTVKAANKKQSTNSKVGGHKKLKNTRSEPRSGNANQAAREAAVKLQ
EQLTQLQSELGIKAVEKRPTPASPASDSESPKAETRTVSSPKTGQKKSSN
KANTKKAAGLKSGNYNQPAGASKAGASGSGVQVEKLQKAEGRLSGLASLK
RVGNVKVISDAEGRNSTIKAKFTLGPLVLRVEKSFKKGSVRSVKSATART
NEMMGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTREFVWRRTPK
IAKLVNEKLKLAAESLFAPQGVEVVRLoooooooooooooo
>C6
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
DDDEDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEAAPAASVQQSSVAA
APAQTLDEVAPAAASSVSSGISDGVDLPAESGNAAEAVAAGNSADESVSA
AVAPAQAAAASNNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARD
LKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRWASP
NAASGSTVKAANKKQTTTSKVGGHKKLKNTRSEPRSVNSNHEAREAAVKL
QEQLTQLQSELAIKAVEKRPSDPASPASHPDSDSESPKAETRTVSGPKTS
QKKSSNKQNTKKASGLKSGNYNQPAGASKAGATPSGAVEKLQKAEGRLSG
LASLKRVGNVKVISDAEGRNSTIKAKFTLGPLVLRVEKSFKKGSVRSVKS
ATARTNEMIGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTREFVW
RRTPKIAKLVNEKLKLAAESLFAPQGVEVVRLooooooooo
>C7
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
DDDEDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDDDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAASAPQNAAAA
APAQTLDEVAPAAASSVSAGISDGVDLPAESGNVAEPVAAGNAADESVSA
AVAPAAAASNSEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARDLKN
NVIDMSTDAFQARHNHFIDAIFSRINRIVADNYDPYVVNLTGRLASGPAS
GSTVKAATKKQSTNSKVGGHKKLKNTRSEPRSGHSNQEAAVKLQEQLTQL
QSELAIKAVEKRPVESTSDPVSPPAASASDSESPKAETRTVSGQKSQKKS
SNKQNTKKAAGLKSGNYNQPAGGSSKAGQSGVAVEKLQKAEGRLSGLASL
KRVGNVKVISDAEGRNSTIKAKFTLGPLILRVEKSFKKGSVRSVKSATAR
TNEMMGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTREFVWRRTP
KIAKLVNEKLKLAAESLFAPQGVEVVRLooooooooooooo
>C8
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDDDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDEVAPAASAPQSAAAA
APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAADPVAAGNAADESVSA
AVAPAQSAAASNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARDL
KNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRLASPN
TASGSTVKAANKKQSTSSKVGGHKKLKNTRSEPRSGNSNKEAREAAVKLQ
EQLTQLQSELAIKAVEKRPTESQSDPAPSASESDSPKAETRTVSGPKASQ
KKSSNGTQGHKQNTKKASGLKSGNYNQPAGASKAGATGGNAVEKLQKAEG
RLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLGPLILRVEKSFKKGSVR
SVKSATARTNEMVGRIKFSVLDDRATLMSIKVQQPKQVEVESKDNHDRTR
EFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVVRLooooo
>C9
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
DDDEDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDDDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDEVAPAASAQQSAVAA
APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEAVAAGNAADESVSA
NVAPAQSAAASNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARDL
KNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRWASPN
AASGSTVKAANKKHSTTSKVGGHKKLKNTRSEPRAGNSNQNQNQNQEARE
AAVKLQEQLTQLQSELAIKAVEKRPSEPQSDHAPSAAASESPKAETRTVS
GTKTSQKKSSSNGTQGHKQNAKKASGLKSGNYNQPAGASKAGASAAVEKL
QKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLGPLILRVEKSFK
KGSVRSVKSATARTNEMVGRIKFSVLDDRATLMSIKVQQPKQVEVESKDN
HDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVVRL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=99, Nseq=9, Len=616 

C1              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
C2              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
C3              MKFVILLCVLSALLLQIEASPLKQLSRSERAVSRQQTVNNEVAPAVAPAS
C4              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
C5              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
C6              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
C7              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
C8              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
C9              MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQAVNNEVAPAVAPAS
                **********************::************:*************

C1              DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
C2              DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
C3              EDDDDDDDEDDDDEPDLGDLIDDDEDDDEEEDDDDDEEDDTPQGQAAPAA
C4              EDDDDDDDEDDDDEPDLGDLIDDDEDDDEEEDDDDDEEDDTPQGQAAPAA
C5              EDDDDDDDEDDDDEPDLGDLIDDDEDDDEEEDDDDDEEDDTPQGQAAPAA
C6              DDDEDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
C7              DDDEDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDDDEEDDTPQGQAAPAA
C8              DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDDDEEDDTPQGQAAPAA
C9              DDDEDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDDDEEDDTPQGQAAPAA
                :**:********************:*********:***************

C1              TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDE-TPAATAQQSAVAA
C2              TASDNDEEEDDDDDDYLDRLFDDILGDDDDEDDDDE-APAATAQQSAAAA
C3              TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAATAQQSAVAA
C4              TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAAAAQQSPVAA
C5              AASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAATAQQSAVAA
C6              TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEAAPAASVQQSSVAA
C7              TASDDDEEEDDDDDDYLDRLFDDILGDDDDEDDDDEVAPAASAPQNAAAA
C8              TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDEVAPAASAPQSAAAA
C9              TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDEVAPAASAQQSAVAA
                :***:***********************:******* :***:. *...**

C1              APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEVLAAGNAADESVSA
C2              APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAELLAAGNAADESVSA
C3              APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAADVVAAGNAADESVSA
C4              APAQTLDEVAPAAASSVGAGISDGVDLPAESGNAADAVAAGNAADESVSA
C5              APAQTLDEVAPAAASSVGAGISDGVDLPAESGNAADAVAAGNAADESVSA
C6              APAQTLDEVAPAAASSVSSGISDGVDLPAESGNAAEAVAAGNSADESVSA
C7              APAQTLDEVAPAAASSVSAGISDGVDLPAESGNVAEPVAAGNAADESVSA
C8              APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAADPVAAGNAADESVSA
C9              APAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEAVAAGNAADESVSA
                *****************.:**************.*: :****:*******

C1              AVAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C2              AVAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C3              AVAPAQAAAASN--NEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C4              AVAPAQSAAASN--NEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C5              AVAPAQAAAASN--NEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C6              AVAPAQAAAASN-NNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C7              AVAP--AAAASN--SEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C8              AVAPAQSAAASN--NEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
C9              NVAPAQSAAASN--NEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREAR
                 ***   ****.  .***********************************

C1              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSENYDPYVVNLTGRSVL
C2              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSENYDPYVVNLTGRSAL
C3              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRWAS
C4              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRTAA
C5              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRTAA
C6              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRWAS
C7              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVADNYDPYVVNLTGRLAS
C8              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRLAS
C9              DLKNNVIDMSTDAFQARHNHFIDAIFSRINRIVSDNYDPYVVNLTGRWAS
                *********************************::************ . 

C1              PNAASGSNVKAANKKQSTSSKVGGHKKLKNTRSEPRSVNSNQ------EA
C2              PNAASGSAVKGTNKKQSTSSKVGGHKKLKNTRSEPRSANPNQ------EA
C3              PNAASGSTVKAANKKQTTTSKVGGHKKLKNTRSEPRSGHSNQ------EA
C4              PNAAG-STVKAANKKQSTTSKVGGHKKLKNTRSEPRSVSGNQ------AA
C5              TNAAGGSTVKAANKKQSTNSKVGGHKKLKNTRSEPRSGNANQ------AA
C6              PNAASGSTVKAANKKQTTTSKVGGHKKLKNTRSEPRSVNSNH------EA
C7              G-PASGSTVKAATKKQSTNSKVGGHKKLKNTRSEPRSGHSNQ--------
C8              PNTASGSTVKAANKKQSTSSKVGGHKKLKNTRSEPRSGNSNK------EA
C9              PNAASGSTVKAANKKHSTTSKVGGHKKLKNTRSEPRAGNSNQNQNQNQEA
                  .*. * **.:.**::*.*****************:   *:        

C1              REAAVKLQEQLTQLQSELAIKAVEKRP-----SPTSPATESESDSGSPKA
C2              REAAVKLQEQLTQLQSELGIKAVEKRPRGPATSPASPATESESDSGSPKA
C3              REAAVKLQEQLTQLQSELAIKAVEKRPSEALTSDPAAPAASQSDAESPKA
C4              REAAVKLQEQLTQLQSELAIKAVEKRAGEAATSDPAAPAADASDSESPKA
C5              REAAVKLQEQLTQLQSELGIKAVEKRP---------TPASPASDSESPKA
C6              REAAVKLQEQLTQLQSELAIKAVEKRP----SDPASPASHPDSDSESPKA
C7              -EAAVKLQEQLTQLQSELAIKAVEKRPVESTSDPVSPPAASASDSESPKA
C8              REAAVKLQEQLTQLQSELAIKAVEKRP----TESQSDPAPSASESDSPKA
C9              REAAVKLQEQLTQLQSELAIKAVEKRP----SEPQSDHAPSAAASESPKA
                 *****************.*******.           :   : : ****

C1              ETRTVSGSKTGQK-KSS------NKQNTKKASGLKSGNYNQPAG-ASKAG
C2              ETRTVSGAKTGQK-KSS------NKQNTNKASSLKSGNYNQPAG-ASKAG
C3              ETRTVSGPKTSQKNKSS------NKQNTKKASGVKSGNYNQPAG-ASKAG
C4              ETRTVSSPKTGQK-KSS------NKANTKKAAGLKSGNYNQPAG-SSKAG
C5              ETRTVSSPKTGQK-KSS------NKANTKKAAGLKSGNYNQPAG-ASKAG
C6              ETRTVSGPKTSQK-KSS------NKQNTKKASGLKSGNYNQPAG-ASKAG
C7              ETRTVSGQKSQKK--SS------NKQNTKKAAGLKSGNYNQPAGGSSKAG
C8              ETRTVSGPKASQK-KSS-NGTQGHKQNTKKASGLKSGNYNQPAG-ASKAG
C9              ETRTVSGTKTSQK-KSSSNGTQGHKQNAKKASGLKSGNYNQPAG-ASKAG
                ******. *: :*  **      :* *::**:.:********** :****

C1              ASS-AGAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C2              AAG-GGAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C3              ASS-GAAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C4              ASGSGVQVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C5              ASGSGVQVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C6              ATP-SGAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C7              QS--GVAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C8              ATG-GNAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
C9              AS---AAVEKLQKAEGRLSGLASLKRVGNVKVISDAEGRNSTIKAKFTLG
                 :     *******************************************

C1              PLVLRVEKSFKKGSVRSVKSATARTNEMMGRIKFSVLDDRATLMSIKVQQ
C2              PLVLRVEKSFKKGSVRSVKSATARTNEMMGRIKFSVLDDRATLMSIKVQQ
C3              PLVLRVEKSFKKGSVRSVKSATARTNEMIGRIKFSVLDDRATLMSIKVQQ
C4              PLVLRVEKSFKKGSVRSVKSATARTNEMMGRIKFSVHDDRATLMSIKVQQ
C5              PLVLRVEKSFKKGSVRSVKSATARTNEMMGRIKFSVLDDRATLMSIKVQQ
C6              PLVLRVEKSFKKGSVRSVKSATARTNEMIGRIKFSVLDDRATLMSIKVQQ
C7              PLILRVEKSFKKGSVRSVKSATARTNEMMGRIKFSVLDDRATLMSIKVQQ
C8              PLILRVEKSFKKGSVRSVKSATARTNEMVGRIKFSVLDDRATLMSIKVQQ
C9              PLILRVEKSFKKGSVRSVKSATARTNEMVGRIKFSVLDDRATLMSIKVQQ
                **:*************************:******* *************

C1              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C2              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C3              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C4              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C5              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C6              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C7              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C8              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
C9              PKQVEVESKDNHDRTREFVWRRTPKIAKLVNEKLKLAAESLFAPQGVEVV
                **************************************************

C1              RLoooooooooo----
C2              RLooooo---------
C3              RLooooo---------
C4              RLoooooo--------
C5              RLoooooooooooooo
C6              RLooooooooo-----
C7              RLooooooooooooo-
C8              RLooooo---------
C9              RL--------------
                **              




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [50464]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [50464]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [50464]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [50464]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length  591 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length  591 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/236/ect-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [50464]

Library Relaxation: Multi_proc [72]
 ins