--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Mon Nov 14 20:52:47 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/226/dlg1-PI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1543.74 -1554.08
2 -1543.68 -1552.98
--------------------------------------
TOTAL -1543.71 -1553.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.250157 0.001197 0.189441 0.320968 0.246959 1170.14 1258.74 1.000
r(A<->C){all} 0.159595 0.001241 0.091147 0.227572 0.157355 817.37 1015.39 1.001
r(A<->G){all} 0.228062 0.002138 0.141855 0.321276 0.225068 885.27 921.95 1.000
r(A<->T){all} 0.070525 0.001087 0.014000 0.136685 0.066911 764.77 850.86 1.000
r(C<->G){all} 0.073773 0.000692 0.025632 0.125251 0.071574 877.32 956.58 1.000
r(C<->T){all} 0.395232 0.003701 0.272633 0.509524 0.394744 648.26 839.08 1.000
r(G<->T){all} 0.072812 0.001223 0.016153 0.147186 0.068441 523.13 709.31 1.000
pi(A){all} 0.324951 0.000283 0.293840 0.358855 0.325007 1212.11 1294.98 1.000
pi(C){all} 0.290552 0.000269 0.259392 0.321698 0.290335 1108.11 1156.81 1.000
pi(G){all} 0.224574 0.000239 0.196956 0.256567 0.223696 988.56 1070.10 1.000
pi(T){all} 0.159923 0.000180 0.130708 0.183115 0.160043 1095.36 1149.44 1.000
alpha{1,2} 0.245680 0.050182 0.000308 0.665567 0.189415 780.88 1024.70 1.000
alpha{3} 1.077549 0.346482 0.183840 2.193507 0.951994 1212.10 1356.55 1.000
pinvar{all} 0.219476 0.019659 0.000236 0.467780 0.203359 967.91 975.38 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1303.223057
Model 2: PositiveSelection -1300.554051
Model 0: one-ratio -1318.039758
Model 3: discrete -1300.337611
Model 7: beta -1303.455363
Model 8: beta&w>1 -1300.419246
Model 0 vs 1 29.633401999999933
Model 2 vs 1 5.338011999999708
Model 8 vs 7 6.072234000000208
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.554 3.804
157 A 0.620 4.165
176 S 0.992** 6.188
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.904 3.799 +- 1.988
155 P 0.616 2.648 +- 2.124
157 A 0.922 3.867 +- 1.961
174 H 0.526 2.359 +- 2.178
176 S 0.994** 4.116 +- 1.842
178 I 0.531 2.412 +- 2.225
180 H 0.571 2.383 +- 1.956
>C1
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTSQIQ
IQSLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKM
LKRAFESTooooooooooooooooooo
>C2
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQQQQQQAQQRSSRSPQQQNPQQPQQQGSKSRSGSQT
SQIQIQSLTQTYPNAPQRKRVLVSLHPHPHQHPHQSQHQQQHHYQLRLNN
GNQAKMLKRAFESTooooooooooooo
>C3
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQAQQRSSRSPQQQNSQQPQPQQQQQGSKSRSGSQTS
QIQIQSLTQTYPNAHQRKRVLVSLHPHQHQSQHQHQQQHQHYQLRLNNGN
QAKMLKRAFESTooooooooooooooo
>C4
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPLAEQQQQQQQRSSRSPQQLQQNPQQAQQQQGSKSRSGSQTSQ
IQTQSLTQIPKHTHQRKRVLVSLHQHQHQHEHQSQRQHQHQHHYQLRLNN
GNQAKMLKRAFESTooooooooooooo
>C5
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPSAEQQQQQQQQQQQRSSRSPQQLQQNPQQQQQQSQSQGSKSR
SGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQYQ
HQYQHHYQLRLNSGNQAKKLKRAFEST
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=248
C1 MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
C2 MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
C3 MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
C4 MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
C5 MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
**************************************************
C1 DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
C2 DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
C3 DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
C4 DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
C5 DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
**************************************************
C1 DTENAKEPTVEQQQKQQQ--AQQRSSRSPQ--QQNPQQ------QQGSKS
C2 DTENAKEPTAEQQQQQQQQQAQQRSSRSPQ--QQNPQQPQ----QQGSKS
C3 DTENAKEPTAEQQQQAQQ-----RSSRSPQ--QQNSQQPQPQQQQQGSKS
C4 DTENAKEPLAEQQQQQQQ-----RSSRSPQQLQQNPQQAQQQ---QGSKS
C5 DTENAKEPSAEQQQQQQQQ-QQQRSSRSPQQLQQNPQQQQQQSQSQGSKS
******** .****: ** ******* ***.** *****
C1 RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQH--QS
C2 RSGSQTSQIQIQSLTQTYPNAP--QRKRVLVSLHPHP------HQHPHQS
C3 RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQS--QH
C4 RSGSQTSQIQTQSLTQIPKHTH--QRKRVLVSLHQHQ----HQHEHQSQR
C5 RSGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQY
********** :**** : ****:***** * *: *
C1 QIQHQH-HYQLRHNNGIQAKMLKRAFESTooooooooooooooooooo
C2 QHQQQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
C3 QHQQQHQHYQLRLNNGNQAKMLKRAFESTooooooooooooooo----
C4 QHQHQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
C5 QHQYQH-HYQLRLNSGNQAKKLKRAFEST-------------------
* * ** ***** *.* *** ********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 227 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 227 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7922]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [7922]--->[6304]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/226/dlg1-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.281 Mb, Max= 30.602 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQ--AQQRSSRSPQ--QQNPQQ------QQGSKS
RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQH--QS
QIQHQH-HYQLRHNNGIQAKMLKRAFESTooooooooooooooooooo
>C2
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQQQQQQAQQRSSRSPQ--QQNPQQPQ----QQGSKS
RSGSQTSQIQIQSLTQTYPNAP--QRKRVLVSLHPHP------HQHPHQS
QHQQQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
>C3
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQAQQ-----RSSRSPQ--QQNSQQPQPQQQQQGSKS
RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQS--QH
QHQQQHQHYQLRLNNGNQAKMLKRAFESTooooooooooooooo----
>C4
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPLAEQQQQQQQ-----RSSRSPQQLQQNPQQAQQQ---QGSKS
RSGSQTSQIQTQSLTQIPKHTH--QRKRVLVSLHQHQ----HQHEHQSQR
QHQHQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
>C5
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPSAEQQQQQQQQ-QQQRSSRSPQQLQQNPQQQQQQSQSQGSKS
RSGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQY
QHQYQH-HYQLRLNSGNQAKKLKRAFEST-------------------
FORMAT of file /tmp/tmp2683149877454485042aln Not Supported[FATAL:T-COFFEE]
>C1
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQ--AQQRSSRSPQ--QQNPQQ------QQGSKS
RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQH--QS
QIQHQH-HYQLRHNNGIQAKMLKRAFESTooooooooooooooooooo
>C2
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQQQQQQAQQRSSRSPQ--QQNPQQPQ----QQGSKS
RSGSQTSQIQIQSLTQTYPNAP--QRKRVLVSLHPHP------HQHPHQS
QHQQQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
>C3
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQAQQ-----RSSRSPQ--QQNSQQPQPQQQQQGSKS
RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQS--QH
QHQQQHQHYQLRLNNGNQAKMLKRAFESTooooooooooooooo----
>C4
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPLAEQQQQQQQ-----RSSRSPQQLQQNPQQAQQQ---QGSKS
RSGSQTSQIQTQSLTQIPKHTH--QRKRVLVSLHQHQ----HQHEHQSQR
QHQHQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
>C5
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPSAEQQQQQQQQ-QQQRSSRSPQQLQQNPQQQQQQSQSQGSKS
RSGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQY
QHQYQH-HYQLRLNSGNQAKKLKRAFEST-------------------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:84 BS:248
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 96.38 C1 C2 96.38
TOP 1 0 96.38 C2 C1 96.38
BOT 0 2 95.45 C1 C3 95.45
TOP 2 0 95.45 C3 C1 95.45
BOT 0 3 93.09 C1 C4 93.09
TOP 3 0 93.09 C4 C1 93.09
BOT 0 4 90.38 C1 C5 90.38
TOP 4 0 90.38 C5 C1 90.38
BOT 1 2 97.27 C2 C3 97.27
TOP 2 1 97.27 C3 C2 97.27
BOT 1 3 92.76 C2 C4 92.76
TOP 3 1 92.76 C4 C2 92.76
BOT 1 4 91.08 C2 C5 91.08
TOP 4 1 91.08 C5 C2 91.08
BOT 2 3 92.76 C3 C4 92.76
TOP 3 2 92.76 C4 C3 92.76
BOT 2 4 90.52 C3 C5 90.52
TOP 4 2 90.52 C5 C3 90.52
BOT 3 4 92.99 C4 C5 92.99
TOP 4 3 92.99 C5 C4 92.99
AVG 0 C1 * 93.83
AVG 1 C2 * 94.37
AVG 2 C3 * 94.00
AVG 3 C4 * 92.90
AVG 4 C5 * 91.24
TOT TOT * 93.27
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
C2 ATGCCAGTGAAAAAGCAAGAAGCTCATCGCGCTCTCGAGCTGCTCGAGGA
C3 ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
C4 ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
C5 ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
***************************** ********************
C1 CTACCACGCGAGACTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAA
C2 CTACCACGCGAGGCTTTCTGAGCCGCAGGATCGGGCGCTGCGTATTGCAA
C3 CTACCACGCGAGACTTTCTGAGCCGCAGGATCGGGCGTTGCGCATTGCAA
C4 CTATCACGCCAGACTTTCTGAGCCACAGGATCGGGCGCTGCGTATTGCAA
C5 CTATCATGCGAGGCTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAA
*** ** ** **.***** *****.************ **** *******
C1 TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
C2 TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
C3 TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
C4 TCGAACGCGTTATACGCATATTTAAGTCTCGCTTGTTTCAAGCGCTTTTA
C5 TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
*************************.******************** ***
C1 GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
C2 GATATACAAGAATTCTATGAATTGACCTTATTGGATGACTCGAAGAGCAT
C3 GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
C4 GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
C5 GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
**************************.***********************
C1 ACAACAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAAAAGG
C2 ACAACAAAAGACAGCCGAGACCTTGCAGATTGCAACCAAATGGGAGAAGG
C3 ACAACAAAAGACAGCCGAAACCTTGCAAATTGCAACCAAATGGGAGAAGG
C4 ACAGCAAAAGACAGCGGAAACCTTGCAAATTGCAACCAAATGGGAGAAGG
C5 ACAGCAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAGAAGG
***.*********** **.********.*****************.****
C1 ATGGCCAGGCAGTCAAAATAGCTGATAATCAGCGCATGCGCATCGAATCG
C2 ACGGACAGGCAGTCAAAATAGCCGATAATCAGCGCATGCGCATCGAATCG
C3 ACGGACAGGCAGTCAAAATAGCCGATAATCAGCGCATGCGCATCGAATCG
C4 ACGGACAGGCCGTTAAAATTGCCGATAATCAGCGCATGCGCATCGAGTCG
C5 ACGGACAGGCCGTTAAGATTGCCGATAATCAGCGCATGCGCATCGAGTCG
* **.*****.** **.**:** ***********************.***
C1 GACACGGAAAATGCCAAGGAGCCAACTGTCGAGCAGCAGCAAAAGCAGCA
C2 GATACGGAAAATGCCAAGGAGCCAACGGCCGAGCAGCAACAACAGCAGCA
C3 GATACGGAAAATGCCAAGGAGCCAACGGCCGAGCAGCAGCAGCAGGCGCA
C4 GATACGGAAAATGCGAAGGAGCCGCTGGCCGAGCAGCAGCAGCAGCAGCA
C5 GATACGGAAAATGCGAAGGAGCCGTCGGCCGAGCAGCAGCAGCAGCAGCA
** *********** ********. * *********.**..** .***
C1 GCAA------GCGCAGCAGCGCAGTTCCCGCTCCCCGCAG------CAGC
C2 GCAGCAGCAGGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG------CAGC
C3 GCAG---------------CGCAGTTCCCGCTCCCCGCAG------CAGC
C4 GCAG---------------CGCAGTTCCCGCTCACCGCAGCAGTTGCAGC
C5 GCAGCAG---CAGCAGCAGCGCAGTTCCCGCTCCCCGCAGCAGCTGCAGC
***. **************.****** ****
C1 AGAATCCGCAGCAG------------------CAGCAGGGATCCAAATCG
C2 AGAATCCGCAGCAGCCGCAG------------CAGCAGGGATCCAAATCA
C3 AGAATTCGCAGCAGCCGCAGCCGCAGCAGCAGCAGCAGGGATCCAAATCT
C4 AGAATCCGCAGCAGGCGCAACAGCAG---------CAGGGATCCAAGTCG
C5 AGAATCCGCAGCAGCAGCAGCAGCAATCGCAGTCGCAGGGATCCAAGTCA
***** ******** ***********.**
C1 AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTTACACAGAC
C2 AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTCACACAGAC
C3 AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTCACACAGAC
C4 CGGAGCGGGTCGCAGACCTCACAGATACAGACACAGTCACTCACACAGAT
C5 AGGAGCGGGTCGCAGACTTCACAGATACAGATAGAGTCACTCACACAGAT
.********** ***** ************* * ******* *******
C1 ATACCCAAACGCACAC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC
C2 ATACCCAAACGCACCC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC
C3 ATACCCAAACGCACAC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC
C4 ACCCAAGCACACACAC------CAGCGCAAGCGAGTCCTCGTAAGCCTCC
C5 ACACCAACACCAACACGCACAGCAACGCAAGCGAATCCTCGTAAGCCTCC
* .*....** .**.* **.*********.*******.*******
C1 ATCCACATCAA------------------CATCAACAT------CAAAGC
C2 ATCCACATCCA------------------CATCAACATCCACATCAAAGC
C3 ATCCACATCAA------------------CATCAAAGC------CAACAT
C4 ATCAACATCAA------------CATCAACATGAACATCAAAGCCAACGC
C5 ATCAACATCAAAATCAACATCAAAGCCAACATCAACACCAACACCAATAC
***.*****.* *** **.. *** .
C1 CAAATTCAACACCAACAC---CATTACCAACTTCGCCATAACAACGGCAT
C2 CAACACCAACAACAACAC---CATTACCAACTTCGCCTTAACAACGGCAA
C3 CAACACCAACAACAACACCAACATTACCAACTTCGCCTTAACAACGGCAA
C4 CAACACCAACACCAACAC---CATTACCAACTTCGCCTTAACAACGGCAA
C5 CAACATCAATACCAACAC---CATTACCAACTTCGCCTTAACAGCGGCAA
***.: *** *.****** ****************:*****.*****:
C1 TCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACC-------------
C2 TCAAGCCAAAATGCTCAAGCGCGCTTTCGAGTCCACC-------------
C3 TCAAGCCAAAATGCTTAAGCGCGCTTTCGAGTCCACC-------------
C4 TCAAGCCAAAATGCTAAAGCGCGCTTTCGAGTCCACC-------------
C5 TCAAGCTAAAAAGCTAAAGCGTGCTTTCGAGTCAACC-------------
****** ****:*** ***** ***** *****.***
C1 --------------------------------------------
C2 --------------------------------------------
C3 --------------------------------------------
C4 --------------------------------------------
C5 --------------------------------------------
>C1
ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
CTACCACGCGAGACTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAA
TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
ACAACAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAAAAGG
ATGGCCAGGCAGTCAAAATAGCTGATAATCAGCGCATGCGCATCGAATCG
GACACGGAAAATGCCAAGGAGCCAACTGTCGAGCAGCAGCAAAAGCAGCA
GCAA------GCGCAGCAGCGCAGTTCCCGCTCCCCGCAG------CAGC
AGAATCCGCAGCAG------------------CAGCAGGGATCCAAATCG
AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTTACACAGAC
ATACCCAAACGCACAC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC
ATCCACATCAA------------------CATCAACAT------CAAAGC
CAAATTCAACACCAACAC---CATTACCAACTTCGCCATAACAACGGCAT
TCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACC-------------
--------------------------------------------
>C2
ATGCCAGTGAAAAAGCAAGAAGCTCATCGCGCTCTCGAGCTGCTCGAGGA
CTACCACGCGAGGCTTTCTGAGCCGCAGGATCGGGCGCTGCGTATTGCAA
TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
GATATACAAGAATTCTATGAATTGACCTTATTGGATGACTCGAAGAGCAT
ACAACAAAAGACAGCCGAGACCTTGCAGATTGCAACCAAATGGGAGAAGG
ACGGACAGGCAGTCAAAATAGCCGATAATCAGCGCATGCGCATCGAATCG
GATACGGAAAATGCCAAGGAGCCAACGGCCGAGCAGCAACAACAGCAGCA
GCAGCAGCAGGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG------CAGC
AGAATCCGCAGCAGCCGCAG------------CAGCAGGGATCCAAATCA
AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTCACACAGAC
ATACCCAAACGCACCC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC
ATCCACATCCA------------------CATCAACATCCACATCAAAGC
CAACACCAACAACAACAC---CATTACCAACTTCGCCTTAACAACGGCAA
TCAAGCCAAAATGCTCAAGCGCGCTTTCGAGTCCACC-------------
--------------------------------------------
>C3
ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
CTACCACGCGAGACTTTCTGAGCCGCAGGATCGGGCGTTGCGCATTGCAA
TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
ACAACAAAAGACAGCCGAAACCTTGCAAATTGCAACCAAATGGGAGAAGG
ACGGACAGGCAGTCAAAATAGCCGATAATCAGCGCATGCGCATCGAATCG
GATACGGAAAATGCCAAGGAGCCAACGGCCGAGCAGCAGCAGCAGGCGCA
GCAG---------------CGCAGTTCCCGCTCCCCGCAG------CAGC
AGAATTCGCAGCAGCCGCAGCCGCAGCAGCAGCAGCAGGGATCCAAATCT
AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTCACACAGAC
ATACCCAAACGCACAC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC
ATCCACATCAA------------------CATCAAAGC------CAACAT
CAACACCAACAACAACACCAACATTACCAACTTCGCCTTAACAACGGCAA
TCAAGCCAAAATGCTTAAGCGCGCTTTCGAGTCCACC-------------
--------------------------------------------
>C4
ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
CTATCACGCCAGACTTTCTGAGCCACAGGATCGGGCGCTGCGTATTGCAA
TCGAACGCGTTATACGCATATTTAAGTCTCGCTTGTTTCAAGCGCTTTTA
GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
ACAGCAAAAGACAGCGGAAACCTTGCAAATTGCAACCAAATGGGAGAAGG
ACGGACAGGCCGTTAAAATTGCCGATAATCAGCGCATGCGCATCGAGTCG
GATACGGAAAATGCGAAGGAGCCGCTGGCCGAGCAGCAGCAGCAGCAGCA
GCAG---------------CGCAGTTCCCGCTCACCGCAGCAGTTGCAGC
AGAATCCGCAGCAGGCGCAACAGCAG---------CAGGGATCCAAGTCG
CGGAGCGGGTCGCAGACCTCACAGATACAGACACAGTCACTCACACAGAT
ACCCAAGCACACACAC------CAGCGCAAGCGAGTCCTCGTAAGCCTCC
ATCAACATCAA------------CATCAACATGAACATCAAAGCCAACGC
CAACACCAACACCAACAC---CATTACCAACTTCGCCTTAACAACGGCAA
TCAAGCCAAAATGCTAAAGCGCGCTTTCGAGTCCACC-------------
--------------------------------------------
>C5
ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA
CTATCATGCGAGGCTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAA
TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA
GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT
ACAGCAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAGAAGG
ACGGACAGGCCGTTAAGATTGCCGATAATCAGCGCATGCGCATCGAGTCG
GATACGGAAAATGCGAAGGAGCCGTCGGCCGAGCAGCAGCAGCAGCAGCA
GCAGCAG---CAGCAGCAGCGCAGTTCCCGCTCCCCGCAGCAGCTGCAGC
AGAATCCGCAGCAGCAGCAGCAGCAATCGCAGTCGCAGGGATCCAAGTCA
AGGAGCGGGTCGCAGACTTCACAGATACAGATAGAGTCACTCACACAGAT
ACACCAACACCAACACGCACAGCAACGCAAGCGAATCCTCGTAAGCCTCC
ATCAACATCAAAATCAACATCAAAGCCAACATCAACACCAACACCAATAC
CAACATCAATACCAACAC---CATTACCAACTTCGCCTTAACAGCGGCAA
TCAAGCTAAAAAGCTAAAGCGTGCTTTCGAGTCAACC-------------
--------------------------------------------
>C1
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQooAQQRSSRSPQooQQNPQQooooooQQGSKS
RSGSQTSQIQIQSLTQTYPNAHooQRKRVLVSLHPHQooooooHQHooQS
QIQHQHoHYQLRHNNGIQAKMLKRAFEST
>C2
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQQQQQQAQQRSSRSPQooQQNPQQPQooooQQGSKS
RSGSQTSQIQIQSLTQTYPNAPooQRKRVLVSLHPHPooooooHQHPHQS
QHQQQHoHYQLRLNNGNQAKMLKRAFEST
>C3
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTAEQQQQAQQoooooRSSRSPQooQQNSQQPQPQQQQQGSKS
RSGSQTSQIQIQSLTQTYPNAHooQRKRVLVSLHPHQooooooHQSooQH
QHQQQHQHYQLRLNNGNQAKMLKRAFEST
>C4
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPLAEQQQQQQQoooooRSSRSPQQLQQNPQQAQQQoooQGSKS
RSGSQTSQIQTQSLTQIPKHTHooQRKRVLVSLHQHQooooHQHEHQSQR
QHQHQHoHYQLRLNNGNQAKMLKRAFEST
>C5
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPSAEQQQQQQQQoQQQRSSRSPQQLQQNPQQQQQQSQSQGSKS
RSGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQY
QHQYQHoHYQLRLNSGNQAKKLKRAFEST
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 744 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479156347
Setting output file names to "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2102027447
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4216616715
Seed = 1765340775
Swapseed = 1479156347
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 39 unique site patterns
Division 2 has 39 unique site patterns
Division 3 has 60 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1761.049973 -- -25.624409
Chain 2 -- -1799.771447 -- -25.624409
Chain 3 -- -1799.745824 -- -25.624409
Chain 4 -- -1799.771447 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1815.617678 -- -25.624409
Chain 2 -- -1761.049973 -- -25.624409
Chain 3 -- -1797.194080 -- -25.624409
Chain 4 -- -1798.633525 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1761.050] (-1799.771) (-1799.746) (-1799.771) * [-1815.618] (-1761.050) (-1797.194) (-1798.634)
500 -- (-1587.616) (-1564.986) [-1558.378] (-1575.905) * (-1559.145) (-1564.076) (-1566.082) [-1561.775] -- 0:00:00
1000 -- (-1565.367) (-1560.181) [-1551.835] (-1564.302) * [-1555.909] (-1559.612) (-1553.262) (-1551.386) -- 0:00:00
1500 -- [-1558.060] (-1564.292) (-1554.125) (-1559.621) * (-1555.827) (-1555.635) (-1547.127) [-1549.086] -- 0:11:05
2000 -- (-1568.914) (-1563.262) (-1555.325) [-1550.201] * [-1550.022] (-1550.754) (-1546.469) (-1556.650) -- 0:08:19
2500 -- (-1559.196) [-1549.589] (-1545.647) (-1552.841) * (-1555.172) (-1553.176) (-1547.726) [-1555.449] -- 0:06:39
3000 -- (-1550.723) (-1551.509) [-1548.296] (-1549.214) * (-1549.406) (-1548.765) [-1548.795] (-1551.843) -- 0:05:32
3500 -- (-1545.172) (-1549.181) [-1543.788] (-1550.287) * (-1558.791) (-1545.729) (-1544.412) [-1558.519] -- 0:04:44
4000 -- (-1547.861) (-1547.763) [-1544.809] (-1549.242) * [-1554.142] (-1549.425) (-1549.462) (-1555.565) -- 0:04:09
4500 -- (-1543.808) [-1545.989] (-1541.682) (-1553.747) * (-1549.118) (-1549.947) [-1547.013] (-1554.683) -- 0:03:41
5000 -- (-1547.793) (-1553.264) (-1548.028) [-1544.017] * (-1551.095) (-1552.602) (-1546.060) [-1546.689] -- 0:03:19
Average standard deviation of split frequencies: 0.039284
5500 -- (-1552.269) (-1547.168) [-1544.145] (-1548.119) * (-1556.937) (-1559.267) (-1542.390) [-1547.810] -- 0:06:01
6000 -- (-1554.024) (-1545.279) [-1547.194] (-1544.998) * (-1554.025) (-1558.863) [-1548.824] (-1551.577) -- 0:05:31
6500 -- (-1551.089) (-1545.624) [-1541.186] (-1551.525) * (-1553.732) (-1549.793) (-1548.069) [-1545.966] -- 0:05:05
7000 -- (-1547.076) [-1543.693] (-1543.735) (-1550.316) * (-1545.648) [-1548.503] (-1546.337) (-1551.444) -- 0:04:43
7500 -- (-1551.919) [-1542.230] (-1542.951) (-1550.508) * (-1549.096) (-1553.104) [-1549.078] (-1547.049) -- 0:04:24
8000 -- (-1551.714) [-1545.307] (-1551.158) (-1546.145) * (-1543.554) (-1543.648) [-1543.359] (-1549.334) -- 0:04:08
8500 -- [-1553.352] (-1551.412) (-1541.690) (-1547.665) * (-1547.332) [-1546.446] (-1548.246) (-1552.395) -- 0:03:53
9000 -- (-1549.827) (-1553.228) [-1543.840] (-1546.524) * (-1541.179) [-1544.367] (-1552.108) (-1554.883) -- 0:03:40
9500 -- (-1543.862) (-1547.590) (-1548.423) [-1544.734] * (-1545.589) [-1545.082] (-1554.749) (-1549.698) -- 0:03:28
10000 -- (-1546.160) (-1551.264) [-1541.862] (-1544.681) * (-1548.548) (-1543.192) [-1549.845] (-1546.757) -- 0:04:57
Average standard deviation of split frequencies: 0.044194
10500 -- (-1545.850) (-1546.698) [-1544.246] (-1540.870) * [-1545.602] (-1543.738) (-1546.421) (-1552.096) -- 0:04:42
11000 -- [-1544.456] (-1554.465) (-1543.579) (-1544.802) * (-1551.499) (-1544.233) [-1546.446] (-1546.391) -- 0:04:29
11500 -- (-1545.881) (-1548.560) [-1545.328] (-1546.181) * (-1552.667) (-1544.784) (-1544.287) [-1549.246] -- 0:04:17
12000 -- (-1544.671) (-1543.057) [-1546.676] (-1543.271) * (-1553.253) (-1543.045) (-1549.492) [-1546.080] -- 0:04:07
12500 -- (-1544.825) (-1546.613) (-1549.919) [-1542.465] * (-1554.198) (-1547.931) [-1543.123] (-1547.465) -- 0:03:57
13000 -- (-1551.709) (-1548.714) (-1549.772) [-1540.963] * (-1550.645) (-1553.477) (-1542.621) [-1544.856] -- 0:03:47
13500 -- (-1551.998) (-1547.588) (-1549.600) [-1544.589] * [-1558.312] (-1547.920) (-1546.471) (-1547.932) -- 0:03:39
14000 -- (-1552.496) (-1544.365) (-1552.931) [-1544.196] * (-1556.744) [-1545.331] (-1543.644) (-1549.377) -- 0:04:41
14500 -- [-1547.352] (-1546.092) (-1547.461) (-1543.103) * [-1548.329] (-1545.548) (-1545.994) (-1548.903) -- 0:04:31
15000 -- (-1554.983) (-1549.143) [-1545.376] (-1545.627) * (-1544.028) [-1546.663] (-1545.583) (-1549.423) -- 0:04:22
Average standard deviation of split frequencies: 0.058926
15500 -- (-1552.523) [-1542.814] (-1546.493) (-1553.547) * [-1546.942] (-1545.667) (-1544.302) (-1552.944) -- 0:04:14
16000 -- (-1549.151) (-1548.328) (-1550.153) [-1545.913] * (-1548.148) (-1546.127) (-1548.685) [-1545.694] -- 0:04:06
16500 -- (-1544.388) (-1556.723) [-1543.137] (-1548.992) * [-1544.709] (-1542.096) (-1547.154) (-1544.767) -- 0:03:58
17000 -- (-1546.529) [-1543.286] (-1547.962) (-1551.888) * (-1547.675) (-1544.023) (-1555.181) [-1544.052] -- 0:03:51
17500 -- (-1548.576) (-1546.200) [-1544.775] (-1555.277) * (-1552.637) [-1542.777] (-1543.338) (-1546.368) -- 0:03:44
18000 -- [-1546.472] (-1549.204) (-1547.694) (-1552.971) * (-1551.272) (-1550.809) [-1546.899] (-1544.150) -- 0:04:32
18500 -- (-1555.790) (-1547.043) [-1553.170] (-1552.088) * (-1547.070) (-1545.680) (-1545.594) [-1546.317] -- 0:04:25
19000 -- (-1548.588) [-1543.651] (-1547.757) (-1548.330) * [-1544.693] (-1544.856) (-1546.260) (-1548.851) -- 0:04:18
19500 -- (-1547.443) [-1544.004] (-1549.470) (-1546.875) * [-1543.880] (-1547.075) (-1546.357) (-1543.072) -- 0:04:11
20000 -- (-1552.570) [-1544.986] (-1549.726) (-1549.236) * (-1543.221) [-1545.829] (-1552.703) (-1545.698) -- 0:04:05
Average standard deviation of split frequencies: 0.053223
20500 -- (-1548.815) [-1546.609] (-1551.854) (-1549.559) * (-1544.202) (-1543.969) (-1547.699) [-1546.121] -- 0:03:58
21000 -- (-1546.717) (-1549.128) (-1551.834) [-1541.549] * (-1552.583) [-1549.760] (-1546.442) (-1547.195) -- 0:03:53
21500 -- (-1547.419) (-1548.700) [-1545.376] (-1548.164) * (-1545.896) [-1543.178] (-1548.442) (-1543.985) -- 0:03:47
22000 -- [-1544.833] (-1553.745) (-1545.525) (-1544.927) * (-1544.427) [-1544.434] (-1550.828) (-1552.197) -- 0:03:42
22500 -- [-1543.225] (-1545.600) (-1552.810) (-1546.454) * (-1550.187) (-1545.877) (-1549.737) [-1542.324] -- 0:04:20
23000 -- (-1547.772) (-1549.509) (-1546.353) [-1542.942] * (-1547.465) (-1548.332) (-1544.958) [-1541.890] -- 0:04:14
23500 -- (-1550.425) [-1546.693] (-1548.195) (-1552.555) * (-1546.235) [-1545.894] (-1546.363) (-1548.289) -- 0:04:09
24000 -- (-1545.350) (-1549.773) [-1544.399] (-1546.234) * (-1551.898) (-1552.714) [-1548.867] (-1548.253) -- 0:04:04
24500 -- (-1544.557) (-1544.667) (-1544.789) [-1547.178] * (-1556.604) (-1546.237) [-1547.215] (-1546.317) -- 0:03:58
25000 -- (-1548.650) (-1550.444) [-1548.479] (-1540.616) * (-1552.167) (-1545.414) [-1546.172] (-1548.683) -- 0:03:54
Average standard deviation of split frequencies: 0.030218
25500 -- (-1550.593) (-1549.624) [-1547.010] (-1546.769) * (-1550.069) [-1545.701] (-1548.760) (-1550.024) -- 0:03:49
26000 -- [-1548.473] (-1551.577) (-1549.452) (-1547.458) * (-1544.787) (-1545.867) (-1549.886) [-1541.818] -- 0:03:44
26500 -- [-1548.500] (-1548.428) (-1548.305) (-1549.885) * (-1547.316) [-1545.963] (-1555.133) (-1548.157) -- 0:04:17
27000 -- (-1548.871) (-1549.642) [-1547.533] (-1548.114) * [-1544.291] (-1541.532) (-1550.928) (-1548.801) -- 0:04:12
27500 -- (-1548.157) (-1546.429) [-1552.474] (-1544.546) * (-1547.520) (-1544.515) [-1552.405] (-1546.477) -- 0:04:07
28000 -- (-1550.975) [-1544.590] (-1551.270) (-1549.539) * [-1549.269] (-1547.553) (-1548.956) (-1545.593) -- 0:04:03
28500 -- (-1542.710) (-1549.371) (-1552.633) [-1545.809] * (-1543.839) [-1552.360] (-1551.572) (-1547.320) -- 0:03:58
29000 -- (-1549.598) (-1545.430) [-1546.540] (-1541.656) * (-1546.059) (-1547.978) [-1549.440] (-1548.337) -- 0:03:54
29500 -- (-1550.153) (-1546.116) (-1546.399) [-1542.816] * (-1546.761) (-1545.791) [-1545.739] (-1545.699) -- 0:03:50
30000 -- [-1549.837] (-1547.980) (-1550.094) (-1547.310) * (-1546.416) (-1545.634) [-1549.364] (-1550.733) -- 0:03:46
Average standard deviation of split frequencies: 0.010248
30500 -- (-1546.950) (-1544.338) [-1547.471] (-1553.947) * [-1549.896] (-1546.926) (-1555.954) (-1548.480) -- 0:04:14
31000 -- (-1544.152) [-1546.061] (-1545.617) (-1548.578) * [-1544.457] (-1549.586) (-1545.618) (-1551.417) -- 0:04:10
31500 -- (-1543.695) [-1547.934] (-1543.982) (-1550.979) * [-1542.474] (-1550.016) (-1548.962) (-1544.857) -- 0:04:05
32000 -- (-1547.548) [-1546.794] (-1547.660) (-1546.406) * [-1546.198] (-1546.205) (-1550.472) (-1544.634) -- 0:04:02
32500 -- (-1550.050) [-1549.882] (-1547.915) (-1548.206) * (-1547.441) (-1545.449) (-1550.230) [-1547.198] -- 0:03:58
33000 -- (-1543.836) (-1545.750) (-1552.401) [-1546.254] * (-1548.931) (-1552.297) (-1546.675) [-1545.620] -- 0:03:54
33500 -- (-1550.811) [-1547.541] (-1545.024) (-1546.133) * (-1546.643) [-1544.437] (-1544.415) (-1547.847) -- 0:03:50
34000 -- [-1543.042] (-1549.645) (-1550.793) (-1545.650) * (-1548.315) (-1549.291) (-1548.976) [-1549.930] -- 0:03:47
34500 -- [-1542.836] (-1547.032) (-1545.965) (-1547.914) * (-1543.911) [-1545.570] (-1545.358) (-1545.873) -- 0:03:43
35000 -- [-1546.037] (-1549.116) (-1551.304) (-1551.668) * (-1549.472) [-1550.603] (-1544.188) (-1545.358) -- 0:04:08
Average standard deviation of split frequencies: 0.017459
35500 -- [-1544.943] (-1546.526) (-1545.117) (-1543.822) * (-1552.670) [-1544.591] (-1542.217) (-1542.146) -- 0:04:04
36000 -- (-1549.378) (-1544.733) [-1548.925] (-1547.295) * [-1543.231] (-1544.408) (-1544.521) (-1546.890) -- 0:04:01
36500 -- [-1543.866] (-1545.098) (-1545.720) (-1548.504) * (-1544.542) (-1545.438) (-1548.760) [-1546.152] -- 0:03:57
37000 -- [-1549.687] (-1547.629) (-1545.892) (-1548.295) * [-1550.798] (-1547.418) (-1548.595) (-1545.147) -- 0:03:54
37500 -- (-1545.010) (-1543.331) (-1548.084) [-1543.080] * (-1552.531) (-1547.224) [-1547.627] (-1544.090) -- 0:03:51
38000 -- (-1543.480) (-1546.087) (-1544.832) [-1543.035] * (-1544.399) (-1550.337) [-1542.796] (-1545.184) -- 0:03:47
38500 -- [-1542.817] (-1552.358) (-1548.691) (-1544.380) * (-1548.733) [-1548.265] (-1542.996) (-1551.235) -- 0:03:44
39000 -- [-1545.990] (-1547.903) (-1546.586) (-1546.059) * (-1553.528) (-1543.842) [-1547.703] (-1552.145) -- 0:04:06
39500 -- (-1543.106) (-1553.194) [-1544.317] (-1547.916) * (-1552.526) [-1545.368] (-1546.504) (-1558.345) -- 0:04:03
40000 -- (-1548.345) [-1548.281] (-1547.512) (-1548.244) * (-1555.656) (-1544.022) (-1539.851) [-1554.440] -- 0:04:00
Average standard deviation of split frequencies: 0.027048
40500 -- [-1548.197] (-1547.421) (-1547.951) (-1548.150) * (-1550.287) (-1545.000) [-1546.716] (-1543.104) -- 0:03:56
41000 -- [-1545.747] (-1544.604) (-1549.091) (-1545.466) * (-1552.924) (-1546.946) [-1543.760] (-1547.149) -- 0:03:53
41500 -- (-1547.861) (-1544.530) (-1549.798) [-1543.865] * (-1553.428) (-1548.997) (-1545.958) [-1548.210] -- 0:03:50
42000 -- (-1546.953) (-1546.268) [-1546.082] (-1542.899) * (-1555.074) [-1544.500] (-1544.582) (-1543.549) -- 0:03:48
42500 -- (-1551.231) (-1546.900) (-1554.083) [-1545.374] * (-1554.720) (-1546.966) (-1550.625) [-1545.116] -- 0:03:45
43000 -- (-1548.058) [-1545.519] (-1541.214) (-1549.890) * (-1554.111) [-1549.116] (-1547.449) (-1547.431) -- 0:04:04
43500 -- [-1545.294] (-1544.126) (-1548.305) (-1554.702) * [-1547.540] (-1543.256) (-1553.237) (-1548.671) -- 0:04:01
44000 -- (-1544.461) (-1548.449) (-1547.645) [-1546.471] * (-1551.039) [-1545.671] (-1545.263) (-1547.816) -- 0:03:59
44500 -- (-1555.213) (-1544.772) [-1545.125] (-1549.941) * (-1559.311) [-1543.486] (-1548.158) (-1545.182) -- 0:03:56
45000 -- (-1544.294) (-1545.823) (-1549.223) [-1548.090] * [-1547.107] (-1544.747) (-1549.924) (-1544.982) -- 0:03:53
Average standard deviation of split frequencies: 0.030744
45500 -- [-1546.177] (-1543.760) (-1545.767) (-1551.891) * (-1543.564) (-1549.332) (-1549.321) [-1543.637] -- 0:03:50
46000 -- [-1548.863] (-1546.916) (-1552.230) (-1547.032) * (-1551.245) (-1543.134) (-1546.003) [-1543.714] -- 0:03:48
46500 -- (-1545.317) (-1552.149) (-1547.223) [-1549.669] * (-1544.232) (-1542.300) [-1545.763] (-1541.265) -- 0:03:45
47000 -- (-1543.682) [-1552.458] (-1550.932) (-1548.075) * (-1542.327) [-1542.946] (-1543.589) (-1548.960) -- 0:04:03
47500 -- [-1546.581] (-1553.317) (-1551.165) (-1542.575) * (-1542.326) (-1546.605) (-1553.914) [-1545.951] -- 0:04:00
48000 -- (-1546.183) (-1554.200) [-1548.343] (-1545.911) * [-1543.976] (-1547.405) (-1550.289) (-1547.321) -- 0:03:58
48500 -- (-1549.019) [-1547.655] (-1552.412) (-1545.647) * [-1548.655] (-1545.951) (-1547.723) (-1556.284) -- 0:03:55
49000 -- [-1544.663] (-1549.055) (-1543.545) (-1550.531) * (-1545.107) (-1550.769) (-1547.119) [-1548.673] -- 0:03:52
49500 -- [-1547.929] (-1544.981) (-1550.222) (-1543.434) * [-1540.080] (-1555.660) (-1551.642) (-1548.918) -- 0:03:50
50000 -- (-1555.085) (-1548.856) (-1545.813) [-1549.133] * [-1547.904] (-1550.448) (-1546.306) (-1552.200) -- 0:03:48
Average standard deviation of split frequencies: 0.012405
50500 -- [-1543.177] (-1550.283) (-1543.578) (-1549.796) * (-1544.810) (-1547.360) [-1545.031] (-1547.645) -- 0:03:45
51000 -- (-1546.295) (-1550.979) [-1546.336] (-1553.411) * (-1543.865) (-1549.686) [-1545.347] (-1543.304) -- 0:03:43
51500 -- (-1548.859) [-1545.953] (-1551.367) (-1548.219) * (-1553.140) [-1546.950] (-1545.048) (-1551.146) -- 0:03:59
52000 -- [-1545.443] (-1556.889) (-1546.104) (-1555.571) * [-1551.468] (-1545.267) (-1548.432) (-1551.197) -- 0:03:57
52500 -- (-1546.128) [-1546.390] (-1548.008) (-1553.908) * [-1545.548] (-1549.018) (-1543.054) (-1550.813) -- 0:03:54
53000 -- (-1543.254) [-1547.761] (-1546.910) (-1551.695) * (-1548.402) [-1543.197] (-1544.054) (-1549.185) -- 0:03:52
53500 -- (-1548.892) (-1548.623) [-1546.736] (-1551.543) * (-1551.633) (-1550.581) [-1545.154] (-1547.328) -- 0:03:49
54000 -- [-1545.613] (-1551.014) (-1543.618) (-1547.408) * (-1546.717) (-1544.980) [-1544.449] (-1547.599) -- 0:03:47
54500 -- [-1543.599] (-1541.774) (-1548.255) (-1547.688) * (-1548.325) (-1544.981) (-1550.611) [-1547.536] -- 0:03:45
55000 -- (-1548.756) [-1548.304] (-1549.980) (-1548.278) * (-1550.606) [-1544.978] (-1546.169) (-1546.481) -- 0:03:43
Average standard deviation of split frequencies: 0.011224
55500 -- [-1548.471] (-1548.939) (-1545.114) (-1545.118) * (-1547.529) (-1545.142) (-1550.157) [-1545.960] -- 0:03:58
56000 -- [-1546.221] (-1547.704) (-1545.353) (-1546.170) * [-1541.075] (-1539.753) (-1551.553) (-1547.799) -- 0:03:56
56500 -- [-1550.488] (-1547.809) (-1553.672) (-1547.817) * (-1545.434) (-1543.715) [-1547.144] (-1547.689) -- 0:03:53
57000 -- (-1548.625) (-1553.435) [-1547.972] (-1552.310) * (-1550.042) (-1544.370) (-1547.614) [-1545.304] -- 0:03:51
57500 -- (-1546.941) (-1546.211) [-1548.241] (-1545.940) * (-1545.473) (-1542.213) [-1548.451] (-1547.205) -- 0:03:49
58000 -- (-1551.259) (-1545.315) (-1546.401) [-1543.288] * (-1549.048) (-1549.937) [-1544.336] (-1548.398) -- 0:03:47
58500 -- (-1545.956) (-1552.431) [-1544.865] (-1545.956) * (-1544.014) (-1549.552) (-1551.259) [-1543.266] -- 0:03:45
59000 -- [-1546.928] (-1547.581) (-1550.394) (-1544.444) * [-1548.588] (-1548.128) (-1545.773) (-1547.079) -- 0:03:43
59500 -- [-1543.674] (-1547.831) (-1547.662) (-1543.278) * (-1547.999) (-1547.820) (-1546.493) [-1545.301] -- 0:03:57
60000 -- (-1549.357) (-1552.566) (-1546.527) [-1546.121] * [-1545.078] (-1547.599) (-1543.160) (-1549.780) -- 0:03:55
Average standard deviation of split frequencies: 0.012951
60500 -- [-1544.930] (-1548.725) (-1546.211) (-1547.387) * [-1547.776] (-1552.539) (-1545.115) (-1544.351) -- 0:03:52
61000 -- [-1542.447] (-1546.321) (-1547.518) (-1549.631) * (-1548.666) [-1541.435] (-1543.234) (-1552.108) -- 0:03:50
61500 -- [-1548.503] (-1544.965) (-1543.409) (-1546.742) * (-1552.929) [-1547.695] (-1543.674) (-1543.164) -- 0:03:48
62000 -- (-1544.997) [-1551.847] (-1545.928) (-1545.715) * (-1553.561) (-1545.319) [-1544.184] (-1548.628) -- 0:03:46
62500 -- (-1549.702) [-1544.924] (-1543.672) (-1555.081) * (-1547.804) (-1548.357) [-1542.989] (-1542.120) -- 0:03:45
63000 -- (-1548.320) [-1543.045] (-1545.330) (-1549.765) * (-1555.394) (-1547.031) (-1550.932) [-1545.797] -- 0:03:43
63500 -- (-1545.982) [-1543.851] (-1546.087) (-1542.223) * (-1551.326) [-1550.420] (-1544.595) (-1546.088) -- 0:03:41
64000 -- (-1547.812) [-1542.240] (-1546.869) (-1544.752) * [-1549.059] (-1548.479) (-1546.718) (-1549.728) -- 0:03:54
64500 -- (-1551.986) [-1545.899] (-1546.609) (-1544.262) * (-1547.309) (-1546.699) [-1547.155] (-1549.574) -- 0:03:52
65000 -- (-1541.051) (-1547.961) [-1549.014] (-1552.886) * (-1548.806) (-1561.487) [-1545.321] (-1547.424) -- 0:03:50
Average standard deviation of split frequencies: 0.014285
65500 -- [-1544.058] (-1546.548) (-1543.963) (-1545.388) * (-1551.350) (-1558.239) [-1545.757] (-1548.151) -- 0:03:48
66000 -- (-1546.570) (-1546.154) [-1544.498] (-1546.224) * [-1549.079] (-1545.266) (-1548.943) (-1552.091) -- 0:03:46
66500 -- (-1548.231) (-1543.859) (-1547.504) [-1545.865] * (-1547.052) (-1553.897) (-1546.400) [-1551.760] -- 0:03:44
67000 -- (-1545.531) (-1545.883) [-1549.809] (-1550.668) * (-1544.445) (-1544.075) [-1545.111] (-1548.289) -- 0:03:42
67500 -- (-1550.334) (-1547.558) [-1546.058] (-1548.062) * (-1545.682) (-1545.936) (-1551.793) [-1547.557] -- 0:03:41
68000 -- [-1544.787] (-1547.628) (-1549.246) (-1544.753) * [-1546.566] (-1543.106) (-1547.314) (-1545.651) -- 0:03:53
68500 -- (-1551.133) (-1547.002) (-1547.456) [-1542.642] * (-1544.200) (-1550.065) [-1552.383] (-1547.581) -- 0:03:51
69000 -- (-1553.648) [-1542.935] (-1544.117) (-1549.593) * (-1546.960) (-1545.171) [-1543.868] (-1546.193) -- 0:03:49
69500 -- [-1547.553] (-1545.309) (-1545.647) (-1553.252) * (-1542.385) (-1549.545) [-1543.404] (-1547.004) -- 0:03:47
70000 -- (-1555.268) [-1543.171] (-1547.932) (-1551.559) * (-1541.941) (-1555.034) [-1545.372] (-1546.085) -- 0:03:45
Average standard deviation of split frequencies: 0.017789
70500 -- (-1556.069) (-1545.785) [-1547.754] (-1547.386) * (-1544.621) [-1545.760] (-1549.237) (-1544.957) -- 0:03:44
71000 -- (-1560.218) (-1541.802) (-1546.257) [-1547.663] * (-1544.603) (-1541.313) (-1553.091) [-1547.179] -- 0:03:42
71500 -- [-1548.667] (-1545.942) (-1547.090) (-1549.951) * (-1546.301) (-1550.852) (-1554.882) [-1547.697] -- 0:03:40
72000 -- [-1545.375] (-1545.809) (-1549.611) (-1551.107) * [-1542.630] (-1545.183) (-1549.982) (-1553.116) -- 0:03:52
72500 -- (-1552.863) [-1548.332] (-1548.753) (-1551.230) * (-1547.947) (-1546.587) (-1544.649) [-1543.391] -- 0:03:50
73000 -- (-1548.006) (-1555.732) (-1544.063) [-1549.079] * [-1546.386] (-1547.330) (-1544.275) (-1545.106) -- 0:03:48
73500 -- (-1545.526) (-1548.967) (-1555.665) [-1549.557] * (-1549.902) (-1548.826) [-1544.196] (-1545.693) -- 0:03:46
74000 -- [-1546.768] (-1545.192) (-1560.425) (-1547.537) * (-1543.271) [-1545.668] (-1547.271) (-1545.070) -- 0:03:45
74500 -- (-1544.323) (-1543.218) (-1545.283) [-1546.257] * (-1542.930) (-1550.815) [-1547.606] (-1548.057) -- 0:03:43
75000 -- (-1547.399) (-1549.121) (-1551.900) [-1546.367] * (-1544.547) (-1547.604) (-1544.876) [-1543.050] -- 0:03:42
Average standard deviation of split frequencies: 0.016541
75500 -- [-1546.619] (-1543.485) (-1549.363) (-1550.313) * (-1547.721) [-1543.294] (-1551.334) (-1543.443) -- 0:03:40
76000 -- (-1547.246) (-1544.796) (-1549.194) [-1545.781] * (-1553.389) (-1545.082) (-1557.926) [-1544.053] -- 0:03:38
76500 -- (-1546.790) [-1546.775] (-1551.718) (-1552.604) * (-1553.197) (-1544.254) [-1547.591] (-1548.958) -- 0:03:49
77000 -- (-1543.813) (-1545.523) [-1545.493] (-1547.573) * [-1548.305] (-1548.782) (-1547.192) (-1545.953) -- 0:03:47
77500 -- (-1547.492) (-1543.978) (-1547.352) [-1553.278] * (-1554.124) [-1545.846] (-1545.207) (-1543.292) -- 0:03:46
78000 -- [-1544.528] (-1544.459) (-1546.584) (-1558.444) * (-1548.659) [-1544.155] (-1551.650) (-1541.578) -- 0:03:44
78500 -- (-1552.147) (-1544.387) [-1552.836] (-1557.211) * (-1551.113) (-1545.563) [-1544.594] (-1544.260) -- 0:03:43
79000 -- (-1544.823) (-1545.048) [-1545.581] (-1550.352) * (-1559.489) [-1546.728] (-1545.592) (-1549.791) -- 0:03:41
79500 -- (-1544.875) [-1543.149] (-1546.993) (-1556.477) * (-1548.987) (-1547.217) (-1542.854) [-1546.319] -- 0:03:39
80000 -- (-1549.144) (-1547.561) [-1552.429] (-1546.593) * (-1553.917) (-1544.512) (-1548.885) [-1547.136] -- 0:03:38
Average standard deviation of split frequencies: 0.013636
80500 -- (-1547.651) (-1546.677) (-1548.360) [-1543.527] * (-1551.001) (-1546.726) [-1546.017] (-1550.963) -- 0:03:48
81000 -- (-1548.009) [-1544.377] (-1547.502) (-1546.322) * [-1543.112] (-1540.503) (-1546.432) (-1548.864) -- 0:03:46
81500 -- (-1542.723) [-1545.276] (-1544.935) (-1545.363) * (-1549.771) (-1545.777) (-1546.276) [-1549.144] -- 0:03:45
82000 -- (-1551.747) [-1546.990] (-1552.817) (-1546.838) * [-1549.559] (-1548.360) (-1546.776) (-1549.418) -- 0:03:43
82500 -- [-1544.421] (-1546.740) (-1546.844) (-1548.159) * [-1550.290] (-1549.833) (-1545.723) (-1551.683) -- 0:03:42
83000 -- (-1558.430) [-1549.811] (-1551.688) (-1550.275) * (-1545.200) [-1546.151] (-1547.489) (-1546.691) -- 0:03:40
83500 -- (-1544.253) (-1545.963) [-1546.708] (-1543.919) * (-1551.097) (-1558.204) (-1545.132) [-1543.365] -- 0:03:39
84000 -- (-1545.144) (-1549.977) (-1549.048) [-1544.349] * (-1547.886) (-1559.130) [-1545.737] (-1543.442) -- 0:03:38
84500 -- (-1547.886) [-1547.210] (-1546.319) (-1541.009) * (-1547.310) [-1549.047] (-1549.758) (-1550.814) -- 0:03:47
85000 -- (-1551.755) (-1547.635) (-1550.509) [-1547.972] * (-1546.975) (-1543.386) (-1544.720) [-1548.598] -- 0:03:46
Average standard deviation of split frequencies: 0.012790
85500 -- (-1556.737) (-1551.137) [-1547.467] (-1544.595) * [-1544.668] (-1547.349) (-1543.529) (-1554.849) -- 0:03:44
86000 -- [-1546.257] (-1549.012) (-1548.679) (-1550.331) * [-1543.821] (-1548.641) (-1542.491) (-1545.287) -- 0:03:43
86500 -- (-1548.170) (-1546.483) [-1547.634] (-1555.567) * [-1542.765] (-1554.594) (-1549.512) (-1548.013) -- 0:03:41
87000 -- (-1547.315) (-1544.518) [-1543.346] (-1551.051) * [-1550.489] (-1552.439) (-1545.363) (-1542.726) -- 0:03:40
87500 -- [-1548.979] (-1546.530) (-1547.891) (-1547.906) * (-1551.933) [-1549.898] (-1548.083) (-1545.967) -- 0:03:39
88000 -- (-1550.850) [-1548.666] (-1548.157) (-1557.036) * [-1543.537] (-1554.174) (-1544.832) (-1550.755) -- 0:03:37
88500 -- (-1550.063) (-1544.205) (-1550.690) [-1543.966] * (-1550.707) (-1544.447) (-1540.982) [-1550.196] -- 0:03:36
89000 -- (-1549.227) (-1544.150) (-1550.512) [-1548.182] * (-1547.058) (-1545.802) [-1543.470] (-1552.766) -- 0:03:45
89500 -- (-1545.630) (-1552.833) [-1540.047] (-1552.594) * [-1542.042] (-1554.929) (-1543.411) (-1548.257) -- 0:03:43
90000 -- (-1548.523) (-1549.021) [-1545.186] (-1543.125) * (-1548.210) [-1545.486] (-1547.866) (-1547.499) -- 0:03:42
Average standard deviation of split frequencies: 0.012132
90500 -- (-1551.109) (-1555.583) (-1545.143) [-1542.327] * [-1542.347] (-1546.954) (-1549.587) (-1547.986) -- 0:03:41
91000 -- [-1542.188] (-1552.857) (-1548.312) (-1544.854) * [-1545.914] (-1548.957) (-1541.378) (-1542.592) -- 0:03:39
91500 -- (-1556.833) (-1549.351) [-1547.938] (-1543.941) * (-1550.912) (-1545.992) (-1542.713) [-1543.416] -- 0:03:38
92000 -- (-1546.291) (-1551.221) [-1549.600] (-1545.960) * (-1543.947) (-1542.928) (-1547.622) [-1544.473] -- 0:03:37
92500 -- [-1543.806] (-1544.720) (-1560.713) (-1549.654) * (-1543.776) (-1546.449) [-1545.543] (-1551.445) -- 0:03:35
93000 -- [-1542.280] (-1543.435) (-1552.462) (-1546.778) * (-1543.794) (-1549.185) [-1543.877] (-1546.865) -- 0:03:44
93500 -- (-1543.738) [-1540.946] (-1545.461) (-1546.557) * [-1545.421] (-1543.725) (-1547.095) (-1547.397) -- 0:03:42
94000 -- (-1548.081) [-1543.779] (-1543.933) (-1542.744) * (-1551.381) (-1547.487) [-1542.505] (-1548.405) -- 0:03:41
94500 -- (-1545.218) (-1544.502) [-1540.164] (-1546.261) * (-1547.779) (-1555.017) [-1543.753] (-1548.203) -- 0:03:40
95000 -- (-1549.455) (-1546.380) [-1542.823] (-1545.135) * (-1546.938) [-1549.931] (-1549.815) (-1550.694) -- 0:03:39
Average standard deviation of split frequencies: 0.016368
95500 -- [-1544.106] (-1546.967) (-1546.342) (-1546.627) * [-1546.704] (-1545.983) (-1552.576) (-1548.279) -- 0:03:37
96000 -- (-1546.178) [-1546.098] (-1549.080) (-1544.203) * (-1553.374) (-1552.712) (-1544.273) [-1546.531] -- 0:03:36
96500 -- [-1541.891] (-1551.785) (-1549.470) (-1549.169) * [-1550.036] (-1555.207) (-1550.920) (-1551.265) -- 0:03:35
97000 -- [-1544.642] (-1543.553) (-1550.456) (-1546.829) * [-1546.279] (-1550.220) (-1545.410) (-1542.196) -- 0:03:43
97500 -- (-1544.193) [-1547.219] (-1542.863) (-1548.916) * (-1551.202) (-1545.275) (-1547.396) [-1548.990] -- 0:03:42
98000 -- (-1545.940) [-1545.966] (-1546.671) (-1554.539) * (-1542.684) (-1545.824) [-1543.935] (-1548.394) -- 0:03:40
98500 -- [-1550.824] (-1544.824) (-1545.960) (-1560.809) * [-1548.012] (-1547.819) (-1544.147) (-1546.646) -- 0:03:39
99000 -- (-1546.379) (-1543.021) (-1547.682) [-1550.653] * [-1547.942] (-1543.730) (-1551.007) (-1549.809) -- 0:03:38
99500 -- [-1545.256] (-1546.560) (-1546.795) (-1551.458) * (-1543.466) (-1552.710) [-1542.106] (-1552.221) -- 0:03:37
100000 -- [-1543.595] (-1546.706) (-1553.185) (-1552.437) * (-1549.501) (-1553.619) (-1546.385) [-1546.155] -- 0:03:36
Average standard deviation of split frequencies: 0.009366
100500 -- [-1543.980] (-1547.409) (-1552.496) (-1555.431) * (-1542.986) [-1549.477] (-1546.715) (-1549.852) -- 0:03:34
101000 -- [-1546.846] (-1543.736) (-1546.619) (-1553.719) * (-1548.051) (-1547.402) [-1548.638] (-1545.009) -- 0:03:42
101500 -- (-1555.205) (-1546.934) [-1547.248] (-1549.435) * [-1544.705] (-1551.916) (-1550.522) (-1548.507) -- 0:03:41
102000 -- [-1548.701] (-1551.272) (-1553.996) (-1555.600) * (-1547.407) (-1548.451) [-1544.266] (-1548.573) -- 0:03:40
102500 -- (-1549.021) (-1548.886) [-1547.298] (-1555.147) * (-1546.358) (-1550.519) [-1544.868] (-1549.633) -- 0:03:38
103000 -- (-1545.793) [-1553.173] (-1549.795) (-1556.962) * [-1547.631] (-1546.350) (-1548.399) (-1550.353) -- 0:03:37
103500 -- (-1554.840) (-1553.926) [-1549.029] (-1551.187) * (-1547.449) (-1546.927) (-1548.471) [-1547.185] -- 0:03:36
104000 -- (-1553.049) (-1555.161) [-1545.996] (-1549.136) * (-1554.592) [-1549.669] (-1547.574) (-1546.134) -- 0:03:35
104500 -- [-1545.893] (-1546.476) (-1545.014) (-1546.016) * (-1550.414) (-1554.242) [-1552.344] (-1551.967) -- 0:03:34
105000 -- (-1548.289) (-1554.055) (-1543.421) [-1543.382] * (-1549.773) (-1551.354) (-1551.142) [-1545.232] -- 0:03:33
Average standard deviation of split frequencies: 0.019271
105500 -- (-1550.464) (-1547.290) [-1543.467] (-1549.236) * (-1545.851) [-1545.968] (-1549.323) (-1550.369) -- 0:03:40
106000 -- (-1548.058) (-1552.098) (-1543.553) [-1547.749] * [-1545.822] (-1543.398) (-1550.266) (-1551.309) -- 0:03:39
106500 -- [-1542.970] (-1546.199) (-1543.929) (-1554.695) * [-1549.222] (-1549.570) (-1554.740) (-1551.488) -- 0:03:38
107000 -- (-1549.383) (-1546.874) (-1546.450) [-1546.501] * [-1551.255] (-1550.702) (-1547.664) (-1559.773) -- 0:03:36
107500 -- (-1546.270) (-1549.627) (-1543.041) [-1545.985] * (-1555.833) (-1548.286) [-1544.859] (-1555.660) -- 0:03:35
108000 -- [-1543.023] (-1547.233) (-1552.908) (-1550.639) * (-1547.218) (-1543.422) [-1542.459] (-1554.762) -- 0:03:34
108500 -- (-1545.521) (-1547.242) [-1546.769] (-1542.680) * (-1547.001) [-1545.958] (-1545.944) (-1558.102) -- 0:03:33
109000 -- (-1556.219) (-1544.814) (-1550.588) [-1539.330] * (-1545.098) (-1547.170) [-1548.830] (-1556.118) -- 0:03:32
109500 -- (-1546.450) (-1544.261) [-1548.984] (-1551.409) * (-1542.967) (-1543.623) [-1543.577] (-1550.562) -- 0:03:39
110000 -- [-1552.107] (-1546.431) (-1556.057) (-1545.645) * (-1550.478) [-1543.101] (-1548.145) (-1550.152) -- 0:03:38
Average standard deviation of split frequencies: 0.018459
110500 -- (-1545.956) (-1550.630) (-1560.269) [-1545.921] * (-1547.652) (-1546.610) [-1553.544] (-1557.711) -- 0:03:37
111000 -- (-1547.636) (-1548.920) (-1546.396) [-1547.630] * (-1546.021) (-1543.349) [-1550.479] (-1552.957) -- 0:03:36
111500 -- (-1545.638) [-1549.939] (-1545.208) (-1544.960) * [-1546.367] (-1549.261) (-1550.113) (-1556.322) -- 0:03:35
112000 -- (-1546.432) (-1545.479) (-1549.151) [-1544.664] * (-1551.406) (-1545.149) (-1545.875) [-1552.555] -- 0:03:34
112500 -- [-1547.453] (-1547.394) (-1547.194) (-1546.731) * (-1554.154) [-1549.406] (-1547.767) (-1552.117) -- 0:03:33
113000 -- [-1544.593] (-1550.208) (-1544.814) (-1546.834) * (-1553.265) [-1549.089] (-1544.112) (-1550.198) -- 0:03:31
113500 -- [-1546.539] (-1548.061) (-1551.286) (-1544.207) * (-1546.752) [-1550.813] (-1540.628) (-1554.141) -- 0:03:38
114000 -- (-1550.407) (-1545.707) (-1547.740) [-1546.274] * (-1548.413) [-1547.364] (-1542.843) (-1551.311) -- 0:03:37
114500 -- [-1548.158] (-1550.725) (-1547.988) (-1551.383) * (-1553.476) [-1548.487] (-1546.068) (-1549.428) -- 0:03:36
115000 -- (-1543.317) (-1552.332) (-1551.029) [-1546.605] * (-1544.876) [-1548.679] (-1547.951) (-1550.644) -- 0:03:35
Average standard deviation of split frequencies: 0.009482
115500 -- (-1548.009) (-1543.659) (-1553.285) [-1550.879] * [-1545.351] (-1546.519) (-1542.614) (-1546.050) -- 0:03:34
116000 -- (-1547.826) (-1547.754) [-1550.220] (-1547.837) * (-1547.864) (-1552.030) [-1546.042] (-1550.580) -- 0:03:33
116500 -- (-1545.141) [-1547.134] (-1548.183) (-1553.584) * [-1548.692] (-1550.640) (-1543.802) (-1555.704) -- 0:03:32
117000 -- (-1547.743) [-1547.911] (-1546.717) (-1545.667) * (-1553.792) [-1546.804] (-1556.846) (-1545.680) -- 0:03:31
117500 -- (-1548.111) (-1555.107) (-1544.375) [-1545.781] * (-1553.762) [-1547.846] (-1553.257) (-1551.333) -- 0:03:30
118000 -- [-1542.704] (-1545.789) (-1548.473) (-1550.322) * (-1547.717) [-1556.265] (-1548.715) (-1552.424) -- 0:03:36
118500 -- (-1544.437) (-1547.433) [-1546.129] (-1550.343) * [-1551.899] (-1550.023) (-1544.107) (-1549.311) -- 0:03:35
119000 -- (-1542.100) (-1540.159) [-1550.465] (-1549.453) * (-1552.316) [-1550.219] (-1543.625) (-1545.464) -- 0:03:34
119500 -- (-1543.620) [-1543.392] (-1553.970) (-1550.639) * [-1547.876] (-1548.153) (-1550.303) (-1546.850) -- 0:03:33
120000 -- (-1545.233) [-1541.083] (-1551.235) (-1551.193) * (-1551.426) (-1546.638) [-1546.046] (-1548.788) -- 0:03:32
Average standard deviation of split frequencies: 0.010418
120500 -- [-1545.683] (-1546.980) (-1548.100) (-1554.362) * (-1552.263) (-1546.105) [-1548.336] (-1546.360) -- 0:03:31
121000 -- [-1542.332] (-1549.194) (-1547.516) (-1552.005) * (-1550.559) (-1548.486) [-1544.115] (-1547.903) -- 0:03:30
121500 -- (-1543.098) (-1551.034) [-1546.873] (-1556.184) * (-1551.506) [-1542.887] (-1547.360) (-1554.458) -- 0:03:29
122000 -- [-1547.405] (-1552.256) (-1552.513) (-1556.103) * (-1552.380) [-1540.721] (-1553.123) (-1545.873) -- 0:03:35
122500 -- (-1548.816) (-1548.572) [-1545.696] (-1553.435) * (-1545.459) (-1544.830) [-1546.364] (-1552.823) -- 0:03:34
123000 -- [-1543.413] (-1548.416) (-1543.062) (-1545.462) * (-1548.945) (-1544.691) (-1552.428) [-1543.193] -- 0:03:33
123500 -- (-1547.891) (-1547.054) [-1543.667] (-1546.937) * [-1542.592] (-1545.736) (-1555.281) (-1543.014) -- 0:03:32
124000 -- (-1543.976) (-1553.776) [-1549.425] (-1552.762) * (-1550.373) (-1542.706) [-1545.445] (-1546.689) -- 0:03:31
124500 -- (-1546.523) (-1547.518) [-1544.887] (-1547.087) * (-1542.357) [-1544.947] (-1547.370) (-1543.998) -- 0:03:30
125000 -- (-1547.048) (-1544.955) [-1545.677] (-1547.479) * [-1542.612] (-1550.248) (-1550.042) (-1551.762) -- 0:03:30
Average standard deviation of split frequencies: 0.004988
125500 -- [-1547.272] (-1544.901) (-1545.904) (-1546.911) * (-1548.586) [-1545.874] (-1544.182) (-1545.694) -- 0:03:29
126000 -- [-1547.626] (-1548.041) (-1555.893) (-1550.536) * (-1549.770) [-1548.288] (-1549.209) (-1548.140) -- 0:03:35
126500 -- (-1551.100) (-1547.503) [-1545.614] (-1548.547) * (-1546.484) [-1544.927] (-1548.246) (-1546.286) -- 0:03:34
127000 -- [-1547.691] (-1545.869) (-1545.201) (-1542.662) * (-1547.588) [-1550.483] (-1547.918) (-1548.127) -- 0:03:33
127500 -- (-1544.570) (-1547.834) [-1549.817] (-1545.966) * [-1543.158] (-1553.158) (-1544.520) (-1545.737) -- 0:03:32
128000 -- (-1544.038) (-1549.226) (-1547.233) [-1552.018] * (-1545.867) (-1547.682) (-1546.650) [-1545.827] -- 0:03:31
128500 -- (-1543.579) (-1555.531) (-1548.114) [-1544.241] * (-1554.493) [-1545.780] (-1545.084) (-1550.685) -- 0:03:30
129000 -- [-1551.910] (-1550.584) (-1548.479) (-1549.518) * [-1545.842] (-1548.600) (-1541.437) (-1549.973) -- 0:03:29
129500 -- (-1549.540) (-1551.960) [-1545.554] (-1548.349) * (-1551.566) (-1545.577) [-1541.788] (-1545.149) -- 0:03:28
130000 -- (-1549.696) [-1549.627] (-1546.649) (-1547.954) * (-1550.903) (-1542.182) [-1545.056] (-1545.632) -- 0:03:27
Average standard deviation of split frequencies: 0.004810
130500 -- (-1549.519) [-1547.152] (-1549.832) (-1550.669) * [-1547.723] (-1546.439) (-1543.967) (-1541.334) -- 0:03:33
131000 -- (-1547.906) (-1550.498) (-1552.549) [-1545.433] * (-1545.413) (-1545.660) (-1546.179) [-1544.863] -- 0:03:32
131500 -- [-1544.907] (-1547.290) (-1549.177) (-1550.891) * [-1549.485] (-1549.459) (-1544.845) (-1541.203) -- 0:03:31
132000 -- [-1548.853] (-1550.169) (-1551.337) (-1547.506) * (-1545.962) (-1551.617) [-1546.668] (-1543.937) -- 0:03:30
132500 -- (-1545.806) (-1546.086) [-1543.632] (-1547.922) * (-1546.032) (-1544.751) (-1544.478) [-1547.600] -- 0:03:29
133000 -- [-1545.139] (-1548.736) (-1548.433) (-1548.800) * (-1552.756) (-1552.062) (-1546.532) [-1546.448] -- 0:03:28
133500 -- (-1543.984) (-1555.412) [-1547.371] (-1549.611) * [-1550.016] (-1547.720) (-1545.646) (-1546.011) -- 0:03:27
134000 -- (-1552.388) [-1548.414] (-1549.581) (-1546.663) * (-1549.435) (-1543.459) [-1544.615] (-1545.994) -- 0:03:26
134500 -- (-1545.117) (-1545.902) (-1545.383) [-1545.023] * (-1542.727) [-1545.516] (-1551.624) (-1541.533) -- 0:03:32
135000 -- (-1546.465) (-1545.521) (-1546.075) [-1544.451] * (-1547.390) (-1549.877) [-1548.786] (-1544.558) -- 0:03:31
Average standard deviation of split frequencies: 0.004622
135500 -- [-1549.342] (-1547.229) (-1550.440) (-1549.305) * [-1547.810] (-1549.471) (-1542.722) (-1552.479) -- 0:03:30
136000 -- (-1549.619) [-1548.860] (-1547.476) (-1544.214) * (-1542.421) (-1547.709) [-1547.135] (-1547.723) -- 0:03:29
136500 -- (-1547.863) [-1547.611] (-1550.761) (-1543.786) * (-1546.820) (-1542.132) [-1549.362] (-1548.368) -- 0:03:28
137000 -- (-1549.214) (-1550.456) (-1554.071) [-1548.922] * (-1545.761) (-1547.531) (-1544.361) [-1542.598] -- 0:03:27
137500 -- (-1551.615) [-1548.703] (-1553.498) (-1548.190) * (-1543.004) (-1549.108) (-1547.342) [-1542.550] -- 0:03:27
138000 -- (-1544.895) (-1547.511) (-1545.507) [-1541.457] * (-1545.939) [-1544.226] (-1548.028) (-1541.624) -- 0:03:26
138500 -- (-1556.854) (-1551.077) [-1543.717] (-1544.568) * (-1545.476) [-1544.296] (-1543.485) (-1545.757) -- 0:03:31
139000 -- (-1547.176) (-1554.395) (-1548.975) [-1545.267] * (-1549.652) (-1544.878) [-1545.165] (-1544.228) -- 0:03:30
139500 -- [-1543.362] (-1547.071) (-1546.251) (-1542.953) * [-1543.135] (-1545.833) (-1546.692) (-1542.762) -- 0:03:29
140000 -- (-1548.825) [-1550.874] (-1547.294) (-1546.114) * (-1545.512) [-1541.532] (-1545.960) (-1545.649) -- 0:03:28
Average standard deviation of split frequencies: 0.006702
140500 -- (-1545.754) (-1557.223) (-1546.142) [-1548.902] * (-1546.047) (-1545.251) (-1552.400) [-1542.424] -- 0:03:27
141000 -- (-1542.167) (-1551.649) [-1546.653] (-1550.979) * [-1545.656] (-1549.341) (-1547.578) (-1544.779) -- 0:03:27
141500 -- (-1550.115) [-1553.190] (-1543.994) (-1551.902) * [-1545.908] (-1544.271) (-1545.279) (-1545.512) -- 0:03:26
142000 -- [-1551.317] (-1545.844) (-1548.413) (-1542.232) * (-1545.892) (-1546.279) [-1547.253] (-1551.213) -- 0:03:25
142500 -- (-1543.926) (-1553.897) (-1547.539) [-1549.487] * (-1549.501) (-1547.851) [-1546.778] (-1545.707) -- 0:03:24
143000 -- [-1544.119] (-1547.830) (-1550.775) (-1542.640) * [-1545.375] (-1546.785) (-1547.655) (-1545.378) -- 0:03:29
143500 -- (-1546.838) (-1551.732) (-1551.534) [-1544.326] * (-1550.670) (-1543.997) (-1549.300) [-1544.686] -- 0:03:28
144000 -- [-1548.212] (-1548.499) (-1544.021) (-1545.651) * (-1550.372) (-1555.800) (-1551.953) [-1543.511] -- 0:03:28
144500 -- (-1547.747) [-1545.866] (-1546.933) (-1550.652) * [-1551.222] (-1542.756) (-1547.451) (-1540.677) -- 0:03:27
145000 -- [-1545.347] (-1550.870) (-1547.741) (-1553.707) * [-1547.429] (-1546.238) (-1545.820) (-1552.157) -- 0:03:26
Average standard deviation of split frequencies: 0.004305
145500 -- (-1543.703) (-1549.288) [-1548.544] (-1544.961) * [-1549.807] (-1551.156) (-1556.826) (-1545.629) -- 0:03:25
146000 -- (-1548.524) [-1552.493] (-1550.956) (-1546.444) * (-1548.445) [-1545.075] (-1559.285) (-1553.779) -- 0:03:24
146500 -- (-1548.152) (-1544.794) [-1549.207] (-1547.778) * (-1549.744) (-1543.707) (-1561.602) [-1550.915] -- 0:03:23
147000 -- (-1544.352) (-1544.577) (-1543.783) [-1548.294] * (-1547.064) [-1545.011] (-1548.477) (-1548.100) -- 0:03:28
147500 -- (-1548.703) [-1543.365] (-1547.193) (-1548.760) * (-1556.439) (-1544.740) (-1554.744) [-1545.706] -- 0:03:28
148000 -- (-1541.693) (-1547.940) [-1549.967] (-1548.124) * (-1550.114) (-1555.499) (-1544.773) [-1541.278] -- 0:03:27
148500 -- [-1550.655] (-1548.163) (-1547.763) (-1550.506) * (-1550.792) (-1548.264) [-1546.415] (-1551.702) -- 0:03:26
149000 -- [-1543.561] (-1546.662) (-1546.688) (-1553.476) * [-1543.821] (-1541.979) (-1548.138) (-1550.458) -- 0:03:25
149500 -- (-1544.220) [-1545.941] (-1550.992) (-1547.317) * [-1547.382] (-1543.783) (-1549.028) (-1547.642) -- 0:03:24
150000 -- [-1545.279] (-1551.781) (-1545.620) (-1548.921) * (-1549.539) (-1546.005) [-1545.226] (-1543.427) -- 0:03:24
Average standard deviation of split frequencies: 0.003129
150500 -- (-1543.071) (-1552.837) [-1547.429] (-1547.495) * (-1554.792) (-1545.797) (-1547.587) [-1548.245] -- 0:03:23
151000 -- [-1545.037] (-1557.250) (-1549.715) (-1551.612) * (-1552.941) [-1548.189] (-1549.408) (-1545.386) -- 0:03:28
151500 -- (-1548.590) [-1545.381] (-1553.370) (-1544.504) * (-1550.925) [-1543.822] (-1546.400) (-1545.981) -- 0:03:27
152000 -- (-1554.654) (-1554.989) (-1546.253) [-1545.992] * (-1551.001) (-1546.539) (-1547.036) [-1543.573] -- 0:03:26
152500 -- [-1541.756] (-1548.046) (-1552.387) (-1549.070) * (-1549.264) (-1553.583) (-1544.288) [-1546.992] -- 0:03:25
153000 -- [-1542.998] (-1549.432) (-1551.312) (-1543.128) * (-1547.308) [-1545.142] (-1543.334) (-1547.272) -- 0:03:24
153500 -- (-1545.280) (-1542.016) [-1547.630] (-1542.989) * (-1544.546) (-1549.854) [-1543.305] (-1547.726) -- 0:03:24
154000 -- (-1548.590) (-1546.990) (-1543.613) [-1545.255] * [-1547.624] (-1547.325) (-1552.397) (-1544.157) -- 0:03:23
154500 -- (-1544.903) [-1544.513] (-1547.630) (-1543.198) * (-1547.710) (-1557.551) [-1541.489] (-1542.813) -- 0:03:22
155000 -- (-1544.735) (-1545.906) [-1544.193] (-1549.658) * (-1543.574) (-1544.748) (-1546.759) [-1543.276] -- 0:03:27
Average standard deviation of split frequencies: 0.009065
155500 -- (-1542.059) (-1546.487) [-1551.469] (-1549.162) * (-1544.653) (-1546.972) (-1550.915) [-1548.589] -- 0:03:26
156000 -- (-1546.042) (-1546.786) [-1553.839] (-1546.542) * (-1549.851) (-1546.469) [-1548.923] (-1550.965) -- 0:03:25
156500 -- (-1548.134) (-1549.151) (-1553.436) [-1540.299] * (-1544.096) (-1545.813) (-1548.486) [-1543.998] -- 0:03:24
157000 -- (-1556.180) (-1542.445) [-1546.253] (-1552.071) * (-1546.807) (-1550.110) [-1545.412] (-1550.591) -- 0:03:24
157500 -- (-1546.319) [-1544.279] (-1543.029) (-1542.697) * (-1546.033) [-1542.189] (-1549.701) (-1548.434) -- 0:03:23
158000 -- (-1546.375) [-1545.203] (-1542.689) (-1547.385) * (-1546.091) [-1546.815] (-1553.163) (-1547.956) -- 0:03:22
158500 -- (-1544.700) (-1548.069) (-1546.640) [-1547.417] * (-1550.970) [-1544.580] (-1545.638) (-1547.958) -- 0:03:21
159000 -- (-1547.103) [-1543.878] (-1544.746) (-1553.587) * (-1545.684) [-1541.873] (-1546.194) (-1545.594) -- 0:03:20
159500 -- (-1546.952) (-1547.973) [-1545.364] (-1552.464) * (-1546.869) (-1547.518) (-1551.304) [-1548.015] -- 0:03:25
160000 -- [-1544.747] (-1543.144) (-1546.577) (-1544.990) * (-1550.823) (-1541.501) [-1549.201] (-1547.810) -- 0:03:24
Average standard deviation of split frequencies: 0.010758
160500 -- [-1545.743] (-1551.483) (-1546.837) (-1548.206) * [-1549.002] (-1546.921) (-1549.817) (-1543.919) -- 0:03:23
161000 -- (-1551.826) [-1545.412] (-1548.112) (-1554.832) * (-1547.735) (-1548.860) [-1546.623] (-1544.984) -- 0:03:23
161500 -- [-1546.732] (-1550.468) (-1542.853) (-1545.570) * [-1545.398] (-1547.303) (-1549.579) (-1552.586) -- 0:03:22
162000 -- (-1546.215) [-1540.603] (-1551.300) (-1547.749) * [-1545.706] (-1548.458) (-1553.353) (-1554.443) -- 0:03:21
162500 -- (-1546.870) [-1542.548] (-1544.835) (-1549.367) * (-1544.196) (-1547.390) (-1552.631) [-1541.589] -- 0:03:21
163000 -- [-1548.751] (-1549.240) (-1548.582) (-1549.694) * [-1543.834] (-1545.543) (-1561.849) (-1551.533) -- 0:03:20
163500 -- (-1542.559) [-1542.059] (-1543.875) (-1551.958) * (-1548.269) (-1551.702) [-1548.024] (-1551.286) -- 0:03:24
164000 -- [-1543.807] (-1549.966) (-1544.827) (-1553.097) * (-1552.075) [-1543.359] (-1552.937) (-1546.937) -- 0:03:23
164500 -- (-1545.418) [-1552.951] (-1551.037) (-1548.062) * (-1548.297) (-1550.482) (-1550.915) [-1551.085] -- 0:03:23
165000 -- (-1542.407) [-1544.975] (-1551.660) (-1546.868) * (-1553.388) (-1547.369) (-1558.464) [-1550.458] -- 0:03:22
Average standard deviation of split frequencies: 0.017985
165500 -- [-1545.719] (-1550.974) (-1550.924) (-1544.605) * [-1547.221] (-1547.793) (-1549.932) (-1551.839) -- 0:03:21
166000 -- (-1545.721) [-1542.919] (-1548.140) (-1542.249) * (-1548.527) [-1548.806] (-1549.333) (-1550.955) -- 0:03:20
166500 -- [-1546.395] (-1542.227) (-1546.035) (-1543.123) * (-1548.589) (-1548.209) [-1545.052] (-1551.969) -- 0:03:20
167000 -- [-1542.254] (-1543.315) (-1547.300) (-1546.012) * (-1547.538) (-1546.819) [-1548.926] (-1549.581) -- 0:03:19
167500 -- (-1548.127) [-1549.557] (-1550.468) (-1546.456) * [-1547.093] (-1552.112) (-1544.690) (-1540.954) -- 0:03:23
168000 -- [-1546.449] (-1549.436) (-1548.729) (-1552.805) * (-1554.188) [-1551.491] (-1545.145) (-1545.638) -- 0:03:23
168500 -- (-1549.886) (-1544.777) [-1544.552] (-1548.446) * (-1556.084) [-1548.012] (-1544.108) (-1549.078) -- 0:03:22
169000 -- [-1547.292] (-1547.436) (-1550.611) (-1548.666) * (-1546.744) (-1548.559) (-1547.961) [-1544.647] -- 0:03:21
169500 -- [-1550.009] (-1551.271) (-1549.243) (-1551.852) * (-1553.127) [-1555.689] (-1552.014) (-1547.060) -- 0:03:20
170000 -- (-1545.283) (-1546.072) [-1545.361] (-1556.889) * (-1552.008) (-1554.799) [-1548.977] (-1547.637) -- 0:03:20
Average standard deviation of split frequencies: 0.018414
170500 -- (-1545.625) [-1550.814] (-1548.003) (-1558.906) * (-1545.851) (-1552.359) (-1544.956) [-1547.030] -- 0:03:19
171000 -- (-1544.477) (-1545.308) [-1543.184] (-1555.143) * (-1544.188) [-1545.164] (-1548.751) (-1547.320) -- 0:03:18
171500 -- [-1551.285] (-1546.823) (-1542.796) (-1555.664) * (-1544.293) (-1551.304) (-1554.041) [-1547.386] -- 0:03:18
172000 -- (-1552.061) (-1543.959) [-1544.255] (-1547.005) * (-1552.028) [-1546.595] (-1549.483) (-1548.370) -- 0:03:22
172500 -- (-1549.328) (-1542.157) [-1547.163] (-1545.554) * (-1551.839) (-1542.567) [-1549.908] (-1547.686) -- 0:03:21
173000 -- (-1550.903) (-1545.702) [-1551.901] (-1543.127) * (-1553.921) [-1544.096] (-1551.563) (-1547.876) -- 0:03:20
173500 -- (-1549.778) (-1544.541) (-1548.256) [-1542.087] * (-1550.478) (-1550.580) (-1552.322) [-1544.875] -- 0:03:20
174000 -- (-1550.840) [-1546.814] (-1548.202) (-1543.418) * (-1550.975) (-1546.936) [-1542.922] (-1542.513) -- 0:03:19
174500 -- (-1551.470) [-1546.698] (-1554.199) (-1544.907) * (-1554.915) (-1549.442) [-1545.913] (-1546.902) -- 0:03:18
175000 -- (-1551.371) (-1544.044) (-1550.445) [-1548.197] * [-1548.243] (-1559.907) (-1545.243) (-1550.163) -- 0:03:18
Average standard deviation of split frequencies: 0.013392
175500 -- (-1546.553) (-1541.935) [-1550.369] (-1549.637) * [-1551.046] (-1553.439) (-1548.747) (-1544.378) -- 0:03:17
176000 -- [-1549.185] (-1544.391) (-1545.732) (-1543.444) * (-1546.164) (-1549.501) (-1548.201) [-1545.002] -- 0:03:21
176500 -- (-1549.629) (-1544.802) (-1551.149) [-1548.769] * (-1547.389) (-1549.205) (-1547.256) [-1542.398] -- 0:03:20
177000 -- (-1548.981) (-1542.936) (-1546.878) [-1547.108] * [-1543.299] (-1544.330) (-1547.854) (-1543.324) -- 0:03:19
177500 -- [-1550.600] (-1542.686) (-1550.335) (-1546.096) * (-1542.606) (-1548.111) [-1546.812] (-1544.065) -- 0:03:19
178000 -- (-1549.959) [-1543.964] (-1544.050) (-1548.702) * [-1557.056] (-1547.556) (-1548.453) (-1546.463) -- 0:03:18
178500 -- (-1545.622) (-1545.705) (-1543.593) [-1546.885] * (-1543.792) (-1551.037) [-1543.997] (-1553.014) -- 0:03:17
179000 -- (-1553.516) (-1544.952) [-1546.771] (-1548.025) * (-1561.311) (-1548.296) [-1541.918] (-1546.687) -- 0:03:17
179500 -- (-1543.519) [-1547.977] (-1547.247) (-1547.356) * (-1547.636) (-1549.952) (-1547.132) [-1543.810] -- 0:03:16
180000 -- (-1550.077) (-1550.284) (-1547.723) [-1546.125] * (-1547.988) (-1545.076) (-1554.305) [-1545.414] -- 0:03:20
Average standard deviation of split frequencies: 0.015656
180500 -- [-1547.816] (-1551.323) (-1554.397) (-1543.102) * [-1554.587] (-1542.435) (-1549.708) (-1541.556) -- 0:03:19
181000 -- (-1550.482) (-1553.776) (-1556.730) [-1542.052] * (-1549.588) (-1541.101) (-1550.348) [-1545.605] -- 0:03:19
181500 -- (-1548.841) (-1548.144) (-1549.084) [-1546.987] * (-1547.931) (-1553.840) [-1545.217] (-1554.273) -- 0:03:18
182000 -- (-1545.538) (-1546.107) (-1550.748) [-1544.960] * (-1550.174) [-1549.226] (-1544.764) (-1556.877) -- 0:03:17
182500 -- [-1548.383] (-1549.675) (-1546.445) (-1548.254) * (-1551.745) (-1548.383) [-1542.405] (-1550.292) -- 0:03:17
183000 -- (-1547.984) [-1543.110] (-1550.927) (-1546.931) * (-1552.251) (-1550.919) [-1544.747] (-1544.343) -- 0:03:16
183500 -- (-1547.204) (-1543.213) [-1550.049] (-1557.595) * (-1550.929) (-1549.082) (-1542.780) [-1544.731] -- 0:03:15
184000 -- [-1545.739] (-1545.206) (-1553.610) (-1549.581) * (-1547.647) (-1546.739) (-1544.073) [-1547.853] -- 0:03:15
184500 -- (-1547.985) (-1545.980) [-1549.538] (-1557.322) * (-1547.946) (-1546.421) [-1545.113] (-1544.608) -- 0:03:18
185000 -- [-1542.319] (-1551.045) (-1542.617) (-1554.705) * (-1544.138) (-1546.618) [-1540.313] (-1556.374) -- 0:03:18
Average standard deviation of split frequencies: 0.021965
185500 -- (-1546.326) (-1553.718) (-1543.330) [-1545.321] * (-1550.889) (-1547.593) (-1546.835) [-1545.193] -- 0:03:17
186000 -- (-1547.090) (-1546.313) [-1542.585] (-1547.210) * (-1554.285) (-1547.576) (-1545.677) [-1549.029] -- 0:03:16
186500 -- [-1545.635] (-1548.547) (-1545.657) (-1546.846) * (-1549.774) [-1550.579] (-1551.991) (-1544.674) -- 0:03:16
187000 -- (-1544.813) [-1544.610] (-1549.468) (-1547.416) * (-1548.091) [-1546.107] (-1543.700) (-1553.784) -- 0:03:15
187500 -- (-1546.989) (-1544.038) [-1549.732] (-1546.235) * [-1543.426] (-1542.778) (-1545.343) (-1554.860) -- 0:03:15
188000 -- [-1542.886] (-1548.628) (-1549.941) (-1554.812) * (-1544.857) (-1540.198) (-1548.908) [-1547.841] -- 0:03:14
188500 -- (-1545.710) (-1551.551) (-1548.432) [-1549.231] * (-1544.423) (-1539.927) (-1553.185) [-1552.778] -- 0:03:18
189000 -- (-1547.252) [-1542.017] (-1545.094) (-1544.825) * (-1546.456) [-1543.035] (-1544.106) (-1550.731) -- 0:03:17
189500 -- (-1543.322) (-1549.194) (-1546.938) [-1545.816] * (-1550.351) (-1548.625) [-1542.465] (-1545.026) -- 0:03:16
190000 -- [-1545.063] (-1544.235) (-1549.291) (-1548.418) * [-1546.081] (-1548.931) (-1547.342) (-1542.861) -- 0:03:16
Average standard deviation of split frequencies: 0.018131
190500 -- (-1548.584) (-1552.078) (-1546.412) [-1543.611] * [-1544.133] (-1549.236) (-1552.404) (-1547.785) -- 0:03:15
191000 -- (-1543.429) (-1543.832) (-1543.986) [-1541.690] * (-1550.222) (-1545.600) [-1547.943] (-1550.173) -- 0:03:14
191500 -- (-1549.720) [-1555.460] (-1545.604) (-1544.830) * (-1561.723) (-1541.814) [-1542.163] (-1550.306) -- 0:03:14
192000 -- (-1545.840) (-1550.870) [-1543.940] (-1543.833) * (-1555.188) [-1547.876] (-1546.815) (-1552.684) -- 0:03:13
192500 -- (-1547.926) (-1545.901) [-1557.709] (-1551.892) * (-1553.636) (-1544.527) [-1548.549] (-1551.518) -- 0:03:17
193000 -- (-1543.685) [-1542.502] (-1546.874) (-1542.336) * [-1547.768] (-1551.931) (-1548.741) (-1555.710) -- 0:03:16
193500 -- [-1543.199] (-1554.881) (-1546.465) (-1544.344) * (-1555.059) (-1552.163) [-1547.765] (-1550.859) -- 0:03:15
194000 -- (-1545.076) (-1549.705) (-1543.188) [-1543.560] * (-1547.905) (-1546.611) (-1546.364) [-1553.567] -- 0:03:15
194500 -- [-1542.075] (-1546.195) (-1544.045) (-1547.421) * (-1547.903) (-1547.289) [-1544.503] (-1554.151) -- 0:03:14
195000 -- (-1549.304) [-1548.291] (-1548.855) (-1546.260) * (-1550.510) (-1546.947) (-1545.393) [-1552.452] -- 0:03:14
Average standard deviation of split frequencies: 0.016836
195500 -- (-1544.244) (-1547.974) (-1546.819) [-1545.935] * [-1545.863] (-1542.076) (-1547.002) (-1548.114) -- 0:03:13
196000 -- (-1544.330) [-1542.770] (-1546.005) (-1543.037) * (-1544.522) [-1544.919] (-1548.057) (-1555.213) -- 0:03:12
196500 -- (-1545.725) [-1544.925] (-1548.651) (-1546.486) * (-1545.258) [-1546.907] (-1546.923) (-1545.806) -- 0:03:12
197000 -- [-1551.822] (-1547.125) (-1555.414) (-1549.640) * [-1543.573] (-1545.660) (-1545.547) (-1548.119) -- 0:03:15
197500 -- (-1549.684) [-1542.513] (-1554.253) (-1549.201) * (-1552.583) (-1544.750) (-1544.002) [-1551.884] -- 0:03:15
198000 -- (-1545.069) (-1548.269) (-1553.566) [-1551.944] * (-1551.075) (-1544.386) [-1543.097] (-1550.298) -- 0:03:14
198500 -- (-1547.652) [-1544.311] (-1556.650) (-1543.938) * (-1547.905) (-1555.089) [-1545.172] (-1547.333) -- 0:03:13
199000 -- [-1544.687] (-1543.625) (-1552.170) (-1547.057) * (-1546.922) (-1541.406) [-1547.172] (-1546.336) -- 0:03:13
199500 -- (-1545.187) [-1543.704] (-1554.704) (-1552.319) * (-1547.224) (-1550.661) [-1544.577] (-1541.337) -- 0:03:12
200000 -- (-1547.427) (-1545.827) [-1545.217] (-1552.613) * (-1554.632) (-1548.042) [-1543.323] (-1543.283) -- 0:03:12
Average standard deviation of split frequencies: 0.016444
200500 -- (-1548.301) (-1551.593) (-1551.290) [-1547.162] * (-1547.776) (-1546.881) [-1544.705] (-1546.972) -- 0:03:11
201000 -- (-1542.581) (-1551.894) [-1542.783] (-1548.609) * (-1549.822) (-1547.770) (-1544.693) [-1546.952] -- 0:03:14
201500 -- (-1545.359) (-1547.607) (-1544.970) [-1553.355] * (-1547.131) (-1550.127) (-1553.315) [-1546.865] -- 0:03:14
202000 -- [-1548.553] (-1547.542) (-1543.480) (-1542.896) * (-1549.444) (-1549.593) (-1549.261) [-1547.717] -- 0:03:13
202500 -- (-1544.520) [-1543.834] (-1545.274) (-1550.441) * (-1548.189) (-1548.096) (-1545.890) [-1548.313] -- 0:03:12
203000 -- (-1547.496) [-1543.440] (-1548.237) (-1546.193) * (-1552.469) (-1554.144) [-1548.495] (-1552.695) -- 0:03:12
203500 -- (-1554.397) (-1550.245) (-1549.355) [-1547.633] * (-1556.504) (-1558.437) [-1544.249] (-1543.397) -- 0:03:11
204000 -- (-1548.344) (-1543.582) (-1547.753) [-1548.670] * (-1557.954) (-1550.196) (-1549.528) [-1547.132] -- 0:03:11
204500 -- [-1552.180] (-1547.007) (-1548.961) (-1555.382) * (-1552.739) [-1544.865] (-1548.004) (-1544.436) -- 0:03:10
205000 -- [-1546.520] (-1549.836) (-1550.755) (-1547.541) * (-1544.448) [-1543.499] (-1548.584) (-1546.819) -- 0:03:13
Average standard deviation of split frequencies: 0.011442
205500 -- (-1551.081) [-1541.856] (-1545.913) (-1545.200) * (-1555.035) [-1540.892] (-1551.649) (-1547.685) -- 0:03:13
206000 -- (-1548.288) [-1543.859] (-1545.801) (-1549.547) * (-1557.915) [-1548.197] (-1556.754) (-1546.186) -- 0:03:12
206500 -- [-1547.816] (-1544.382) (-1544.450) (-1548.780) * (-1551.245) (-1547.082) [-1547.953] (-1547.055) -- 0:03:12
207000 -- (-1543.171) (-1545.177) [-1544.442] (-1548.301) * (-1548.764) [-1546.943] (-1555.405) (-1547.402) -- 0:03:11
207500 -- [-1543.965] (-1552.825) (-1547.202) (-1552.159) * (-1546.394) [-1547.202] (-1557.807) (-1547.350) -- 0:03:10
208000 -- (-1547.199) [-1548.758] (-1551.060) (-1549.172) * (-1545.408) (-1547.148) [-1554.848] (-1553.941) -- 0:03:10
208500 -- (-1542.239) (-1544.844) [-1549.366] (-1549.676) * (-1544.933) (-1552.013) [-1550.537] (-1545.657) -- 0:03:09
209000 -- [-1541.445] (-1545.537) (-1550.641) (-1545.567) * (-1542.295) [-1546.090] (-1551.779) (-1542.352) -- 0:03:09
209500 -- [-1543.440] (-1550.399) (-1551.537) (-1547.282) * (-1543.263) (-1550.101) [-1548.754] (-1551.010) -- 0:03:12
210000 -- [-1544.989] (-1550.108) (-1545.924) (-1544.658) * (-1545.434) (-1545.525) (-1547.630) [-1549.110] -- 0:03:11
Average standard deviation of split frequencies: 0.013426
210500 -- (-1545.606) [-1547.353] (-1543.448) (-1548.176) * (-1543.781) (-1544.856) (-1548.256) [-1543.261] -- 0:03:11
211000 -- (-1557.571) (-1550.678) (-1543.763) [-1548.288] * (-1544.321) (-1546.273) (-1548.187) [-1543.524] -- 0:03:10
211500 -- (-1546.172) (-1551.118) [-1545.949] (-1545.355) * (-1548.479) [-1542.686] (-1547.340) (-1543.347) -- 0:03:10
212000 -- (-1551.430) (-1554.668) (-1546.882) [-1548.604] * (-1549.615) (-1547.346) [-1544.896] (-1554.230) -- 0:03:09
212500 -- (-1546.646) (-1555.406) (-1556.254) [-1548.496] * (-1547.330) [-1545.491] (-1546.490) (-1550.534) -- 0:03:09
213000 -- (-1549.829) (-1551.118) [-1546.947] (-1559.674) * (-1557.408) (-1545.270) (-1545.367) [-1546.605] -- 0:03:08
213500 -- (-1550.883) [-1542.402] (-1551.041) (-1552.487) * [-1558.985] (-1546.057) (-1547.936) (-1549.990) -- 0:03:11
214000 -- (-1544.635) [-1543.895] (-1555.210) (-1546.706) * (-1557.372) (-1546.270) [-1543.000] (-1553.305) -- 0:03:10
214500 -- [-1543.286] (-1549.707) (-1552.185) (-1548.982) * (-1559.026) (-1548.716) [-1545.149] (-1552.320) -- 0:03:10
215000 -- (-1548.894) (-1542.147) (-1555.297) [-1546.215] * (-1550.959) (-1548.573) [-1545.721] (-1547.964) -- 0:03:09
Average standard deviation of split frequencies: 0.020369
215500 -- (-1545.383) (-1549.760) (-1553.250) [-1545.181] * [-1553.198] (-1551.854) (-1554.048) (-1546.762) -- 0:03:09
216000 -- (-1542.258) (-1548.328) (-1556.371) [-1543.842] * (-1546.258) [-1544.579] (-1547.065) (-1547.449) -- 0:03:08
216500 -- (-1544.065) (-1548.257) (-1547.872) [-1548.980] * [-1544.699] (-1554.792) (-1546.825) (-1545.406) -- 0:03:08
217000 -- (-1545.484) (-1546.242) (-1551.361) [-1549.285] * (-1543.591) (-1544.040) [-1545.555] (-1543.296) -- 0:03:07
217500 -- (-1551.782) (-1549.588) (-1546.587) [-1548.609] * (-1542.195) (-1544.807) [-1544.944] (-1546.080) -- 0:03:10
218000 -- (-1545.225) (-1546.754) (-1548.563) [-1544.679] * (-1547.972) [-1546.498] (-1549.560) (-1546.592) -- 0:03:10
218500 -- (-1545.973) [-1542.618] (-1543.371) (-1545.520) * [-1556.185] (-1546.589) (-1553.863) (-1547.355) -- 0:03:09
219000 -- (-1547.791) (-1545.238) [-1549.463] (-1548.026) * (-1550.288) (-1547.218) (-1549.178) [-1547.909] -- 0:03:09
219500 -- (-1544.686) [-1545.416] (-1546.930) (-1555.435) * (-1549.536) (-1547.480) (-1548.460) [-1549.685] -- 0:03:08
220000 -- (-1548.909) [-1548.165] (-1549.610) (-1553.144) * (-1549.818) (-1548.531) (-1541.049) [-1546.021] -- 0:03:07
Average standard deviation of split frequencies: 0.022075
220500 -- (-1547.589) (-1546.869) (-1546.776) [-1546.924] * (-1546.072) [-1544.345] (-1547.236) (-1541.444) -- 0:03:07
221000 -- (-1546.868) (-1551.803) (-1546.955) [-1555.167] * (-1547.360) (-1551.258) [-1545.225] (-1542.038) -- 0:03:06
221500 -- [-1548.130] (-1543.787) (-1546.478) (-1545.138) * (-1549.314) [-1542.210] (-1548.291) (-1548.048) -- 0:03:06
222000 -- (-1546.525) [-1543.650] (-1546.144) (-1545.736) * (-1545.704) (-1543.207) [-1546.351] (-1549.035) -- 0:03:09
222500 -- (-1545.490) (-1543.164) (-1547.159) [-1545.622] * (-1554.801) [-1546.059] (-1544.445) (-1543.992) -- 0:03:08
223000 -- (-1545.404) (-1546.086) [-1549.446] (-1543.366) * (-1554.074) (-1544.946) [-1543.861] (-1542.997) -- 0:03:08
223500 -- [-1546.708] (-1547.911) (-1553.874) (-1545.600) * (-1548.599) (-1547.079) (-1547.047) [-1546.557] -- 0:03:07
224000 -- (-1556.076) (-1542.916) [-1548.265] (-1550.551) * [-1545.503] (-1549.813) (-1548.624) (-1548.207) -- 0:03:07
224500 -- (-1550.625) (-1546.946) (-1545.230) [-1545.954] * (-1549.919) (-1545.997) (-1549.981) [-1544.564] -- 0:03:06
225000 -- (-1542.672) (-1545.495) (-1543.039) [-1550.328] * (-1555.431) (-1548.974) [-1545.834] (-1548.634) -- 0:03:06
Average standard deviation of split frequencies: 0.022249
225500 -- (-1542.139) (-1546.264) [-1546.685] (-1545.867) * (-1551.280) (-1544.820) [-1551.036] (-1547.528) -- 0:03:05
226000 -- [-1548.254] (-1547.380) (-1549.500) (-1549.660) * [-1547.212] (-1542.428) (-1550.032) (-1545.606) -- 0:03:08
226500 -- (-1545.418) (-1542.428) (-1545.973) [-1542.909] * (-1546.403) (-1551.608) [-1549.565] (-1547.571) -- 0:03:07
227000 -- (-1548.573) (-1548.256) [-1543.871] (-1549.474) * (-1552.661) [-1544.462] (-1548.138) (-1548.976) -- 0:03:07
227500 -- (-1547.931) (-1546.201) [-1543.328] (-1543.032) * (-1551.900) [-1543.705] (-1556.235) (-1549.175) -- 0:03:06
228000 -- (-1544.903) (-1542.673) (-1542.913) [-1545.285] * [-1552.062] (-1543.689) (-1543.554) (-1548.945) -- 0:03:06
228500 -- (-1543.232) [-1544.224] (-1548.457) (-1551.060) * (-1549.847) [-1549.894] (-1547.257) (-1544.397) -- 0:03:05
229000 -- [-1545.303] (-1546.022) (-1546.009) (-1546.790) * (-1558.893) (-1543.488) (-1544.452) [-1542.867] -- 0:03:05
229500 -- (-1546.723) (-1545.684) (-1544.444) [-1539.184] * (-1552.989) (-1544.099) (-1552.630) [-1549.054] -- 0:03:04
230000 -- (-1548.836) (-1541.646) (-1547.642) [-1547.642] * (-1549.389) [-1546.348] (-1560.286) (-1550.728) -- 0:03:07
Average standard deviation of split frequencies: 0.020437
230500 -- (-1553.490) [-1544.717] (-1551.699) (-1550.766) * (-1545.276) (-1548.377) [-1541.753] (-1548.896) -- 0:03:06
231000 -- [-1548.851] (-1550.418) (-1549.405) (-1552.983) * (-1544.497) (-1544.801) (-1548.635) [-1550.466] -- 0:03:06
231500 -- (-1548.198) [-1543.780] (-1549.708) (-1547.463) * (-1551.263) (-1545.843) (-1543.022) [-1548.277] -- 0:03:05
232000 -- (-1551.740) [-1544.176] (-1546.799) (-1547.800) * [-1545.927] (-1547.809) (-1543.916) (-1545.844) -- 0:03:05
232500 -- (-1546.510) (-1552.467) (-1553.034) [-1547.859] * (-1543.521) [-1545.922] (-1543.515) (-1542.845) -- 0:03:04
233000 -- (-1552.132) (-1549.314) [-1546.509] (-1545.849) * [-1544.703] (-1545.574) (-1551.197) (-1546.073) -- 0:03:04
233500 -- [-1548.416] (-1556.714) (-1545.611) (-1548.120) * (-1546.636) (-1545.593) (-1548.796) [-1547.755] -- 0:03:03
234000 -- [-1553.736] (-1549.703) (-1546.860) (-1550.732) * (-1542.006) (-1553.822) [-1545.210] (-1543.023) -- 0:03:03
234500 -- (-1544.129) (-1548.706) (-1544.280) [-1545.427] * (-1552.896) (-1546.898) (-1550.151) [-1545.144] -- 0:03:06
235000 -- (-1547.952) [-1544.746] (-1543.636) (-1557.988) * [-1548.565] (-1543.195) (-1549.641) (-1548.438) -- 0:03:05
Average standard deviation of split frequencies: 0.016646
235500 -- (-1545.445) (-1545.571) (-1543.207) [-1553.694] * [-1551.657] (-1546.222) (-1544.135) (-1548.510) -- 0:03:05
236000 -- (-1547.620) (-1543.479) [-1545.809] (-1545.281) * (-1544.862) [-1547.841] (-1553.214) (-1546.641) -- 0:03:04
236500 -- (-1544.211) [-1546.481] (-1550.376) (-1547.794) * (-1543.371) (-1550.456) (-1551.502) [-1547.405] -- 0:03:04
237000 -- (-1541.245) (-1546.450) (-1548.587) [-1545.786] * [-1543.331] (-1551.812) (-1548.682) (-1553.200) -- 0:03:03
237500 -- [-1549.815] (-1556.166) (-1544.485) (-1545.981) * [-1542.347] (-1546.505) (-1553.917) (-1555.358) -- 0:03:03
238000 -- (-1548.073) (-1550.084) [-1541.826] (-1545.760) * (-1547.333) (-1548.267) [-1550.419] (-1556.688) -- 0:03:02
238500 -- (-1548.403) (-1549.018) (-1546.956) [-1547.945] * (-1551.252) (-1550.010) (-1542.808) [-1549.099] -- 0:03:05
239000 -- (-1550.119) (-1551.049) (-1540.955) [-1544.106] * (-1554.794) (-1545.293) [-1546.196] (-1546.291) -- 0:03:04
239500 -- [-1546.821] (-1547.531) (-1543.101) (-1550.208) * [-1547.293] (-1550.305) (-1543.059) (-1546.373) -- 0:03:04
240000 -- [-1547.677] (-1547.981) (-1550.859) (-1543.763) * [-1544.759] (-1551.604) (-1544.049) (-1555.554) -- 0:03:03
Average standard deviation of split frequencies: 0.013058
240500 -- (-1548.784) (-1550.482) (-1547.902) [-1548.440] * [-1550.710] (-1548.457) (-1544.124) (-1550.330) -- 0:03:03
241000 -- (-1551.639) (-1548.328) [-1541.252] (-1547.006) * (-1549.324) [-1547.585] (-1542.362) (-1548.261) -- 0:03:02
241500 -- (-1551.893) (-1545.849) (-1543.273) [-1548.243] * (-1547.210) [-1543.285] (-1547.223) (-1541.693) -- 0:03:02
242000 -- (-1546.618) [-1544.776] (-1543.243) (-1548.861) * (-1546.797) (-1546.492) (-1546.087) [-1544.811] -- 0:03:01
242500 -- [-1546.991] (-1546.662) (-1545.322) (-1551.446) * (-1548.320) (-1544.379) (-1550.807) [-1543.312] -- 0:03:04
243000 -- (-1552.842) (-1547.065) (-1550.751) [-1544.535] * [-1549.070] (-1544.739) (-1544.920) (-1552.161) -- 0:03:03
243500 -- (-1551.952) (-1547.704) (-1549.265) [-1543.066] * [-1541.933] (-1551.071) (-1545.094) (-1554.145) -- 0:03:03
244000 -- (-1545.871) (-1544.495) (-1546.633) [-1546.730] * (-1549.154) [-1547.897] (-1545.176) (-1546.632) -- 0:03:02
244500 -- (-1546.868) (-1547.407) (-1546.485) [-1542.540] * (-1546.628) (-1547.271) (-1544.124) [-1545.231] -- 0:03:02
245000 -- (-1548.507) (-1549.057) (-1554.986) [-1542.382] * (-1551.022) (-1550.017) [-1542.483] (-1543.420) -- 0:03:01
Average standard deviation of split frequencies: 0.014053
245500 -- (-1544.637) (-1549.335) (-1545.708) [-1549.720] * (-1547.248) (-1545.735) [-1542.513] (-1548.287) -- 0:03:01
246000 -- (-1548.704) [-1548.338] (-1550.385) (-1548.262) * (-1549.555) (-1544.505) [-1544.651] (-1544.728) -- 0:03:00
246500 -- (-1542.960) (-1541.708) (-1546.779) [-1547.109] * (-1547.737) [-1547.198] (-1547.264) (-1547.429) -- 0:03:00
247000 -- (-1546.688) [-1546.137] (-1549.187) (-1548.037) * (-1542.603) [-1545.967] (-1552.181) (-1549.056) -- 0:03:02
247500 -- (-1545.795) (-1546.511) [-1547.651] (-1545.853) * [-1542.397] (-1545.482) (-1545.664) (-1545.346) -- 0:03:02
248000 -- (-1543.028) (-1549.757) (-1551.518) [-1540.102] * (-1543.942) [-1547.046] (-1546.230) (-1547.334) -- 0:03:01
248500 -- (-1542.803) (-1551.293) (-1554.760) [-1546.531] * (-1547.717) (-1556.216) [-1541.683] (-1548.668) -- 0:03:01
249000 -- (-1549.135) (-1548.185) [-1545.626] (-1548.339) * (-1547.862) (-1543.352) (-1543.384) [-1545.225] -- 0:03:00
249500 -- (-1549.828) (-1551.520) [-1545.631] (-1545.259) * [-1546.013] (-1544.136) (-1545.035) (-1545.863) -- 0:03:00
250000 -- [-1549.852] (-1549.716) (-1545.258) (-1544.837) * (-1543.931) (-1545.779) (-1547.293) [-1546.266] -- 0:03:00
Average standard deviation of split frequencies: 0.018179
250500 -- (-1551.704) [-1550.408] (-1545.143) (-1547.840) * (-1548.082) [-1545.026] (-1556.467) (-1549.858) -- 0:02:59
251000 -- (-1548.955) (-1549.991) [-1543.908] (-1544.762) * (-1547.424) [-1545.331] (-1547.085) (-1543.620) -- 0:03:02
251500 -- (-1543.390) [-1546.139] (-1546.495) (-1546.546) * (-1544.781) (-1557.205) [-1544.160] (-1543.533) -- 0:03:01
252000 -- (-1546.742) [-1545.026] (-1544.085) (-1542.946) * (-1543.060) (-1551.965) (-1548.182) [-1546.810] -- 0:03:01
252500 -- (-1545.534) (-1546.573) (-1546.990) [-1544.606] * (-1543.879) (-1549.615) [-1542.598] (-1547.559) -- 0:03:00
253000 -- (-1548.785) (-1546.063) (-1543.501) [-1542.803] * (-1548.916) (-1553.855) (-1545.812) [-1546.741] -- 0:03:00
253500 -- (-1551.507) [-1549.780] (-1548.018) (-1549.638) * (-1550.636) (-1547.418) (-1549.334) [-1544.288] -- 0:02:59
254000 -- (-1546.320) [-1549.589] (-1550.319) (-1546.706) * (-1542.275) (-1547.214) [-1545.596] (-1551.159) -- 0:02:59
254500 -- (-1551.928) (-1548.627) [-1551.545] (-1547.733) * (-1555.051) (-1545.920) [-1542.209] (-1552.117) -- 0:02:58
255000 -- (-1544.986) [-1544.897] (-1545.794) (-1547.483) * (-1543.282) (-1548.870) [-1547.838] (-1545.381) -- 0:03:01
Average standard deviation of split frequencies: 0.018414
255500 -- (-1546.116) [-1542.297] (-1547.715) (-1546.569) * (-1544.090) (-1550.478) [-1545.132] (-1549.713) -- 0:03:00
256000 -- (-1544.462) (-1544.465) (-1546.419) [-1544.095] * (-1540.616) [-1544.249] (-1546.279) (-1548.583) -- 0:03:00
256500 -- (-1544.102) [-1546.600] (-1551.619) (-1546.551) * [-1543.181] (-1543.366) (-1547.897) (-1552.332) -- 0:02:59
257000 -- (-1549.758) [-1543.883] (-1552.306) (-1546.535) * (-1544.208) (-1543.385) [-1545.536] (-1542.164) -- 0:02:59
257500 -- (-1547.154) (-1546.817) (-1551.857) [-1547.818] * (-1551.335) (-1545.993) [-1544.379] (-1543.900) -- 0:02:58
258000 -- [-1551.648] (-1550.325) (-1555.111) (-1548.479) * (-1545.033) [-1547.563] (-1545.617) (-1550.972) -- 0:02:58
258500 -- [-1549.777] (-1543.729) (-1549.261) (-1546.338) * (-1547.132) (-1547.532) [-1544.999] (-1547.905) -- 0:02:57
259000 -- (-1554.410) (-1543.654) (-1544.266) [-1544.198] * (-1549.627) (-1551.718) (-1548.972) [-1549.301] -- 0:02:57
259500 -- (-1551.815) [-1542.855] (-1548.491) (-1547.857) * (-1549.292) [-1545.084] (-1550.093) (-1556.215) -- 0:02:59
260000 -- (-1549.095) (-1549.440) [-1546.199] (-1550.215) * (-1548.220) [-1544.687] (-1549.376) (-1550.229) -- 0:02:59
Average standard deviation of split frequencies: 0.022304
260500 -- (-1547.472) [-1547.279] (-1542.852) (-1546.181) * [-1543.199] (-1544.726) (-1551.366) (-1544.434) -- 0:02:58
261000 -- (-1553.363) [-1546.110] (-1545.291) (-1545.410) * (-1544.615) (-1550.256) [-1551.352] (-1558.260) -- 0:02:58
261500 -- (-1544.264) (-1543.941) [-1545.827] (-1542.399) * (-1549.559) (-1549.584) [-1551.583] (-1550.054) -- 0:02:57
262000 -- [-1547.036] (-1548.512) (-1546.657) (-1552.526) * (-1547.282) (-1548.583) (-1551.214) [-1545.795] -- 0:02:57
262500 -- (-1544.806) (-1545.516) (-1548.754) [-1544.184] * [-1543.286] (-1548.145) (-1546.997) (-1545.013) -- 0:02:57
263000 -- [-1548.511] (-1549.385) (-1547.003) (-1550.062) * (-1546.047) [-1547.860] (-1550.902) (-1544.752) -- 0:02:56
263500 -- (-1546.201) (-1546.054) (-1544.348) [-1543.606] * (-1545.085) (-1550.950) (-1545.991) [-1547.468] -- 0:02:58
264000 -- [-1547.523] (-1552.028) (-1552.656) (-1547.594) * (-1545.420) [-1547.484] (-1541.980) (-1549.726) -- 0:02:58
264500 -- (-1548.596) (-1549.812) [-1550.725] (-1545.487) * [-1544.400] (-1546.807) (-1545.854) (-1553.640) -- 0:02:57
265000 -- (-1547.828) [-1547.186] (-1551.946) (-1545.610) * (-1554.368) [-1548.883] (-1548.156) (-1546.906) -- 0:02:57
Average standard deviation of split frequencies: 0.027174
265500 -- (-1558.043) (-1547.763) (-1548.305) [-1544.062] * [-1548.713] (-1547.819) (-1550.220) (-1546.618) -- 0:02:57
266000 -- (-1543.198) (-1554.263) (-1549.507) [-1548.495] * (-1546.286) (-1548.487) [-1545.129] (-1547.350) -- 0:02:56
266500 -- (-1551.131) (-1548.300) (-1542.799) [-1549.598] * (-1540.731) (-1549.441) (-1551.056) [-1546.190] -- 0:02:56
267000 -- [-1554.342] (-1545.779) (-1548.660) (-1545.072) * (-1545.328) [-1546.568] (-1550.051) (-1546.015) -- 0:02:55
267500 -- (-1552.761) [-1544.824] (-1553.937) (-1545.543) * (-1554.374) (-1545.910) (-1543.521) [-1546.533] -- 0:02:57
268000 -- [-1545.369] (-1544.975) (-1548.694) (-1549.019) * (-1547.802) (-1544.915) [-1545.297] (-1549.771) -- 0:02:57
268500 -- (-1548.093) (-1544.276) [-1556.247] (-1546.111) * (-1548.211) (-1545.569) (-1548.889) [-1548.123] -- 0:02:57
269000 -- (-1544.979) [-1545.963] (-1543.349) (-1545.540) * (-1549.458) (-1541.604) [-1543.945] (-1547.153) -- 0:02:56
269500 -- (-1547.999) (-1550.401) [-1545.407] (-1545.400) * (-1546.370) (-1540.330) (-1544.445) [-1551.445] -- 0:02:56
270000 -- (-1542.739) (-1553.264) [-1541.958] (-1551.261) * [-1545.689] (-1550.438) (-1548.383) (-1549.093) -- 0:02:55
Average standard deviation of split frequencies: 0.028447
270500 -- [-1541.704] (-1547.847) (-1552.325) (-1541.913) * (-1545.286) [-1546.461] (-1549.796) (-1548.449) -- 0:02:55
271000 -- (-1545.221) (-1542.630) [-1543.505] (-1542.128) * (-1543.353) (-1545.432) [-1545.729] (-1550.060) -- 0:02:54
271500 -- (-1543.149) (-1545.846) [-1546.429] (-1544.657) * (-1552.944) [-1543.135] (-1550.973) (-1546.002) -- 0:02:57
272000 -- (-1542.978) [-1549.157] (-1547.182) (-1543.734) * (-1556.038) (-1546.583) (-1548.643) [-1541.644] -- 0:02:56
272500 -- (-1544.598) (-1545.880) (-1548.263) [-1543.123] * [-1553.710] (-1543.579) (-1541.895) (-1546.684) -- 0:02:56
273000 -- (-1544.813) [-1543.035] (-1546.970) (-1557.718) * (-1552.650) [-1549.018] (-1545.212) (-1553.240) -- 0:02:55
273500 -- (-1550.115) (-1543.642) [-1547.479] (-1545.979) * (-1543.004) (-1549.569) [-1543.669] (-1552.176) -- 0:02:55
274000 -- (-1546.471) [-1547.345] (-1550.159) (-1547.975) * (-1550.618) (-1545.009) (-1544.404) [-1550.852] -- 0:02:54
274500 -- (-1543.894) [-1544.986] (-1547.071) (-1546.240) * (-1545.880) [-1545.652] (-1543.230) (-1545.771) -- 0:02:54
275000 -- (-1546.256) (-1546.000) (-1548.332) [-1545.047] * (-1543.121) [-1543.422] (-1546.824) (-1548.285) -- 0:02:54
Average standard deviation of split frequencies: 0.028466
275500 -- (-1548.946) (-1543.741) [-1551.501] (-1544.052) * [-1545.615] (-1550.622) (-1548.841) (-1552.852) -- 0:02:56
276000 -- (-1543.882) (-1546.173) (-1547.024) [-1542.492] * (-1552.162) (-1546.785) (-1547.176) [-1551.865] -- 0:02:55
276500 -- (-1550.891) (-1550.337) [-1544.927] (-1543.980) * (-1552.024) (-1550.032) (-1545.618) [-1544.275] -- 0:02:55
277000 -- (-1548.658) (-1557.346) [-1550.285] (-1545.956) * [-1548.292] (-1541.904) (-1544.869) (-1548.085) -- 0:02:54
277500 -- (-1545.752) (-1554.703) (-1542.042) [-1547.129] * [-1551.426] (-1544.773) (-1551.197) (-1550.715) -- 0:02:54
278000 -- (-1553.591) (-1554.998) (-1544.890) [-1545.846] * (-1551.842) (-1551.326) [-1542.332] (-1546.612) -- 0:02:54
278500 -- (-1550.588) [-1548.472] (-1548.455) (-1544.904) * (-1547.612) [-1555.314] (-1548.388) (-1551.081) -- 0:02:53
279000 -- (-1552.011) (-1550.924) (-1545.445) [-1551.140] * (-1554.077) (-1550.531) (-1542.182) [-1551.561] -- 0:02:53
279500 -- (-1548.657) (-1552.562) [-1544.336] (-1550.013) * (-1554.021) (-1549.000) [-1542.574] (-1541.807) -- 0:02:55
280000 -- (-1543.088) (-1550.146) (-1542.269) [-1548.584] * (-1545.471) (-1546.675) (-1550.845) [-1541.698] -- 0:02:54
Average standard deviation of split frequencies: 0.027433
280500 -- (-1541.713) (-1547.409) [-1543.761] (-1545.292) * (-1547.476) (-1549.842) [-1543.998] (-1545.588) -- 0:02:54
281000 -- (-1544.473) (-1557.045) (-1550.690) [-1546.024] * (-1549.495) (-1544.944) (-1548.697) [-1548.701] -- 0:02:53
281500 -- (-1547.275) (-1546.925) (-1545.220) [-1545.140] * (-1549.077) (-1548.321) [-1547.799] (-1548.163) -- 0:02:53
282000 -- (-1550.287) (-1544.305) [-1550.154] (-1545.523) * (-1554.230) [-1546.635] (-1553.319) (-1545.342) -- 0:02:53
282500 -- (-1552.106) [-1543.636] (-1543.008) (-1549.878) * (-1553.782) [-1543.856] (-1547.933) (-1552.007) -- 0:02:52
283000 -- [-1548.229] (-1545.169) (-1542.621) (-1550.057) * [-1544.903] (-1551.189) (-1551.686) (-1543.986) -- 0:02:52
283500 -- (-1547.704) [-1542.886] (-1543.957) (-1546.491) * (-1554.961) [-1544.930] (-1544.399) (-1552.596) -- 0:02:51
284000 -- (-1552.751) [-1545.147] (-1543.226) (-1546.788) * (-1545.391) (-1543.581) (-1546.890) [-1545.449] -- 0:02:53
284500 -- (-1547.636) (-1546.194) (-1548.703) [-1546.136] * (-1548.894) (-1545.584) [-1544.508] (-1546.523) -- 0:02:53
285000 -- (-1546.736) (-1546.779) [-1547.499] (-1546.378) * (-1544.861) (-1546.820) [-1545.540] (-1546.972) -- 0:02:53
Average standard deviation of split frequencies: 0.026372
285500 -- [-1549.628] (-1547.133) (-1555.640) (-1548.476) * (-1546.711) (-1545.040) (-1547.128) [-1541.450] -- 0:02:52
286000 -- (-1550.368) (-1544.023) [-1545.766] (-1552.280) * (-1547.193) (-1542.342) [-1543.380] (-1546.554) -- 0:02:52
286500 -- (-1547.107) [-1543.792] (-1551.318) (-1550.618) * [-1546.725] (-1544.898) (-1544.580) (-1548.259) -- 0:02:51
287000 -- (-1548.771) [-1545.826] (-1549.181) (-1547.913) * (-1547.867) (-1552.915) [-1549.612] (-1543.703) -- 0:02:51
287500 -- (-1552.517) [-1544.890] (-1545.302) (-1543.335) * (-1549.377) [-1547.387] (-1549.561) (-1549.633) -- 0:02:51
288000 -- [-1545.501] (-1546.608) (-1548.668) (-1547.916) * (-1544.882) (-1546.514) (-1542.708) [-1545.212] -- 0:02:53
288500 -- (-1545.870) (-1557.425) [-1545.322] (-1554.510) * (-1542.179) (-1551.740) [-1544.452] (-1548.132) -- 0:02:52
289000 -- (-1549.585) (-1543.459) (-1553.495) [-1547.132] * (-1550.032) (-1557.546) (-1550.444) [-1544.535] -- 0:02:52
289500 -- [-1544.169] (-1547.779) (-1542.676) (-1544.689) * [-1542.584] (-1552.414) (-1545.734) (-1547.212) -- 0:02:51
290000 -- (-1547.298) [-1544.417] (-1543.669) (-1550.456) * (-1550.482) (-1552.217) [-1550.568] (-1546.761) -- 0:02:51
Average standard deviation of split frequencies: 0.025949
290500 -- (-1547.191) (-1545.630) (-1548.612) [-1548.623] * (-1547.205) (-1551.991) [-1548.093] (-1551.247) -- 0:02:50
291000 -- [-1544.450] (-1548.744) (-1549.192) (-1547.155) * (-1547.042) (-1546.113) (-1544.968) [-1543.090] -- 0:02:50
291500 -- (-1542.308) (-1543.920) [-1549.176] (-1542.137) * (-1546.997) [-1548.580] (-1549.841) (-1547.440) -- 0:02:50
292000 -- (-1545.161) [-1547.052] (-1545.786) (-1542.866) * (-1552.306) (-1551.265) (-1547.326) [-1542.980] -- 0:02:52
292500 -- (-1545.816) [-1546.476] (-1549.629) (-1542.219) * (-1543.527) (-1553.328) (-1549.602) [-1547.481] -- 0:02:51
293000 -- (-1544.738) (-1549.570) [-1548.038] (-1551.231) * (-1549.600) [-1544.172] (-1546.285) (-1545.850) -- 0:02:51
293500 -- (-1546.910) [-1548.211] (-1550.613) (-1559.248) * (-1546.672) (-1545.672) [-1541.997] (-1549.889) -- 0:02:50
294000 -- (-1546.385) (-1548.654) (-1553.763) [-1547.616] * (-1547.903) (-1542.042) (-1551.549) [-1542.313] -- 0:02:50
294500 -- (-1548.651) [-1546.451] (-1544.109) (-1546.926) * (-1546.911) (-1546.543) (-1545.434) [-1544.861] -- 0:02:50
295000 -- (-1551.981) (-1543.907) [-1548.848] (-1557.304) * (-1546.485) (-1546.831) (-1544.907) [-1549.698] -- 0:02:49
Average standard deviation of split frequencies: 0.023889
295500 -- (-1553.451) (-1542.575) (-1548.902) [-1549.250] * (-1552.620) (-1548.043) [-1550.151] (-1544.296) -- 0:02:49
296000 -- (-1547.460) (-1543.476) (-1549.906) [-1547.885] * (-1553.604) (-1551.360) (-1550.379) [-1543.472] -- 0:02:51
296500 -- (-1561.336) (-1548.292) (-1543.654) [-1547.501] * [-1552.236] (-1550.827) (-1547.931) (-1547.142) -- 0:02:50
297000 -- (-1555.852) [-1550.324] (-1547.563) (-1550.588) * (-1553.225) (-1549.226) (-1540.874) [-1544.027] -- 0:02:50
297500 -- [-1549.183] (-1546.492) (-1553.672) (-1543.373) * (-1547.234) (-1550.058) (-1542.954) [-1548.726] -- 0:02:50
298000 -- (-1548.390) (-1542.952) [-1546.555] (-1552.105) * (-1548.741) (-1543.373) (-1545.814) [-1546.699] -- 0:02:49
298500 -- (-1548.049) (-1544.226) [-1544.955] (-1550.512) * (-1551.453) (-1540.812) [-1544.494] (-1547.522) -- 0:02:49
299000 -- (-1545.385) (-1546.287) (-1542.314) [-1541.924] * (-1550.713) (-1542.195) [-1544.423] (-1545.313) -- 0:02:48
299500 -- (-1553.497) [-1545.892] (-1544.252) (-1546.681) * (-1556.782) (-1548.879) (-1543.149) [-1542.552] -- 0:02:48
300000 -- (-1549.527) (-1547.503) (-1540.810) [-1543.424] * (-1552.005) [-1550.842] (-1543.199) (-1543.409) -- 0:02:48
Average standard deviation of split frequencies: 0.023518
300500 -- (-1549.600) (-1543.716) [-1542.700] (-1547.160) * (-1558.570) [-1551.107] (-1543.480) (-1552.426) -- 0:02:49
301000 -- (-1549.148) [-1544.015] (-1546.711) (-1550.120) * (-1549.432) (-1547.044) (-1549.667) [-1545.058] -- 0:02:49
301500 -- (-1547.555) [-1544.526] (-1550.633) (-1546.562) * (-1546.519) [-1545.170] (-1548.244) (-1543.578) -- 0:02:49
302000 -- (-1546.241) [-1545.719] (-1548.352) (-1545.711) * (-1550.694) (-1549.857) [-1544.563] (-1546.980) -- 0:02:48
302500 -- (-1551.170) [-1545.999] (-1547.453) (-1558.418) * (-1555.157) (-1548.597) [-1547.117] (-1554.687) -- 0:02:48
303000 -- (-1547.176) [-1542.565] (-1549.239) (-1550.881) * (-1554.025) (-1548.198) [-1549.678] (-1548.167) -- 0:02:47
303500 -- (-1548.389) [-1541.454] (-1546.842) (-1552.259) * (-1559.131) (-1547.496) [-1546.442] (-1546.349) -- 0:02:47
304000 -- (-1548.410) (-1548.255) [-1549.869] (-1551.617) * (-1554.171) [-1548.029] (-1546.733) (-1548.787) -- 0:02:47
304500 -- (-1557.833) (-1545.569) (-1550.096) [-1545.031] * (-1556.600) (-1547.728) [-1542.178] (-1555.493) -- 0:02:49
305000 -- (-1549.383) (-1548.901) (-1547.373) [-1554.388] * (-1545.979) (-1546.877) [-1545.436] (-1550.296) -- 0:02:48
Average standard deviation of split frequencies: 0.023622
305500 -- (-1548.172) (-1548.341) (-1546.949) [-1549.546] * (-1544.570) (-1554.872) [-1547.032] (-1545.872) -- 0:02:48
306000 -- (-1545.245) (-1545.741) (-1547.489) [-1544.359] * [-1549.728] (-1555.210) (-1548.687) (-1542.850) -- 0:02:47
306500 -- (-1553.432) (-1545.126) [-1546.414] (-1546.879) * (-1551.673) (-1553.141) [-1545.405] (-1544.927) -- 0:02:47
307000 -- (-1551.553) (-1548.229) (-1549.370) [-1543.216] * (-1547.187) (-1547.301) [-1549.924] (-1553.812) -- 0:02:47
307500 -- (-1546.354) (-1543.921) (-1546.280) [-1542.293] * (-1547.183) (-1547.727) [-1547.265] (-1548.662) -- 0:02:46
308000 -- (-1548.815) (-1547.698) [-1549.182] (-1550.256) * (-1551.495) (-1553.908) [-1553.701] (-1550.524) -- 0:02:46
308500 -- (-1547.474) (-1547.013) (-1547.098) [-1542.820] * (-1550.202) [-1545.728] (-1550.852) (-1550.707) -- 0:02:48
309000 -- [-1550.614] (-1549.148) (-1553.212) (-1545.513) * (-1549.378) (-1552.819) (-1551.297) [-1544.923] -- 0:02:47
309500 -- (-1541.101) [-1548.692] (-1544.984) (-1550.965) * [-1553.083] (-1548.463) (-1551.182) (-1546.398) -- 0:02:47
310000 -- (-1542.912) (-1543.579) (-1544.612) [-1551.991] * (-1545.546) (-1555.906) (-1552.365) [-1543.893] -- 0:02:46
Average standard deviation of split frequencies: 0.021749
310500 -- [-1544.171] (-1545.025) (-1546.186) (-1559.464) * (-1544.182) (-1552.341) [-1551.889] (-1547.020) -- 0:02:46
311000 -- (-1549.842) [-1544.977] (-1548.377) (-1554.430) * (-1543.736) (-1550.112) (-1550.020) [-1545.649] -- 0:02:46
311500 -- (-1541.661) (-1541.785) [-1544.237] (-1557.749) * (-1544.259) [-1552.203] (-1544.314) (-1548.923) -- 0:02:45
312000 -- (-1545.308) [-1541.486] (-1545.494) (-1562.977) * (-1549.211) (-1549.577) [-1548.036] (-1548.904) -- 0:02:45
312500 -- (-1546.364) [-1542.014] (-1547.275) (-1555.698) * (-1544.625) [-1550.332] (-1550.902) (-1547.963) -- 0:02:47
313000 -- (-1543.673) [-1548.767] (-1550.444) (-1548.933) * (-1550.715) [-1556.633] (-1548.753) (-1544.762) -- 0:02:46
313500 -- (-1552.032) (-1547.860) [-1545.628] (-1543.435) * (-1547.052) (-1555.304) (-1543.508) [-1550.782] -- 0:02:46
314000 -- (-1550.276) (-1544.399) [-1546.002] (-1548.543) * (-1548.385) (-1551.369) [-1543.212] (-1548.349) -- 0:02:46
314500 -- (-1551.113) (-1549.090) (-1546.456) [-1548.280] * (-1546.149) (-1546.796) (-1547.090) [-1547.191] -- 0:02:45
315000 -- (-1543.635) [-1547.415] (-1543.688) (-1548.957) * (-1551.979) [-1544.112] (-1546.435) (-1551.623) -- 0:02:45
Average standard deviation of split frequencies: 0.021880
315500 -- [-1542.082] (-1550.668) (-1546.084) (-1552.094) * (-1546.768) [-1543.252] (-1547.331) (-1542.973) -- 0:02:44
316000 -- (-1549.016) [-1541.798] (-1542.881) (-1543.970) * (-1548.388) (-1551.134) (-1543.192) [-1545.418] -- 0:02:44
316500 -- (-1547.005) (-1547.297) (-1546.730) [-1545.048] * (-1557.468) (-1547.923) [-1545.815] (-1543.188) -- 0:02:46
317000 -- [-1544.282] (-1548.746) (-1551.160) (-1550.024) * (-1544.826) (-1545.918) [-1543.527] (-1545.035) -- 0:02:45
317500 -- (-1547.457) (-1546.639) (-1547.318) [-1546.880] * (-1544.765) (-1546.049) [-1547.098] (-1553.367) -- 0:02:45
318000 -- (-1545.761) (-1551.103) (-1549.707) [-1544.909] * (-1544.766) [-1544.847] (-1547.846) (-1557.591) -- 0:02:45
318500 -- (-1546.734) [-1544.515] (-1545.382) (-1546.920) * (-1543.653) [-1543.746] (-1546.929) (-1554.642) -- 0:02:44
319000 -- (-1547.124) (-1555.339) (-1543.503) [-1547.405] * [-1547.640] (-1548.717) (-1547.300) (-1547.631) -- 0:02:44
319500 -- (-1545.713) [-1549.368] (-1545.596) (-1555.865) * [-1546.522] (-1547.271) (-1550.956) (-1545.691) -- 0:02:44
320000 -- (-1544.178) (-1549.963) (-1550.017) [-1547.576] * [-1549.871] (-1546.991) (-1550.029) (-1546.274) -- 0:02:43
Average standard deviation of split frequencies: 0.022051
320500 -- (-1550.298) [-1548.185] (-1551.020) (-1555.940) * (-1556.398) (-1548.154) (-1549.315) [-1544.201] -- 0:02:43
321000 -- (-1554.145) (-1545.498) [-1548.583] (-1552.100) * (-1555.441) (-1544.677) [-1549.554] (-1546.736) -- 0:02:44
321500 -- (-1550.900) (-1544.131) (-1544.592) [-1550.018] * (-1551.651) (-1549.162) [-1546.601] (-1546.651) -- 0:02:44
322000 -- (-1551.029) (-1549.474) [-1544.555] (-1544.457) * (-1543.631) [-1550.087] (-1546.344) (-1546.156) -- 0:02:44
322500 -- (-1548.981) (-1546.378) [-1546.046] (-1547.640) * (-1550.308) (-1552.834) (-1549.274) [-1542.837] -- 0:02:43
323000 -- [-1545.526] (-1546.858) (-1546.087) (-1545.446) * (-1553.031) [-1551.739] (-1550.488) (-1548.486) -- 0:02:43
323500 -- (-1544.491) (-1548.931) [-1545.328] (-1547.173) * [-1543.807] (-1544.295) (-1548.974) (-1544.967) -- 0:02:43
324000 -- (-1550.033) (-1549.707) [-1545.160] (-1548.093) * (-1542.430) (-1549.213) (-1555.471) [-1542.707] -- 0:02:42
324500 -- (-1543.561) (-1543.129) (-1552.342) [-1542.621] * [-1541.641] (-1552.176) (-1542.437) (-1551.697) -- 0:02:42
325000 -- (-1544.693) (-1545.286) (-1549.836) [-1549.200] * (-1543.278) (-1549.677) (-1541.914) [-1545.293] -- 0:02:44
Average standard deviation of split frequencies: 0.023618
325500 -- (-1546.214) (-1552.475) (-1547.609) [-1546.801] * (-1547.808) [-1546.146] (-1542.620) (-1550.459) -- 0:02:43
326000 -- [-1543.087] (-1550.178) (-1543.778) (-1550.596) * (-1549.106) (-1541.334) [-1544.296] (-1542.978) -- 0:02:43
326500 -- (-1543.925) (-1549.774) [-1541.664] (-1545.608) * [-1543.166] (-1548.919) (-1549.490) (-1549.137) -- 0:02:42
327000 -- [-1540.917] (-1552.155) (-1543.020) (-1546.483) * [-1542.610] (-1544.257) (-1548.068) (-1546.187) -- 0:02:42
327500 -- [-1543.494] (-1550.046) (-1549.448) (-1543.786) * (-1545.113) [-1544.416] (-1548.137) (-1544.990) -- 0:02:42
328000 -- (-1549.175) (-1548.012) (-1545.128) [-1546.406] * (-1545.295) [-1544.378] (-1545.458) (-1545.295) -- 0:02:41
328500 -- (-1545.999) [-1542.069] (-1548.394) (-1550.279) * (-1551.448) [-1545.343] (-1544.488) (-1543.150) -- 0:02:41
329000 -- (-1544.188) [-1544.043] (-1547.079) (-1547.145) * (-1555.204) (-1542.365) (-1550.522) [-1546.124] -- 0:02:43
329500 -- (-1550.418) (-1552.750) (-1544.897) [-1549.641] * (-1551.460) (-1554.020) (-1546.948) [-1543.024] -- 0:02:42
330000 -- (-1546.607) [-1549.484] (-1545.738) (-1547.297) * [-1543.406] (-1546.080) (-1545.301) (-1543.951) -- 0:02:42
Average standard deviation of split frequencies: 0.021384
330500 -- [-1549.435] (-1548.866) (-1548.242) (-1549.892) * (-1545.266) [-1546.398] (-1543.527) (-1543.612) -- 0:02:42
331000 -- (-1551.892) [-1543.939] (-1545.037) (-1551.499) * [-1546.346] (-1550.309) (-1549.158) (-1541.480) -- 0:02:41
331500 -- (-1551.086) [-1544.363] (-1549.925) (-1551.028) * [-1544.584] (-1547.742) (-1548.899) (-1545.195) -- 0:02:41
332000 -- (-1547.022) (-1547.103) (-1550.522) [-1547.758] * (-1551.908) (-1547.302) [-1551.204] (-1545.721) -- 0:02:40
332500 -- (-1542.728) (-1549.446) [-1548.245] (-1552.927) * (-1545.775) [-1547.043] (-1550.143) (-1548.274) -- 0:02:40
333000 -- (-1546.282) [-1545.076] (-1546.557) (-1545.108) * (-1547.559) (-1545.093) (-1550.672) [-1549.488] -- 0:02:42
333500 -- (-1549.299) [-1546.711] (-1548.042) (-1548.691) * (-1551.447) [-1547.788] (-1550.412) (-1543.598) -- 0:02:41
334000 -- [-1551.354] (-1543.986) (-1548.080) (-1553.354) * (-1545.802) (-1552.235) (-1550.044) [-1545.488] -- 0:02:41
334500 -- (-1542.608) (-1544.618) (-1546.293) [-1554.248] * [-1549.914] (-1562.203) (-1546.160) (-1546.499) -- 0:02:41
335000 -- (-1543.205) [-1545.644] (-1541.837) (-1554.534) * [-1547.264] (-1550.488) (-1543.993) (-1546.150) -- 0:02:40
Average standard deviation of split frequencies: 0.023383
335500 -- [-1547.237] (-1549.177) (-1544.764) (-1548.292) * [-1548.222] (-1550.343) (-1548.648) (-1551.102) -- 0:02:40
336000 -- (-1550.755) (-1544.763) (-1544.935) [-1546.915] * (-1549.163) (-1547.932) [-1546.263] (-1548.994) -- 0:02:40
336500 -- (-1545.944) [-1549.252] (-1547.516) (-1552.147) * (-1551.651) [-1543.589] (-1546.752) (-1550.495) -- 0:02:39
337000 -- [-1549.171] (-1549.466) (-1547.908) (-1548.757) * [-1550.222] (-1543.685) (-1549.021) (-1546.140) -- 0:02:41
337500 -- (-1549.431) (-1544.953) (-1547.461) [-1543.151] * (-1544.244) (-1544.177) [-1546.672] (-1549.933) -- 0:02:40
338000 -- (-1550.247) [-1542.763] (-1545.341) (-1547.020) * (-1558.819) [-1550.712] (-1551.738) (-1545.394) -- 0:02:40
338500 -- (-1547.236) [-1545.568] (-1546.569) (-1544.827) * [-1555.601] (-1550.459) (-1547.326) (-1555.358) -- 0:02:40
339000 -- [-1545.342] (-1546.384) (-1552.165) (-1546.323) * (-1544.955) (-1543.157) [-1544.301] (-1548.967) -- 0:02:39
339500 -- [-1543.778] (-1546.027) (-1552.852) (-1549.734) * (-1551.763) (-1547.223) [-1547.710] (-1548.887) -- 0:02:39
340000 -- (-1545.723) (-1543.959) [-1551.294] (-1544.766) * (-1553.658) (-1543.232) (-1545.895) [-1544.159] -- 0:02:39
Average standard deviation of split frequencies: 0.017989
340500 -- [-1544.087] (-1549.284) (-1552.525) (-1550.061) * (-1553.184) (-1545.176) [-1546.846] (-1548.264) -- 0:02:38
341000 -- [-1552.646] (-1549.718) (-1550.482) (-1550.576) * [-1545.838] (-1551.313) (-1551.421) (-1551.555) -- 0:02:38
341500 -- (-1546.329) (-1549.623) (-1548.656) [-1543.434] * (-1553.523) (-1544.167) [-1544.104] (-1547.489) -- 0:02:40
342000 -- (-1547.510) (-1547.062) [-1545.627] (-1545.392) * (-1553.125) (-1546.826) [-1545.451] (-1545.514) -- 0:02:39
342500 -- [-1548.452] (-1551.959) (-1546.676) (-1552.189) * [-1541.990] (-1546.892) (-1549.891) (-1548.679) -- 0:02:39
343000 -- (-1547.668) (-1550.670) [-1545.893] (-1553.203) * [-1546.761] (-1554.663) (-1551.093) (-1553.554) -- 0:02:38
343500 -- (-1546.166) [-1550.604] (-1554.018) (-1554.434) * (-1545.688) (-1556.530) [-1550.310] (-1544.011) -- 0:02:38
344000 -- [-1550.367] (-1545.362) (-1550.767) (-1553.280) * [-1546.892] (-1561.425) (-1553.469) (-1544.383) -- 0:02:38
344500 -- (-1549.154) [-1548.830] (-1556.212) (-1547.966) * (-1548.385) (-1551.967) (-1550.911) [-1542.525] -- 0:02:37
345000 -- (-1542.689) [-1545.533] (-1552.309) (-1546.790) * (-1546.355) (-1546.908) [-1543.437] (-1542.982) -- 0:02:37
Average standard deviation of split frequencies: 0.016349
345500 -- (-1545.746) (-1552.050) [-1547.298] (-1548.987) * (-1548.088) (-1545.090) (-1545.702) [-1545.337] -- 0:02:39
346000 -- (-1547.060) (-1550.251) [-1553.586] (-1545.409) * (-1554.488) (-1549.181) (-1545.603) [-1546.097] -- 0:02:38
346500 -- [-1545.914] (-1545.937) (-1545.081) (-1542.372) * [-1548.010] (-1549.367) (-1559.096) (-1543.164) -- 0:02:38
347000 -- (-1548.196) (-1543.021) (-1546.125) [-1547.685] * (-1553.974) [-1547.912] (-1542.659) (-1545.689) -- 0:02:38
347500 -- [-1553.107] (-1547.037) (-1540.630) (-1551.721) * (-1546.990) [-1547.278] (-1544.851) (-1549.342) -- 0:02:37
348000 -- (-1548.087) (-1548.377) (-1548.519) [-1544.648] * (-1545.487) (-1548.619) [-1548.513] (-1557.526) -- 0:02:37
348500 -- (-1549.022) (-1547.364) (-1547.948) [-1544.830] * (-1555.823) (-1546.268) [-1544.621] (-1545.018) -- 0:02:37
349000 -- (-1551.522) (-1546.671) (-1543.547) [-1545.877] * (-1550.125) (-1554.472) (-1550.020) [-1544.575] -- 0:02:36
349500 -- [-1545.669] (-1549.389) (-1547.178) (-1547.688) * (-1547.688) (-1551.484) [-1542.692] (-1546.829) -- 0:02:38
350000 -- (-1551.069) [-1545.705] (-1551.165) (-1546.725) * (-1546.663) (-1559.596) (-1548.799) [-1541.859] -- 0:02:37
Average standard deviation of split frequencies: 0.016580
350500 -- (-1551.822) (-1548.061) [-1543.727] (-1542.858) * (-1546.437) [-1549.254] (-1547.347) (-1545.847) -- 0:02:37
351000 -- (-1552.137) (-1547.837) (-1553.247) [-1542.579] * [-1545.024] (-1548.037) (-1548.787) (-1546.732) -- 0:02:37
351500 -- (-1553.594) (-1548.908) (-1543.164) [-1545.404] * [-1547.204] (-1553.636) (-1549.869) (-1545.632) -- 0:02:36
352000 -- [-1547.083] (-1558.144) (-1543.330) (-1543.534) * [-1543.464] (-1547.059) (-1544.960) (-1548.430) -- 0:02:36
352500 -- (-1549.512) [-1552.496] (-1550.276) (-1549.396) * (-1545.343) (-1547.007) [-1542.000] (-1546.086) -- 0:02:36
353000 -- (-1549.242) (-1554.594) (-1554.657) [-1543.466] * [-1545.547] (-1547.200) (-1542.817) (-1550.473) -- 0:02:35
353500 -- (-1548.439) (-1548.108) (-1551.678) [-1542.731] * (-1546.663) (-1545.566) [-1547.250] (-1547.896) -- 0:02:37
354000 -- (-1544.346) [-1546.829] (-1548.198) (-1544.768) * (-1549.446) (-1553.829) (-1550.469) [-1546.678] -- 0:02:36
354500 -- [-1548.804] (-1543.512) (-1546.497) (-1549.562) * [-1548.545] (-1548.062) (-1546.527) (-1547.287) -- 0:02:36
355000 -- (-1548.116) (-1543.414) (-1549.137) [-1545.039] * (-1546.077) (-1545.341) [-1549.803] (-1547.867) -- 0:02:36
Average standard deviation of split frequencies: 0.011918
355500 -- [-1544.134] (-1554.400) (-1548.820) (-1547.268) * [-1543.485] (-1546.571) (-1541.987) (-1551.133) -- 0:02:35
356000 -- (-1543.259) [-1549.397] (-1550.536) (-1543.478) * [-1542.179] (-1546.889) (-1544.257) (-1551.078) -- 0:02:35
356500 -- [-1546.524] (-1548.222) (-1553.530) (-1545.219) * [-1545.286] (-1550.450) (-1548.400) (-1551.249) -- 0:02:35
357000 -- (-1540.930) (-1547.179) (-1545.478) [-1544.974] * (-1552.443) (-1549.860) (-1544.792) [-1544.478] -- 0:02:34
357500 -- (-1547.835) [-1548.833] (-1553.897) (-1546.904) * (-1549.816) [-1553.240] (-1545.117) (-1545.402) -- 0:02:36
358000 -- (-1547.089) (-1550.292) [-1553.344] (-1549.198) * (-1545.861) (-1547.844) [-1543.944] (-1546.316) -- 0:02:36
358500 -- (-1545.137) (-1552.655) [-1553.542] (-1547.650) * (-1549.167) (-1543.982) [-1550.948] (-1545.910) -- 0:02:35
359000 -- (-1549.076) (-1552.677) [-1553.785] (-1547.111) * [-1548.215] (-1545.236) (-1550.888) (-1545.410) -- 0:02:35
359500 -- [-1546.758] (-1543.936) (-1550.313) (-1544.981) * [-1547.770] (-1545.993) (-1553.081) (-1543.784) -- 0:02:35
360000 -- (-1544.037) (-1546.672) (-1548.116) [-1543.565] * (-1547.141) (-1547.524) (-1557.860) [-1543.826] -- 0:02:34
Average standard deviation of split frequencies: 0.008278
360500 -- (-1545.865) [-1550.505] (-1548.077) (-1544.005) * (-1550.302) (-1542.328) [-1544.510] (-1546.781) -- 0:02:34
361000 -- (-1543.595) (-1551.287) (-1542.638) [-1542.361] * (-1550.922) [-1550.401] (-1546.595) (-1556.376) -- 0:02:33
361500 -- [-1547.862] (-1548.224) (-1543.586) (-1552.389) * (-1545.783) (-1545.064) [-1543.873] (-1549.966) -- 0:02:33
362000 -- (-1548.519) [-1540.113] (-1541.991) (-1547.087) * (-1544.107) (-1551.520) (-1546.003) [-1544.725] -- 0:02:35
362500 -- (-1552.240) (-1544.472) [-1547.735] (-1555.226) * (-1553.873) (-1548.033) [-1549.047] (-1548.059) -- 0:02:34
363000 -- (-1552.289) [-1541.445] (-1546.444) (-1546.439) * (-1547.701) (-1543.288) (-1542.671) [-1549.421] -- 0:02:34
363500 -- (-1546.102) (-1548.253) [-1545.065] (-1545.898) * (-1544.328) [-1540.864] (-1544.184) (-1548.345) -- 0:02:34
364000 -- (-1544.012) (-1546.744) [-1546.301] (-1545.937) * (-1543.387) (-1542.978) (-1545.372) [-1542.284] -- 0:02:33
364500 -- (-1554.026) (-1549.557) (-1545.360) [-1544.227] * [-1542.552] (-1541.757) (-1546.110) (-1545.628) -- 0:02:33
365000 -- (-1545.633) (-1545.476) [-1541.750] (-1551.186) * (-1544.144) (-1544.746) (-1553.061) [-1544.409] -- 0:02:33
Average standard deviation of split frequencies: 0.007299
365500 -- (-1543.137) (-1543.647) (-1542.888) [-1545.558] * (-1550.005) (-1542.091) (-1544.467) [-1544.349] -- 0:02:32
366000 -- (-1542.286) [-1545.482] (-1542.479) (-1543.227) * (-1547.939) (-1543.907) [-1547.190] (-1542.621) -- 0:02:34
366500 -- [-1547.774] (-1542.653) (-1544.313) (-1548.072) * (-1545.253) [-1544.296] (-1548.061) (-1546.952) -- 0:02:33
367000 -- [-1544.313] (-1553.684) (-1547.901) (-1547.804) * [-1544.471] (-1542.301) (-1550.423) (-1546.571) -- 0:02:33
367500 -- (-1546.717) (-1544.789) (-1546.240) [-1543.825] * (-1545.212) (-1544.233) [-1545.290] (-1556.357) -- 0:02:33
368000 -- (-1554.499) (-1543.700) (-1548.023) [-1544.330] * (-1547.540) [-1543.990] (-1547.879) (-1550.191) -- 0:02:32
368500 -- [-1545.716] (-1547.058) (-1550.260) (-1550.088) * (-1546.110) (-1548.539) [-1546.501] (-1551.023) -- 0:02:32
369000 -- (-1543.998) (-1544.482) (-1549.075) [-1544.224] * [-1544.445] (-1541.647) (-1547.527) (-1551.378) -- 0:02:32
369500 -- (-1541.328) [-1542.984] (-1546.121) (-1543.223) * (-1545.591) [-1545.728] (-1546.939) (-1548.599) -- 0:02:31
370000 -- (-1545.043) (-1543.009) [-1545.663] (-1540.900) * (-1545.293) (-1549.018) [-1550.966] (-1549.182) -- 0:02:33
Average standard deviation of split frequencies: 0.008055
370500 -- (-1551.017) (-1545.711) (-1550.030) [-1543.418] * [-1544.484] (-1545.108) (-1550.133) (-1551.243) -- 0:02:32
371000 -- (-1545.086) (-1548.923) [-1545.170] (-1543.081) * [-1542.283] (-1546.991) (-1548.478) (-1551.775) -- 0:02:32
371500 -- (-1543.193) (-1549.135) (-1547.244) [-1543.977] * (-1547.648) (-1545.167) (-1545.089) [-1546.447] -- 0:02:32
372000 -- (-1547.304) (-1547.346) [-1547.039] (-1548.274) * (-1543.549) [-1542.065] (-1544.792) (-1549.934) -- 0:02:31
372500 -- (-1544.544) (-1551.072) [-1542.917] (-1544.566) * (-1549.361) (-1547.581) (-1544.131) [-1545.040] -- 0:02:31
373000 -- (-1550.322) (-1544.329) (-1546.903) [-1547.644] * [-1544.788] (-1544.569) (-1545.540) (-1546.182) -- 0:02:31
373500 -- [-1542.844] (-1549.034) (-1551.668) (-1547.267) * [-1543.822] (-1545.961) (-1549.938) (-1543.118) -- 0:02:30
374000 -- (-1547.371) (-1550.264) (-1549.616) [-1545.307] * [-1550.261] (-1549.761) (-1551.455) (-1544.115) -- 0:02:32
374500 -- (-1548.363) [-1546.169] (-1547.581) (-1547.364) * (-1543.346) (-1545.348) (-1551.343) [-1544.633] -- 0:02:31
375000 -- (-1552.094) (-1551.944) [-1553.058] (-1545.631) * [-1545.450] (-1544.598) (-1543.631) (-1547.588) -- 0:02:31
Average standard deviation of split frequencies: 0.007522
375500 -- [-1545.371] (-1548.361) (-1548.748) (-1545.566) * (-1547.984) (-1548.732) (-1547.405) [-1546.889] -- 0:02:31
376000 -- (-1554.152) [-1548.263] (-1542.189) (-1549.037) * (-1550.392) (-1547.878) [-1543.655] (-1545.991) -- 0:02:31
376500 -- (-1546.483) (-1555.237) [-1543.716] (-1554.111) * (-1558.432) (-1550.076) (-1552.486) [-1546.765] -- 0:02:30
377000 -- (-1546.720) [-1547.891] (-1548.540) (-1547.938) * (-1544.979) (-1548.761) (-1547.946) [-1548.755] -- 0:02:30
377500 -- [-1540.433] (-1545.986) (-1550.359) (-1549.047) * (-1548.580) (-1549.648) [-1550.093] (-1544.333) -- 0:02:30
378000 -- (-1553.656) (-1545.205) (-1545.654) [-1544.756] * (-1543.846) (-1550.143) (-1546.889) [-1540.832] -- 0:02:31
378500 -- (-1544.452) (-1542.372) (-1546.499) [-1543.471] * (-1548.681) (-1545.135) [-1545.376] (-1544.227) -- 0:02:31
379000 -- [-1545.359] (-1545.001) (-1545.849) (-1546.355) * (-1546.522) (-1551.097) (-1543.855) [-1544.333] -- 0:02:30
379500 -- (-1547.849) [-1550.679] (-1546.804) (-1548.991) * (-1547.222) (-1553.835) [-1544.246] (-1551.175) -- 0:02:30
380000 -- (-1544.321) (-1548.733) (-1549.920) [-1548.427] * [-1547.955] (-1552.701) (-1549.919) (-1549.475) -- 0:02:30
Average standard deviation of split frequencies: 0.008669
380500 -- [-1543.887] (-1550.380) (-1546.010) (-1545.041) * [-1544.619] (-1547.311) (-1549.631) (-1543.936) -- 0:02:29
381000 -- (-1544.015) (-1544.572) (-1549.634) [-1547.245] * (-1542.190) (-1550.453) (-1545.360) [-1544.152] -- 0:02:29
381500 -- [-1550.024] (-1551.985) (-1548.614) (-1549.128) * (-1546.798) (-1545.539) (-1543.722) [-1545.784] -- 0:02:29
382000 -- (-1549.499) (-1553.189) [-1546.197] (-1547.234) * (-1547.555) (-1547.772) [-1547.537] (-1544.856) -- 0:02:28
382500 -- (-1546.626) (-1544.866) [-1543.189] (-1551.457) * (-1543.176) (-1544.478) [-1547.509] (-1543.040) -- 0:02:30
383000 -- (-1551.658) [-1547.762] (-1543.548) (-1550.403) * (-1551.744) (-1546.462) (-1552.304) [-1546.185] -- 0:02:29
383500 -- [-1545.135] (-1549.759) (-1545.993) (-1547.469) * (-1547.637) (-1547.457) (-1544.273) [-1545.420] -- 0:02:29
384000 -- (-1546.224) (-1559.827) (-1546.067) [-1555.180] * (-1547.569) (-1546.193) (-1547.720) [-1548.117] -- 0:02:29
384500 -- (-1552.207) (-1547.644) (-1548.793) [-1551.117] * (-1552.364) [-1548.348] (-1546.084) (-1545.462) -- 0:02:28
385000 -- [-1543.289] (-1551.396) (-1551.753) (-1551.991) * [-1545.311] (-1545.759) (-1548.299) (-1546.498) -- 0:02:28
Average standard deviation of split frequencies: 0.007735
385500 -- [-1540.597] (-1549.932) (-1547.779) (-1555.184) * (-1543.842) (-1546.284) (-1546.946) [-1550.290] -- 0:02:28
386000 -- (-1545.012) [-1547.103] (-1546.849) (-1545.251) * (-1549.228) (-1553.957) [-1544.290] (-1552.340) -- 0:02:27
386500 -- [-1548.967] (-1552.300) (-1545.348) (-1551.023) * (-1545.096) (-1552.518) [-1542.264] (-1544.715) -- 0:02:29
387000 -- [-1552.279] (-1552.210) (-1544.157) (-1547.414) * (-1550.185) [-1550.815] (-1544.591) (-1547.422) -- 0:02:28
387500 -- (-1545.222) (-1551.393) (-1545.465) [-1544.109] * (-1541.585) [-1548.907] (-1548.264) (-1555.417) -- 0:02:28
388000 -- (-1549.293) (-1551.291) (-1548.687) [-1549.848] * (-1545.092) (-1558.432) [-1543.233] (-1552.484) -- 0:02:28
388500 -- (-1544.676) [-1548.215] (-1543.399) (-1549.461) * (-1544.332) (-1546.865) [-1543.909] (-1545.057) -- 0:02:27
389000 -- (-1545.972) (-1544.510) (-1545.333) [-1548.201] * [-1551.936] (-1551.553) (-1550.631) (-1547.351) -- 0:02:27
389500 -- (-1555.655) (-1552.654) [-1550.238] (-1543.173) * [-1549.950] (-1551.148) (-1553.641) (-1541.791) -- 0:02:27
390000 -- [-1547.331] (-1542.810) (-1560.901) (-1550.158) * (-1546.267) (-1548.097) (-1550.600) [-1549.580] -- 0:02:27
Average standard deviation of split frequencies: 0.009653
390500 -- (-1549.982) (-1546.709) (-1551.576) [-1544.369] * (-1556.836) (-1552.457) [-1542.416] (-1549.346) -- 0:02:28
391000 -- (-1548.410) [-1543.205] (-1548.982) (-1549.892) * (-1555.104) (-1544.172) [-1546.747] (-1550.851) -- 0:02:27
391500 -- (-1552.551) [-1546.854] (-1552.637) (-1542.968) * (-1550.258) [-1546.797] (-1543.784) (-1553.456) -- 0:02:27
392000 -- (-1547.736) (-1548.097) [-1546.516] (-1546.135) * [-1544.964] (-1556.664) (-1548.074) (-1553.413) -- 0:02:27
392500 -- (-1547.229) (-1547.092) [-1543.708] (-1547.498) * [-1545.511] (-1546.097) (-1549.440) (-1549.996) -- 0:02:27
393000 -- [-1547.181] (-1553.827) (-1547.900) (-1544.838) * [-1550.790] (-1550.834) (-1544.363) (-1547.686) -- 0:02:26
393500 -- (-1552.484) (-1550.854) (-1550.860) [-1548.168] * [-1547.317] (-1553.561) (-1552.967) (-1551.073) -- 0:02:26
394000 -- (-1544.720) (-1553.139) (-1544.559) [-1546.216] * (-1547.320) (-1544.416) (-1550.746) [-1550.627] -- 0:02:26
394500 -- (-1550.912) [-1549.521] (-1550.447) (-1549.384) * (-1545.093) (-1544.148) (-1547.920) [-1547.205] -- 0:02:25
395000 -- [-1547.320] (-1555.273) (-1546.124) (-1549.621) * [-1549.721] (-1553.132) (-1544.075) (-1553.570) -- 0:02:27
Average standard deviation of split frequencies: 0.010714
395500 -- [-1541.851] (-1557.114) (-1545.586) (-1545.754) * (-1552.197) (-1546.760) (-1548.734) [-1545.048] -- 0:02:26
396000 -- [-1547.252] (-1549.462) (-1552.559) (-1546.509) * (-1548.714) (-1549.156) [-1547.620] (-1550.770) -- 0:02:26
396500 -- (-1549.517) (-1545.275) (-1549.394) [-1550.208] * (-1544.368) (-1549.423) [-1547.418] (-1555.865) -- 0:02:26
397000 -- (-1542.550) [-1543.534] (-1553.631) (-1542.723) * (-1546.825) (-1545.386) [-1540.867] (-1548.130) -- 0:02:25
397500 -- (-1542.135) (-1544.100) [-1549.741] (-1549.550) * [-1543.451] (-1547.466) (-1547.296) (-1545.372) -- 0:02:25
398000 -- (-1545.197) [-1541.481] (-1548.866) (-1543.913) * (-1547.378) [-1548.257] (-1545.279) (-1546.042) -- 0:02:25
398500 -- (-1548.873) [-1542.310] (-1550.297) (-1548.833) * (-1544.155) (-1548.320) [-1544.712] (-1548.576) -- 0:02:24
399000 -- (-1546.717) (-1543.662) (-1548.277) [-1543.574] * (-1541.249) (-1554.005) [-1547.304] (-1543.780) -- 0:02:26
399500 -- (-1544.345) [-1547.065] (-1554.882) (-1543.331) * (-1542.999) (-1546.109) (-1548.494) [-1546.851] -- 0:02:25
400000 -- (-1544.834) [-1545.896] (-1549.567) (-1544.209) * [-1546.872] (-1552.042) (-1553.000) (-1548.370) -- 0:02:25
Average standard deviation of split frequencies: 0.012158
400500 -- (-1546.731) (-1550.727) [-1543.891] (-1550.520) * [-1553.695] (-1550.865) (-1550.908) (-1549.184) -- 0:02:25
401000 -- (-1549.346) [-1552.300] (-1547.585) (-1548.457) * (-1547.894) (-1548.108) (-1546.615) [-1548.767] -- 0:02:24
401500 -- [-1548.335] (-1553.663) (-1544.465) (-1544.759) * (-1546.609) [-1545.202] (-1553.022) (-1552.157) -- 0:02:24
402000 -- (-1543.749) (-1547.313) (-1545.105) [-1549.653] * (-1545.059) (-1546.530) (-1554.178) [-1549.087] -- 0:02:24
402500 -- (-1546.045) (-1552.984) [-1544.444] (-1541.614) * [-1541.790] (-1549.779) (-1545.527) (-1545.063) -- 0:02:23
403000 -- (-1546.438) (-1550.874) [-1542.445] (-1545.362) * [-1540.821] (-1545.871) (-1550.810) (-1547.992) -- 0:02:25
403500 -- (-1550.882) (-1552.043) [-1544.848] (-1547.873) * (-1546.867) (-1546.479) [-1544.949] (-1550.318) -- 0:02:24
404000 -- [-1543.548] (-1548.337) (-1548.654) (-1547.823) * (-1544.761) (-1548.935) (-1551.282) [-1551.228] -- 0:02:24
404500 -- [-1546.601] (-1552.627) (-1543.424) (-1551.102) * (-1547.212) (-1548.686) (-1546.510) [-1551.708] -- 0:02:24
405000 -- [-1553.156] (-1545.810) (-1545.425) (-1548.569) * (-1554.512) (-1545.706) (-1546.317) [-1544.720] -- 0:02:23
Average standard deviation of split frequencies: 0.013546
405500 -- (-1550.953) [-1552.730] (-1547.313) (-1549.018) * (-1543.163) [-1545.964] (-1546.397) (-1547.678) -- 0:02:23
406000 -- (-1546.970) [-1545.285] (-1545.741) (-1555.873) * [-1551.786] (-1545.959) (-1545.870) (-1546.536) -- 0:02:23
406500 -- (-1549.384) [-1550.716] (-1549.426) (-1546.720) * (-1545.697) (-1551.299) (-1541.495) [-1543.828] -- 0:02:23
407000 -- [-1545.932] (-1545.515) (-1551.047) (-1548.620) * (-1546.581) [-1548.837] (-1551.243) (-1544.627) -- 0:02:22
407500 -- (-1548.215) (-1548.702) (-1543.647) [-1544.964] * (-1549.813) (-1549.454) (-1547.749) [-1547.185] -- 0:02:23
408000 -- [-1550.351] (-1548.131) (-1550.743) (-1550.897) * (-1544.121) (-1549.873) [-1550.097] (-1547.793) -- 0:02:23
408500 -- (-1550.969) (-1546.145) [-1545.052] (-1554.297) * (-1545.175) (-1549.445) (-1548.747) [-1550.396] -- 0:02:23
409000 -- (-1549.932) (-1550.182) [-1541.129] (-1554.640) * [-1549.150] (-1543.913) (-1544.233) (-1545.817) -- 0:02:23
409500 -- (-1546.521) (-1542.039) [-1544.565] (-1548.902) * [-1545.395] (-1545.715) (-1545.984) (-1564.445) -- 0:02:22
410000 -- (-1547.692) (-1550.474) (-1546.143) [-1546.731] * [-1547.155] (-1546.848) (-1546.944) (-1548.746) -- 0:02:22
Average standard deviation of split frequencies: 0.015305
410500 -- (-1545.938) (-1549.986) [-1552.677] (-1551.121) * (-1551.183) (-1547.157) [-1558.254] (-1546.190) -- 0:02:22
411000 -- [-1547.363] (-1555.696) (-1543.938) (-1547.862) * (-1551.678) (-1546.887) [-1545.469] (-1545.814) -- 0:02:21
411500 -- [-1541.346] (-1548.887) (-1543.604) (-1555.990) * (-1543.265) [-1556.471] (-1549.535) (-1547.605) -- 0:02:23
412000 -- (-1545.316) (-1545.483) (-1548.444) [-1545.838] * (-1549.738) [-1548.412] (-1545.367) (-1542.225) -- 0:02:22
412500 -- (-1541.381) (-1549.714) [-1544.282] (-1544.467) * (-1551.297) (-1548.764) (-1555.659) [-1545.969] -- 0:02:22
413000 -- (-1547.860) (-1545.567) (-1547.200) [-1546.990] * (-1549.821) [-1544.582] (-1549.095) (-1542.733) -- 0:02:22
413500 -- (-1547.437) (-1550.916) [-1548.043] (-1545.627) * [-1549.035] (-1546.558) (-1546.330) (-1550.915) -- 0:02:21
414000 -- (-1550.123) [-1548.938] (-1548.741) (-1542.130) * (-1552.305) [-1543.749] (-1549.179) (-1547.381) -- 0:02:21
414500 -- (-1549.600) (-1547.143) [-1546.303] (-1546.663) * (-1543.869) (-1546.402) [-1552.390] (-1546.385) -- 0:02:21
415000 -- (-1549.193) (-1546.933) (-1544.877) [-1546.892] * [-1545.434] (-1554.189) (-1547.165) (-1545.687) -- 0:02:20
Average standard deviation of split frequencies: 0.017375
415500 -- (-1548.381) [-1546.141] (-1544.650) (-1546.080) * [-1544.003] (-1543.985) (-1547.206) (-1547.345) -- 0:02:22
416000 -- (-1549.289) (-1546.741) (-1546.877) [-1542.609] * (-1546.990) (-1544.677) (-1543.740) [-1546.916] -- 0:02:21
416500 -- [-1552.855] (-1543.407) (-1553.104) (-1551.618) * (-1545.467) (-1548.110) [-1542.410] (-1549.965) -- 0:02:21
417000 -- (-1553.283) (-1547.736) [-1543.963] (-1551.387) * (-1547.095) [-1552.795] (-1553.727) (-1550.415) -- 0:02:21
417500 -- [-1546.904] (-1548.986) (-1558.097) (-1551.398) * [-1551.094] (-1548.241) (-1551.807) (-1548.313) -- 0:02:20
418000 -- (-1548.546) [-1547.347] (-1548.086) (-1540.907) * [-1551.368] (-1546.276) (-1544.547) (-1546.837) -- 0:02:20
418500 -- (-1544.976) [-1544.891] (-1552.277) (-1548.117) * [-1543.289] (-1554.208) (-1548.995) (-1545.241) -- 0:02:20
419000 -- (-1553.467) (-1548.523) [-1546.364] (-1550.486) * [-1543.481] (-1550.296) (-1546.251) (-1540.987) -- 0:02:20
419500 -- (-1545.618) [-1542.313] (-1551.351) (-1547.637) * (-1548.456) (-1543.006) (-1543.697) [-1553.007] -- 0:02:19
420000 -- (-1549.972) [-1547.711] (-1543.345) (-1544.958) * [-1547.101] (-1546.543) (-1543.058) (-1545.911) -- 0:02:20
Average standard deviation of split frequencies: 0.020545
420500 -- [-1547.199] (-1546.090) (-1545.351) (-1547.119) * (-1549.785) (-1551.692) (-1551.567) [-1545.294] -- 0:02:20
421000 -- (-1547.825) [-1547.096] (-1546.834) (-1546.030) * [-1544.832] (-1547.318) (-1545.266) (-1551.851) -- 0:02:20
421500 -- (-1551.927) [-1543.627] (-1546.545) (-1540.705) * (-1549.174) (-1546.739) [-1544.376] (-1548.057) -- 0:02:19
422000 -- (-1554.311) [-1549.444] (-1548.557) (-1543.237) * (-1545.731) (-1545.111) [-1546.883] (-1546.059) -- 0:02:19
422500 -- (-1548.644) (-1552.578) (-1543.690) [-1544.268] * [-1545.513] (-1551.085) (-1554.370) (-1544.800) -- 0:02:19
423000 -- (-1548.941) (-1548.953) [-1546.246] (-1546.574) * (-1547.102) (-1549.185) (-1547.082) [-1544.714] -- 0:02:19
423500 -- (-1545.823) (-1552.223) (-1547.577) [-1547.357] * (-1551.134) (-1548.784) [-1545.169] (-1546.334) -- 0:02:18
424000 -- (-1553.217) [-1553.168] (-1549.023) (-1549.567) * (-1547.406) [-1544.010] (-1552.739) (-1552.785) -- 0:02:19
424500 -- (-1543.657) [-1541.326] (-1549.782) (-1554.573) * (-1551.638) [-1546.864] (-1544.303) (-1553.431) -- 0:02:19
425000 -- (-1544.516) [-1543.484] (-1553.009) (-1549.388) * (-1548.789) (-1542.164) (-1545.442) [-1549.727] -- 0:02:19
Average standard deviation of split frequencies: 0.019550
425500 -- (-1548.131) (-1544.798) [-1546.609] (-1550.713) * (-1552.515) (-1545.321) [-1544.280] (-1551.304) -- 0:02:19
426000 -- (-1557.097) (-1545.015) [-1549.693] (-1549.853) * (-1547.803) (-1547.276) [-1544.220] (-1548.446) -- 0:02:18
426500 -- (-1553.578) [-1544.340] (-1549.365) (-1552.774) * [-1547.320] (-1549.204) (-1548.103) (-1544.985) -- 0:02:18
427000 -- [-1549.984] (-1545.684) (-1544.322) (-1558.141) * [-1545.712] (-1542.955) (-1546.281) (-1549.255) -- 0:02:18
427500 -- [-1544.607] (-1544.908) (-1547.058) (-1551.371) * (-1551.537) (-1552.734) (-1545.164) [-1548.985] -- 0:02:17
428000 -- (-1547.934) [-1543.122] (-1546.382) (-1546.356) * (-1549.334) (-1543.926) [-1545.008] (-1547.416) -- 0:02:18
428500 -- (-1542.655) [-1544.368] (-1550.750) (-1549.951) * (-1546.763) [-1549.123] (-1550.725) (-1551.303) -- 0:02:18
429000 -- [-1543.796] (-1545.722) (-1561.340) (-1544.467) * (-1556.733) (-1549.198) [-1547.843] (-1548.463) -- 0:02:18
429500 -- (-1547.242) (-1547.267) [-1548.066] (-1546.546) * [-1559.598] (-1546.386) (-1547.389) (-1548.858) -- 0:02:18
430000 -- (-1543.290) (-1548.411) [-1548.836] (-1559.532) * [-1549.183] (-1545.215) (-1549.096) (-1546.192) -- 0:02:17
Average standard deviation of split frequencies: 0.017513
430500 -- (-1547.176) [-1545.823] (-1556.092) (-1548.524) * [-1546.920] (-1554.799) (-1549.456) (-1554.606) -- 0:02:17
431000 -- (-1542.797) (-1547.249) [-1550.692] (-1546.404) * (-1550.377) (-1551.700) (-1548.927) [-1544.845] -- 0:02:17
431500 -- (-1543.336) [-1549.077] (-1547.916) (-1550.256) * (-1546.365) (-1550.984) [-1544.238] (-1547.934) -- 0:02:17
432000 -- [-1546.443] (-1546.562) (-1549.370) (-1548.920) * (-1550.703) [-1549.875] (-1544.307) (-1548.659) -- 0:02:18
432500 -- (-1545.330) (-1545.901) (-1550.228) [-1548.823] * (-1553.707) (-1549.326) [-1547.070] (-1548.315) -- 0:02:17
433000 -- (-1549.476) (-1547.864) [-1546.304] (-1546.854) * (-1550.056) (-1541.246) [-1546.909] (-1546.147) -- 0:02:17
433500 -- [-1550.717] (-1553.312) (-1552.028) (-1543.168) * (-1549.139) (-1546.780) [-1545.845] (-1551.570) -- 0:02:17
434000 -- [-1546.704] (-1542.975) (-1551.240) (-1544.689) * (-1546.276) (-1546.279) (-1546.654) [-1549.057] -- 0:02:16
434500 -- (-1550.024) (-1546.470) [-1545.184] (-1554.519) * [-1547.608] (-1546.570) (-1562.045) (-1547.278) -- 0:02:16
435000 -- (-1546.354) (-1550.066) (-1551.198) [-1550.778] * (-1544.299) [-1547.381] (-1547.212) (-1550.328) -- 0:02:16
Average standard deviation of split frequencies: 0.021264
435500 -- (-1549.556) (-1544.974) (-1552.537) [-1551.743] * (-1543.097) [-1548.934] (-1549.854) (-1546.778) -- 0:02:16
436000 -- (-1547.623) [-1545.088] (-1547.219) (-1548.949) * (-1547.252) [-1543.707] (-1544.014) (-1545.068) -- 0:02:15
436500 -- (-1545.284) [-1547.856] (-1544.876) (-1552.480) * (-1549.733) (-1548.503) (-1549.740) [-1554.292] -- 0:02:16
437000 -- (-1549.505) (-1550.360) [-1550.730] (-1545.689) * (-1549.748) [-1551.287] (-1545.323) (-1560.460) -- 0:02:16
437500 -- (-1546.160) [-1544.202] (-1544.070) (-1546.826) * (-1550.453) (-1550.207) (-1545.469) [-1551.939] -- 0:02:16
438000 -- [-1544.227] (-1549.529) (-1548.405) (-1545.139) * (-1547.106) (-1554.002) [-1551.333] (-1544.631) -- 0:02:16
438500 -- [-1545.446] (-1545.457) (-1544.151) (-1547.790) * (-1548.770) [-1547.709] (-1548.194) (-1544.808) -- 0:02:15
439000 -- [-1549.336] (-1548.065) (-1544.855) (-1549.403) * (-1548.504) (-1553.930) (-1553.857) [-1557.591] -- 0:02:15
439500 -- (-1552.113) [-1546.355] (-1547.240) (-1543.884) * [-1545.772] (-1551.568) (-1549.227) (-1542.386) -- 0:02:15
440000 -- (-1559.677) (-1545.383) [-1547.711] (-1553.607) * [-1545.697] (-1549.773) (-1543.275) (-1543.661) -- 0:02:14
Average standard deviation of split frequencies: 0.019256
440500 -- (-1551.773) (-1549.882) (-1546.859) [-1546.867] * (-1547.151) [-1544.121] (-1546.700) (-1547.667) -- 0:02:15
441000 -- (-1550.505) (-1547.382) [-1543.553] (-1544.778) * (-1550.161) [-1545.050] (-1544.971) (-1548.716) -- 0:02:15
441500 -- (-1553.109) [-1544.588] (-1547.325) (-1544.131) * [-1547.468] (-1544.390) (-1546.922) (-1549.954) -- 0:02:15
442000 -- (-1547.718) (-1549.335) (-1548.536) [-1548.407] * [-1548.238] (-1548.943) (-1544.231) (-1547.961) -- 0:02:15
442500 -- (-1549.368) [-1549.931] (-1550.001) (-1547.059) * (-1550.368) (-1544.926) (-1546.980) [-1543.930] -- 0:02:14
443000 -- (-1552.715) [-1553.202] (-1547.022) (-1552.353) * [-1546.842] (-1543.636) (-1544.693) (-1550.362) -- 0:02:14
443500 -- [-1552.397] (-1549.407) (-1545.356) (-1547.823) * (-1547.186) (-1547.324) [-1546.675] (-1555.604) -- 0:02:14
444000 -- (-1545.566) (-1544.419) [-1547.418] (-1549.241) * (-1548.215) (-1554.160) [-1543.344] (-1551.624) -- 0:02:13
444500 -- (-1550.903) (-1544.803) [-1546.746] (-1550.993) * [-1545.213] (-1543.817) (-1545.605) (-1554.458) -- 0:02:14
445000 -- (-1545.277) (-1547.468) [-1544.622] (-1554.067) * [-1542.865] (-1546.664) (-1546.916) (-1551.721) -- 0:02:14
Average standard deviation of split frequencies: 0.020787
445500 -- (-1544.233) [-1544.552] (-1542.855) (-1550.391) * [-1549.187] (-1548.020) (-1547.936) (-1543.971) -- 0:02:14
446000 -- (-1554.580) (-1546.784) [-1545.374] (-1550.991) * (-1546.514) [-1541.897] (-1542.485) (-1554.752) -- 0:02:14
446500 -- (-1548.205) (-1556.151) (-1546.716) [-1545.375] * [-1554.357] (-1544.251) (-1548.786) (-1551.890) -- 0:02:13
447000 -- (-1558.304) (-1544.443) (-1550.109) [-1547.080] * (-1545.250) (-1547.951) (-1547.650) [-1553.735] -- 0:02:13
447500 -- (-1545.936) (-1550.793) (-1544.881) [-1546.797] * (-1550.714) [-1546.317] (-1543.863) (-1544.769) -- 0:02:13
448000 -- (-1548.544) (-1549.711) [-1548.111] (-1546.608) * (-1546.190) (-1551.797) (-1550.268) [-1544.274] -- 0:02:13
448500 -- [-1548.998] (-1540.241) (-1544.135) (-1555.286) * (-1554.130) (-1546.243) (-1541.212) [-1547.206] -- 0:02:12
449000 -- [-1548.286] (-1554.033) (-1543.620) (-1550.645) * (-1547.081) (-1550.167) [-1543.627] (-1546.982) -- 0:02:13
449500 -- (-1548.376) (-1545.635) [-1542.577] (-1557.004) * (-1545.589) (-1552.129) [-1549.325] (-1543.230) -- 0:02:13
450000 -- (-1550.546) [-1548.812] (-1548.934) (-1547.255) * [-1546.320] (-1553.969) (-1554.042) (-1544.089) -- 0:02:13
Average standard deviation of split frequencies: 0.024058
450500 -- (-1550.995) (-1545.730) (-1544.442) [-1545.971] * [-1547.191] (-1556.422) (-1545.865) (-1556.976) -- 0:02:12
451000 -- (-1552.432) [-1543.782] (-1544.249) (-1548.538) * (-1547.484) (-1555.445) [-1543.420] (-1549.590) -- 0:02:12
451500 -- (-1554.013) [-1544.405] (-1543.532) (-1548.095) * (-1547.569) (-1548.472) [-1549.090] (-1552.067) -- 0:02:12
452000 -- (-1550.978) [-1546.814] (-1547.517) (-1547.174) * (-1546.930) (-1545.199) (-1544.134) [-1544.763] -- 0:02:12
452500 -- (-1553.295) (-1548.982) [-1546.760] (-1551.571) * (-1544.431) (-1551.687) [-1546.040] (-1549.045) -- 0:02:11
453000 -- (-1555.737) [-1545.061] (-1546.435) (-1546.766) * [-1547.930] (-1542.210) (-1551.895) (-1547.180) -- 0:02:12
453500 -- (-1542.345) [-1548.325] (-1555.162) (-1549.321) * (-1544.136) (-1544.771) (-1548.184) [-1548.639] -- 0:02:12
454000 -- [-1542.326] (-1548.089) (-1544.122) (-1547.596) * [-1548.064] (-1546.769) (-1542.101) (-1547.862) -- 0:02:12
454500 -- (-1555.041) [-1545.830] (-1547.442) (-1554.829) * (-1546.807) [-1546.156] (-1548.788) (-1546.552) -- 0:02:12
455000 -- (-1541.687) (-1547.261) [-1547.419] (-1556.982) * [-1543.108] (-1546.261) (-1545.694) (-1552.686) -- 0:02:11
Average standard deviation of split frequencies: 0.023088
455500 -- [-1546.620] (-1541.152) (-1544.787) (-1554.863) * (-1547.607) (-1549.033) (-1547.507) [-1544.830] -- 0:02:11
456000 -- (-1547.884) [-1548.254] (-1546.584) (-1554.618) * (-1550.977) [-1545.880] (-1554.126) (-1542.146) -- 0:02:11
456500 -- (-1548.113) (-1550.998) [-1547.328] (-1556.364) * (-1547.770) [-1546.870] (-1546.848) (-1549.174) -- 0:02:10
457000 -- (-1552.636) (-1555.922) [-1545.294] (-1549.324) * [-1544.106] (-1544.743) (-1543.246) (-1542.884) -- 0:02:11
457500 -- (-1543.986) (-1553.100) (-1548.194) [-1547.367] * (-1548.070) [-1546.799] (-1552.500) (-1547.594) -- 0:02:11
458000 -- (-1547.467) (-1546.198) (-1547.380) [-1542.460] * (-1547.592) [-1545.907] (-1546.936) (-1547.238) -- 0:02:11
458500 -- (-1549.244) (-1548.156) [-1546.039] (-1544.645) * [-1549.872] (-1555.829) (-1547.552) (-1551.313) -- 0:02:11
459000 -- (-1547.299) (-1544.307) [-1544.807] (-1543.533) * (-1544.577) (-1546.298) (-1548.139) [-1548.093] -- 0:02:10
459500 -- (-1555.620) (-1546.586) (-1547.426) [-1551.051] * (-1545.352) (-1544.457) (-1547.212) [-1547.154] -- 0:02:10
460000 -- (-1546.342) (-1553.860) [-1545.327] (-1544.092) * [-1546.104] (-1544.808) (-1552.458) (-1547.184) -- 0:02:10
Average standard deviation of split frequencies: 0.022854
460500 -- (-1548.125) (-1550.561) (-1551.516) [-1548.822] * (-1544.472) [-1549.555] (-1545.778) (-1548.779) -- 0:02:10
461000 -- (-1541.661) [-1550.857] (-1545.232) (-1553.913) * (-1548.218) (-1545.870) [-1545.008] (-1544.977) -- 0:02:09
461500 -- (-1550.064) [-1544.151] (-1560.522) (-1550.025) * (-1545.267) (-1545.038) [-1543.607] (-1547.304) -- 0:02:10
462000 -- [-1544.485] (-1548.978) (-1550.618) (-1547.835) * [-1544.593] (-1546.437) (-1549.935) (-1544.234) -- 0:02:10
462500 -- [-1545.781] (-1546.523) (-1547.888) (-1546.894) * (-1543.626) (-1543.272) [-1551.758] (-1549.933) -- 0:02:10
463000 -- (-1545.496) (-1546.161) (-1544.050) [-1548.939] * (-1539.965) (-1547.538) (-1547.325) [-1547.660] -- 0:02:09
463500 -- (-1545.686) (-1544.960) [-1544.176] (-1547.755) * [-1547.551] (-1549.488) (-1546.810) (-1553.227) -- 0:02:09
464000 -- (-1545.800) (-1549.273) [-1551.291] (-1548.212) * (-1544.714) (-1549.149) [-1542.516] (-1553.691) -- 0:02:09
464500 -- (-1547.944) (-1548.061) [-1543.999] (-1546.960) * [-1545.435] (-1553.628) (-1545.415) (-1554.687) -- 0:02:09
465000 -- (-1549.964) [-1541.989] (-1549.464) (-1548.247) * (-1548.208) (-1549.778) (-1545.114) [-1549.760] -- 0:02:08
Average standard deviation of split frequencies: 0.023604
465500 -- (-1550.622) (-1548.101) [-1544.735] (-1553.382) * (-1547.064) (-1547.685) (-1548.484) [-1544.345] -- 0:02:09
466000 -- (-1554.456) (-1546.854) [-1545.913] (-1549.098) * [-1549.190] (-1547.887) (-1546.854) (-1540.735) -- 0:02:09
466500 -- [-1545.289] (-1543.229) (-1549.006) (-1546.149) * [-1542.120] (-1547.764) (-1549.550) (-1541.426) -- 0:02:09
467000 -- (-1548.307) (-1544.042) (-1545.145) [-1547.734] * [-1540.530] (-1544.581) (-1549.174) (-1545.689) -- 0:02:08
467500 -- [-1548.749] (-1545.663) (-1546.612) (-1546.210) * (-1545.746) (-1545.919) (-1548.653) [-1549.419] -- 0:02:08
468000 -- (-1548.755) [-1545.942] (-1549.274) (-1544.122) * (-1546.068) (-1545.696) [-1548.054] (-1547.918) -- 0:02:08
468500 -- (-1544.045) [-1546.076] (-1545.080) (-1550.177) * (-1549.224) (-1545.890) (-1549.977) [-1550.139] -- 0:02:08
469000 -- [-1548.995] (-1545.912) (-1544.774) (-1552.659) * (-1548.988) [-1547.235] (-1547.376) (-1557.414) -- 0:02:07
469500 -- (-1551.916) (-1543.746) [-1550.156] (-1548.089) * (-1548.358) [-1542.849] (-1555.709) (-1545.419) -- 0:02:08
470000 -- (-1547.058) [-1548.228] (-1559.079) (-1551.556) * (-1550.423) [-1549.483] (-1552.688) (-1546.875) -- 0:02:08
Average standard deviation of split frequencies: 0.023704
470500 -- (-1545.767) [-1545.979] (-1545.692) (-1548.644) * (-1555.649) [-1547.125] (-1552.150) (-1548.456) -- 0:02:08
471000 -- [-1548.152] (-1546.183) (-1549.090) (-1549.024) * (-1550.044) (-1551.966) [-1541.962] (-1543.782) -- 0:02:08
471500 -- (-1549.711) (-1554.021) [-1547.842] (-1547.058) * (-1544.267) (-1546.771) [-1542.783] (-1547.935) -- 0:02:07
472000 -- (-1540.273) (-1552.154) [-1542.873] (-1543.872) * [-1542.918] (-1554.345) (-1544.927) (-1548.627) -- 0:02:07
472500 -- [-1548.979] (-1549.863) (-1549.232) (-1552.536) * (-1551.170) [-1543.104] (-1548.565) (-1548.849) -- 0:02:07
473000 -- (-1544.343) (-1551.143) [-1545.475] (-1544.315) * (-1547.644) (-1546.304) (-1554.194) [-1543.888] -- 0:02:07
473500 -- [-1546.347] (-1547.040) (-1544.574) (-1553.613) * (-1546.649) (-1542.862) (-1548.233) [-1545.499] -- 0:02:06
474000 -- (-1548.687) [-1546.826] (-1549.396) (-1544.718) * [-1543.759] (-1545.591) (-1555.279) (-1547.585) -- 0:02:07
474500 -- [-1546.832] (-1548.456) (-1546.915) (-1558.533) * [-1547.723] (-1548.150) (-1547.852) (-1542.966) -- 0:02:07
475000 -- (-1550.709) (-1549.246) [-1545.421] (-1548.229) * [-1543.693] (-1545.133) (-1547.541) (-1544.094) -- 0:02:07
Average standard deviation of split frequencies: 0.023108
475500 -- (-1546.643) [-1547.404] (-1548.404) (-1554.925) * (-1549.621) [-1546.436] (-1551.494) (-1547.548) -- 0:02:06
476000 -- (-1553.380) (-1549.870) (-1544.469) [-1552.840] * (-1543.919) [-1546.432] (-1549.271) (-1555.872) -- 0:02:06
476500 -- [-1544.305] (-1551.020) (-1545.609) (-1554.113) * [-1547.251] (-1548.059) (-1543.744) (-1545.675) -- 0:02:06
477000 -- (-1546.723) (-1547.327) (-1546.919) [-1543.102] * [-1548.034] (-1547.745) (-1549.817) (-1544.582) -- 0:02:06
477500 -- (-1559.284) (-1548.970) (-1547.420) [-1546.396] * (-1549.962) (-1546.811) (-1565.166) [-1549.035] -- 0:02:05
478000 -- [-1548.575] (-1553.921) (-1542.299) (-1546.669) * (-1555.174) [-1541.881] (-1541.967) (-1549.968) -- 0:02:06
478500 -- (-1547.643) (-1552.072) (-1545.937) [-1543.527] * [-1548.404] (-1546.773) (-1548.196) (-1552.749) -- 0:02:06
479000 -- (-1546.959) (-1550.806) (-1542.171) [-1545.654] * (-1546.751) (-1550.180) (-1549.603) [-1543.073] -- 0:02:06
479500 -- (-1549.587) (-1549.892) [-1542.572] (-1542.331) * (-1550.132) (-1546.888) (-1550.230) [-1540.418] -- 0:02:05
480000 -- (-1559.169) [-1547.990] (-1546.970) (-1549.007) * [-1544.345] (-1546.422) (-1549.974) (-1544.860) -- 0:02:05
Average standard deviation of split frequencies: 0.024845
480500 -- (-1546.873) (-1549.171) (-1553.546) [-1544.844] * (-1550.038) [-1547.185] (-1552.002) (-1547.086) -- 0:02:05
481000 -- (-1545.035) [-1554.133] (-1549.153) (-1552.896) * [-1540.310] (-1550.246) (-1549.800) (-1543.886) -- 0:02:05
481500 -- (-1548.440) [-1548.663] (-1544.667) (-1551.922) * (-1545.813) (-1549.098) [-1542.248] (-1547.950) -- 0:02:04
482000 -- [-1545.211] (-1550.378) (-1549.810) (-1547.330) * (-1552.749) [-1547.929] (-1549.830) (-1545.702) -- 0:02:05
482500 -- (-1545.532) (-1547.942) [-1542.858] (-1553.475) * (-1548.608) [-1542.675] (-1554.191) (-1549.666) -- 0:02:05
483000 -- [-1545.194] (-1550.787) (-1544.127) (-1556.045) * (-1546.955) (-1550.461) (-1546.612) [-1544.937] -- 0:02:05
483500 -- [-1542.654] (-1553.913) (-1547.673) (-1551.971) * [-1546.688] (-1543.704) (-1549.674) (-1549.136) -- 0:02:04
484000 -- (-1551.051) (-1546.350) (-1549.558) [-1552.048] * (-1545.918) (-1543.947) [-1547.706] (-1544.144) -- 0:02:04
484500 -- (-1544.303) (-1550.370) [-1544.412] (-1553.770) * [-1542.402] (-1546.793) (-1544.745) (-1547.441) -- 0:02:04
485000 -- (-1549.705) [-1545.874] (-1542.911) (-1552.349) * (-1547.305) (-1548.823) (-1544.748) [-1549.274] -- 0:02:04
Average standard deviation of split frequencies: 0.024896
485500 -- (-1550.555) [-1545.005] (-1551.781) (-1552.580) * (-1548.445) (-1549.843) [-1544.821] (-1547.348) -- 0:02:03
486000 -- (-1546.604) (-1545.929) [-1547.315] (-1552.912) * (-1549.404) (-1546.879) [-1544.148] (-1555.461) -- 0:02:03
486500 -- (-1550.813) [-1543.521] (-1554.022) (-1548.377) * (-1545.070) (-1549.692) [-1551.889] (-1549.607) -- 0:02:04
487000 -- [-1548.478] (-1550.716) (-1543.727) (-1552.883) * (-1545.775) (-1549.515) (-1550.174) [-1551.556] -- 0:02:04
487500 -- [-1548.590] (-1550.581) (-1543.831) (-1548.269) * (-1549.331) (-1551.098) [-1548.570] (-1544.545) -- 0:02:04
488000 -- (-1548.075) (-1547.328) (-1542.913) [-1546.588] * (-1550.768) [-1543.514] (-1550.448) (-1545.187) -- 0:02:03
488500 -- (-1548.869) (-1548.279) [-1553.529] (-1541.794) * (-1561.098) [-1548.245] (-1546.677) (-1552.576) -- 0:02:03
489000 -- (-1553.706) [-1550.882] (-1548.331) (-1552.516) * (-1555.576) [-1549.975] (-1543.889) (-1545.130) -- 0:02:03
489500 -- (-1548.862) (-1546.092) [-1543.461] (-1548.175) * (-1553.901) (-1548.607) (-1548.444) [-1550.311] -- 0:02:03
490000 -- (-1556.972) (-1541.501) (-1545.587) [-1548.101] * [-1551.622] (-1555.197) (-1550.841) (-1548.819) -- 0:02:02
Average standard deviation of split frequencies: 0.024659
490500 -- (-1548.659) [-1546.522] (-1546.956) (-1548.630) * (-1550.062) (-1553.739) [-1545.474] (-1544.232) -- 0:02:03
491000 -- [-1547.362] (-1546.891) (-1544.389) (-1557.572) * [-1542.060] (-1547.564) (-1547.790) (-1547.568) -- 0:02:03
491500 -- [-1542.601] (-1549.129) (-1547.639) (-1550.414) * (-1547.346) (-1549.512) [-1543.796] (-1547.156) -- 0:02:03
492000 -- (-1553.377) (-1547.379) (-1544.504) [-1548.980] * (-1545.754) (-1553.443) (-1544.776) [-1545.032] -- 0:02:02
492500 -- (-1545.820) (-1546.336) [-1547.296] (-1549.864) * (-1547.327) (-1549.837) (-1548.855) [-1546.687] -- 0:02:02
493000 -- (-1543.533) (-1546.732) [-1551.274] (-1546.129) * (-1554.609) (-1557.501) [-1543.287] (-1543.156) -- 0:02:02
493500 -- [-1549.500] (-1544.894) (-1544.624) (-1546.844) * [-1545.167] (-1549.353) (-1543.916) (-1548.732) -- 0:02:02
494000 -- (-1546.211) (-1549.660) (-1547.388) [-1546.518] * (-1548.557) [-1549.797] (-1552.584) (-1543.748) -- 0:02:01
494500 -- (-1546.132) (-1548.344) (-1547.793) [-1544.087] * (-1555.506) [-1546.351] (-1557.889) (-1552.534) -- 0:02:02
495000 -- (-1551.157) [-1547.517] (-1545.755) (-1545.164) * [-1544.102] (-1548.139) (-1546.440) (-1548.083) -- 0:02:02
Average standard deviation of split frequencies: 0.026612
495500 -- (-1547.882) (-1555.094) (-1544.901) [-1544.214] * (-1545.815) (-1547.244) [-1550.216] (-1546.994) -- 0:02:02
496000 -- [-1544.480] (-1545.918) (-1548.472) (-1546.587) * [-1545.213] (-1545.515) (-1550.488) (-1544.971) -- 0:02:01
496500 -- (-1551.376) [-1545.006] (-1548.425) (-1547.412) * (-1552.328) (-1547.944) (-1550.594) [-1544.957] -- 0:02:01
497000 -- (-1547.035) (-1543.978) (-1546.138) [-1544.694] * (-1547.162) (-1551.447) [-1544.258] (-1547.388) -- 0:02:01
497500 -- [-1546.684] (-1546.036) (-1542.563) (-1548.908) * [-1552.002] (-1544.602) (-1555.229) (-1551.115) -- 0:02:01
498000 -- (-1551.278) (-1548.391) (-1542.749) [-1545.958] * [-1548.318] (-1549.894) (-1546.510) (-1556.049) -- 0:02:00
498500 -- [-1542.875] (-1541.942) (-1549.815) (-1550.771) * (-1550.233) (-1560.456) [-1546.825] (-1549.893) -- 0:02:00
499000 -- (-1547.031) (-1545.409) (-1547.197) [-1543.832] * [-1553.195] (-1558.205) (-1547.871) (-1549.520) -- 0:02:01
499500 -- [-1545.165] (-1546.619) (-1550.761) (-1548.874) * (-1557.329) (-1547.986) [-1542.319] (-1550.614) -- 0:02:01
500000 -- (-1551.667) [-1553.298] (-1549.268) (-1548.078) * [-1547.987] (-1545.086) (-1543.776) (-1549.417) -- 0:02:01
Average standard deviation of split frequencies: 0.026364
500500 -- [-1550.852] (-1548.635) (-1546.856) (-1546.755) * (-1545.338) (-1554.207) [-1542.902] (-1551.599) -- 0:02:00
501000 -- (-1546.567) [-1546.353] (-1544.229) (-1546.055) * [-1544.452] (-1546.252) (-1547.248) (-1546.756) -- 0:02:00
501500 -- (-1545.626) (-1545.347) [-1547.344] (-1548.793) * [-1547.158] (-1556.672) (-1547.778) (-1550.055) -- 0:02:00
502000 -- [-1544.984] (-1552.189) (-1546.736) (-1546.333) * (-1548.817) [-1544.101] (-1547.142) (-1547.300) -- 0:02:00
502500 -- (-1543.528) (-1546.749) (-1546.941) [-1547.126] * [-1550.501] (-1550.931) (-1554.664) (-1550.518) -- 0:01:59
503000 -- [-1540.255] (-1546.935) (-1546.311) (-1547.370) * (-1545.590) (-1555.476) [-1551.079] (-1547.957) -- 0:02:00
503500 -- (-1551.742) (-1546.523) [-1544.180] (-1550.288) * [-1542.409] (-1549.109) (-1554.561) (-1549.342) -- 0:02:00
504000 -- (-1547.768) [-1549.241] (-1549.690) (-1549.647) * (-1544.517) (-1545.839) [-1552.628] (-1541.258) -- 0:02:00
504500 -- (-1551.473) (-1553.296) [-1542.432] (-1545.668) * [-1542.456] (-1547.574) (-1553.072) (-1544.019) -- 0:01:59
505000 -- (-1550.916) [-1545.259] (-1548.208) (-1549.785) * (-1549.181) [-1540.699] (-1560.132) (-1546.688) -- 0:01:59
Average standard deviation of split frequencies: 0.024222
505500 -- (-1556.212) (-1549.582) [-1546.563] (-1546.128) * [-1541.165] (-1540.874) (-1564.940) (-1549.806) -- 0:01:59
506000 -- (-1545.773) (-1550.301) [-1547.291] (-1548.499) * (-1542.996) (-1548.358) (-1549.393) [-1543.790] -- 0:01:59
506500 -- (-1544.975) [-1550.043] (-1548.802) (-1553.355) * [-1541.783] (-1545.793) (-1547.201) (-1558.134) -- 0:01:58
507000 -- (-1548.837) [-1547.022] (-1550.369) (-1547.384) * [-1549.271] (-1547.788) (-1545.576) (-1548.676) -- 0:01:59
507500 -- [-1545.319] (-1546.789) (-1543.339) (-1548.120) * (-1547.118) (-1551.075) [-1542.488] (-1544.992) -- 0:01:59
508000 -- (-1548.483) [-1541.446] (-1553.542) (-1556.529) * (-1550.491) [-1546.603] (-1547.980) (-1545.988) -- 0:01:59
508500 -- [-1547.686] (-1547.672) (-1548.346) (-1551.720) * [-1549.624] (-1549.545) (-1543.842) (-1541.809) -- 0:01:58
509000 -- (-1548.300) (-1546.561) [-1544.579] (-1550.932) * (-1545.027) (-1550.782) [-1541.611] (-1542.882) -- 0:01:58
509500 -- [-1548.761] (-1546.207) (-1549.066) (-1557.823) * (-1544.018) (-1550.161) [-1544.963] (-1548.815) -- 0:01:58
510000 -- (-1556.387) [-1540.706] (-1550.961) (-1546.094) * (-1545.526) (-1557.329) (-1546.657) [-1548.793] -- 0:01:58
Average standard deviation of split frequencies: 0.025847
510500 -- (-1553.063) [-1544.605] (-1545.034) (-1553.134) * (-1544.807) (-1548.712) (-1552.923) [-1545.936] -- 0:01:57
511000 -- [-1547.240] (-1547.360) (-1554.413) (-1545.885) * (-1552.484) (-1545.672) (-1552.892) [-1548.059] -- 0:01:57
511500 -- (-1557.549) [-1543.354] (-1555.528) (-1546.390) * (-1549.152) [-1544.492] (-1547.678) (-1543.672) -- 0:01:58
512000 -- (-1550.062) (-1546.842) (-1551.891) [-1548.503] * (-1553.454) [-1544.536] (-1543.373) (-1541.991) -- 0:01:58
512500 -- [-1544.868] (-1546.405) (-1546.545) (-1546.502) * (-1556.688) [-1543.962] (-1545.674) (-1546.391) -- 0:01:57
513000 -- (-1547.884) (-1544.748) [-1544.693] (-1550.328) * [-1545.109] (-1544.346) (-1550.563) (-1548.873) -- 0:01:57
513500 -- [-1550.045] (-1548.529) (-1541.282) (-1542.114) * (-1546.979) (-1546.556) [-1550.913] (-1550.137) -- 0:01:57
514000 -- [-1544.194] (-1552.188) (-1542.584) (-1546.396) * (-1550.121) [-1543.645] (-1549.685) (-1552.395) -- 0:01:57
514500 -- (-1545.789) (-1549.229) (-1547.534) [-1542.991] * (-1549.641) (-1544.076) [-1547.926] (-1549.685) -- 0:01:57
515000 -- (-1547.774) (-1546.308) [-1548.294] (-1546.599) * (-1550.927) [-1548.435] (-1546.513) (-1545.739) -- 0:01:56
Average standard deviation of split frequencies: 0.023448
515500 -- (-1550.651) (-1543.744) (-1552.274) [-1544.841] * (-1549.497) (-1548.311) (-1543.575) [-1550.775] -- 0:01:57
516000 -- (-1545.896) [-1540.757] (-1546.286) (-1548.573) * (-1547.369) (-1553.654) [-1542.597] (-1545.703) -- 0:01:57
516500 -- [-1542.982] (-1546.127) (-1551.146) (-1543.081) * (-1551.471) (-1546.726) (-1545.930) [-1546.929] -- 0:01:57
517000 -- (-1544.724) (-1544.255) (-1542.670) [-1544.036] * (-1547.862) [-1548.005] (-1546.668) (-1543.979) -- 0:01:56
517500 -- (-1548.033) [-1544.236] (-1544.886) (-1553.346) * (-1545.931) (-1545.738) (-1551.684) [-1541.719] -- 0:01:56
518000 -- [-1549.712] (-1551.934) (-1546.644) (-1546.623) * (-1545.269) (-1550.224) (-1550.083) [-1543.180] -- 0:01:56
518500 -- (-1542.563) (-1551.443) (-1544.362) [-1546.714] * [-1543.664] (-1549.111) (-1544.573) (-1551.413) -- 0:01:56
519000 -- [-1543.752] (-1548.632) (-1545.362) (-1552.561) * (-1543.411) [-1551.835] (-1548.959) (-1556.048) -- 0:01:55
519500 -- (-1550.168) (-1542.164) [-1549.105] (-1553.470) * [-1543.817] (-1548.346) (-1548.785) (-1548.207) -- 0:01:56
520000 -- (-1546.818) (-1548.748) [-1546.464] (-1556.419) * [-1546.071] (-1546.314) (-1551.881) (-1552.449) -- 0:01:56
Average standard deviation of split frequencies: 0.021729
520500 -- [-1547.815] (-1544.344) (-1547.768) (-1555.640) * [-1547.315] (-1547.696) (-1553.190) (-1544.246) -- 0:01:56
521000 -- (-1546.997) (-1549.367) [-1546.834] (-1551.227) * (-1546.791) (-1548.414) (-1545.653) [-1540.480] -- 0:01:55
521500 -- (-1551.450) (-1548.857) (-1546.029) [-1547.530] * (-1550.295) (-1549.370) [-1548.002] (-1546.915) -- 0:01:55
522000 -- [-1544.543] (-1548.580) (-1545.792) (-1551.153) * (-1548.457) [-1545.271] (-1551.704) (-1550.697) -- 0:01:55
522500 -- (-1550.356) (-1543.150) [-1552.270] (-1547.638) * (-1545.659) (-1543.955) [-1549.292] (-1552.641) -- 0:01:55
523000 -- (-1545.154) (-1545.810) (-1554.149) [-1544.178] * (-1549.486) (-1545.313) [-1548.010] (-1550.536) -- 0:01:54
523500 -- (-1546.951) (-1550.184) (-1548.743) [-1540.623] * (-1546.220) (-1550.406) [-1543.757] (-1549.303) -- 0:01:55
524000 -- (-1545.658) [-1547.849] (-1546.631) (-1543.855) * (-1544.166) [-1546.292] (-1544.344) (-1553.749) -- 0:01:55
524500 -- (-1539.594) (-1550.909) (-1544.220) [-1546.152] * (-1541.415) (-1545.776) (-1552.121) [-1544.738] -- 0:01:55
525000 -- [-1546.532] (-1551.446) (-1548.265) (-1548.649) * (-1544.371) [-1548.826] (-1554.010) (-1544.461) -- 0:01:54
Average standard deviation of split frequencies: 0.021210
525500 -- [-1546.930] (-1552.953) (-1551.131) (-1545.545) * (-1546.193) (-1554.926) [-1550.199] (-1550.855) -- 0:01:54
526000 -- (-1544.785) (-1550.073) (-1542.724) [-1543.248] * (-1549.116) (-1550.824) [-1545.050] (-1550.862) -- 0:01:54
526500 -- (-1547.079) [-1547.089] (-1545.751) (-1548.322) * (-1547.201) (-1554.612) (-1544.655) [-1544.191] -- 0:01:54
527000 -- (-1545.656) (-1545.340) [-1546.802] (-1555.068) * (-1549.189) (-1546.924) (-1549.525) [-1543.348] -- 0:01:53
527500 -- (-1550.277) [-1543.657] (-1551.641) (-1560.869) * [-1552.089] (-1544.724) (-1544.006) (-1550.540) -- 0:01:53
528000 -- (-1547.011) (-1545.754) [-1546.842] (-1548.984) * (-1550.507) [-1543.109] (-1545.613) (-1552.603) -- 0:01:54
528500 -- [-1545.023] (-1544.938) (-1547.698) (-1547.304) * [-1544.255] (-1546.975) (-1548.106) (-1553.360) -- 0:01:54
529000 -- [-1546.709] (-1546.870) (-1549.969) (-1550.649) * (-1546.654) (-1551.909) [-1548.223] (-1545.035) -- 0:01:53
529500 -- [-1546.881] (-1550.187) (-1545.676) (-1553.406) * (-1543.852) (-1547.800) (-1545.538) [-1550.833] -- 0:01:53
530000 -- (-1547.626) (-1546.123) (-1552.890) [-1544.950] * (-1549.201) (-1551.867) (-1544.291) [-1544.443] -- 0:01:53
Average standard deviation of split frequencies: 0.019247
530500 -- (-1547.623) (-1551.478) (-1551.358) [-1546.198] * (-1549.344) (-1544.138) (-1548.600) [-1542.336] -- 0:01:53
531000 -- (-1557.110) [-1550.217] (-1547.290) (-1547.516) * (-1556.417) [-1546.978] (-1545.475) (-1547.816) -- 0:01:53
531500 -- (-1553.986) (-1560.750) [-1544.960] (-1547.983) * (-1554.827) [-1542.424] (-1553.109) (-1545.388) -- 0:01:52
532000 -- (-1545.436) (-1548.234) (-1542.332) [-1549.057] * (-1549.361) [-1544.317] (-1548.473) (-1547.860) -- 0:01:53
532500 -- (-1550.066) (-1553.919) (-1544.939) [-1545.752] * (-1546.756) (-1545.448) [-1545.206] (-1553.351) -- 0:01:53
533000 -- (-1552.747) (-1546.070) [-1547.439] (-1549.303) * [-1543.889] (-1542.086) (-1544.477) (-1544.889) -- 0:01:53
533500 -- (-1551.649) (-1544.121) (-1547.375) [-1543.145] * [-1545.775] (-1547.286) (-1545.125) (-1549.493) -- 0:01:52
534000 -- (-1546.741) (-1549.634) [-1543.977] (-1549.104) * [-1544.805] (-1545.256) (-1557.432) (-1546.378) -- 0:01:52
534500 -- (-1545.013) [-1546.053] (-1545.913) (-1543.738) * [-1546.632] (-1548.707) (-1547.643) (-1549.845) -- 0:01:52
535000 -- [-1548.105] (-1552.524) (-1545.241) (-1544.634) * [-1542.655] (-1547.872) (-1546.691) (-1547.927) -- 0:01:52
Average standard deviation of split frequencies: 0.019642
535500 -- (-1546.779) [-1543.483] (-1551.269) (-1542.581) * (-1545.981) [-1550.026] (-1551.303) (-1545.729) -- 0:01:51
536000 -- (-1544.476) (-1549.635) [-1542.545] (-1545.613) * (-1544.569) (-1552.153) (-1545.687) [-1548.112] -- 0:01:52
536500 -- (-1542.396) (-1545.406) [-1543.400] (-1547.381) * (-1544.874) [-1552.297] (-1548.946) (-1548.445) -- 0:01:52
537000 -- (-1546.398) [-1546.998] (-1542.948) (-1546.595) * (-1545.422) (-1551.918) (-1547.487) [-1548.063] -- 0:01:52
537500 -- (-1544.208) (-1546.383) (-1543.330) [-1547.824] * (-1544.583) [-1544.289] (-1550.511) (-1549.771) -- 0:01:51
538000 -- [-1544.840] (-1545.137) (-1544.441) (-1548.980) * (-1545.245) (-1549.850) [-1552.976] (-1553.421) -- 0:01:51
538500 -- (-1544.362) [-1549.009] (-1543.204) (-1548.401) * (-1548.083) (-1549.945) [-1547.655] (-1556.048) -- 0:01:51
539000 -- (-1541.941) [-1545.072] (-1545.869) (-1545.114) * (-1548.235) [-1547.894] (-1545.503) (-1557.793) -- 0:01:51
539500 -- (-1548.518) [-1547.734] (-1542.709) (-1547.729) * (-1547.105) (-1559.406) [-1545.629] (-1555.293) -- 0:01:50
540000 -- (-1548.881) [-1544.353] (-1545.304) (-1548.455) * (-1546.525) (-1554.472) [-1545.180] (-1548.659) -- 0:01:51
Average standard deviation of split frequencies: 0.018600
540500 -- (-1548.616) [-1543.887] (-1551.856) (-1551.855) * [-1542.939] (-1555.717) (-1557.284) (-1549.006) -- 0:01:51
541000 -- (-1544.757) (-1551.650) (-1544.570) [-1548.813] * (-1547.802) [-1547.041] (-1547.792) (-1547.874) -- 0:01:51
541500 -- [-1552.239] (-1550.389) (-1546.340) (-1549.499) * (-1546.671) (-1551.447) (-1547.132) [-1544.322] -- 0:01:50
542000 -- [-1552.735] (-1551.398) (-1548.119) (-1550.687) * (-1543.546) (-1560.060) [-1543.152] (-1543.972) -- 0:01:50
542500 -- (-1544.922) (-1551.351) (-1545.722) [-1546.247] * (-1549.744) [-1553.904] (-1541.296) (-1542.932) -- 0:01:50
543000 -- (-1550.042) (-1555.093) (-1552.259) [-1551.762] * (-1546.965) (-1548.435) [-1543.477] (-1548.680) -- 0:01:50
543500 -- (-1542.556) (-1552.816) [-1548.234] (-1548.965) * (-1542.036) [-1547.317] (-1542.337) (-1553.673) -- 0:01:50
544000 -- (-1544.142) (-1553.976) (-1543.283) [-1544.483] * (-1547.046) (-1551.107) [-1543.673] (-1551.207) -- 0:01:50
544500 -- (-1549.381) [-1547.029] (-1541.667) (-1545.650) * (-1543.770) [-1542.654] (-1545.147) (-1551.238) -- 0:01:50
545000 -- (-1544.444) [-1544.696] (-1553.092) (-1546.151) * [-1543.472] (-1548.794) (-1545.238) (-1549.165) -- 0:01:50
Average standard deviation of split frequencies: 0.019858
545500 -- [-1543.370] (-1545.376) (-1548.336) (-1545.004) * (-1542.308) (-1548.881) [-1543.404] (-1544.075) -- 0:01:49
546000 -- [-1548.573] (-1546.270) (-1547.528) (-1549.271) * [-1550.378] (-1550.921) (-1545.216) (-1550.169) -- 0:01:49
546500 -- (-1545.875) [-1544.889] (-1546.495) (-1549.019) * (-1546.006) [-1545.498] (-1546.841) (-1549.819) -- 0:01:49
547000 -- (-1544.644) (-1546.210) (-1544.121) [-1552.230] * (-1544.699) (-1546.245) (-1545.283) [-1544.290] -- 0:01:49
547500 -- (-1551.475) [-1547.263] (-1545.456) (-1549.551) * (-1547.107) (-1546.779) [-1542.845] (-1547.942) -- 0:01:49
548000 -- (-1551.322) [-1545.796] (-1546.736) (-1546.052) * (-1551.107) (-1546.710) [-1545.771] (-1548.266) -- 0:01:48
548500 -- (-1553.119) (-1545.509) [-1551.605] (-1549.718) * [-1547.370] (-1544.674) (-1545.731) (-1549.745) -- 0:01:49
549000 -- (-1553.730) [-1542.903] (-1545.093) (-1542.495) * (-1546.130) [-1545.421] (-1550.118) (-1548.716) -- 0:01:49
549500 -- (-1559.150) (-1550.528) [-1547.448] (-1550.765) * [-1543.797] (-1550.509) (-1548.864) (-1553.016) -- 0:01:49
550000 -- (-1547.005) (-1549.236) [-1551.061] (-1546.924) * (-1546.922) (-1553.665) (-1554.162) [-1545.446] -- 0:01:48
Average standard deviation of split frequencies: 0.019689
550500 -- (-1549.866) [-1548.939] (-1550.518) (-1547.441) * (-1542.936) (-1552.933) (-1548.574) [-1547.552] -- 0:01:48
551000 -- (-1544.585) [-1548.132] (-1546.158) (-1546.394) * (-1544.864) (-1549.847) [-1545.835] (-1548.320) -- 0:01:48
551500 -- (-1548.448) (-1560.792) (-1550.862) [-1550.327] * (-1546.655) (-1555.197) [-1545.828] (-1544.207) -- 0:01:48
552000 -- (-1552.127) (-1548.089) (-1544.534) [-1553.411] * (-1551.851) (-1549.979) (-1552.082) [-1543.587] -- 0:01:47
552500 -- (-1549.777) (-1548.114) (-1545.042) [-1546.822] * (-1544.882) (-1550.206) [-1545.594] (-1551.416) -- 0:01:48
553000 -- (-1545.599) (-1552.081) [-1546.660] (-1547.561) * (-1550.980) (-1545.882) [-1544.511] (-1544.238) -- 0:01:48
553500 -- (-1549.853) [-1547.151] (-1553.321) (-1548.352) * (-1549.496) (-1554.964) (-1548.093) [-1541.807] -- 0:01:48
554000 -- (-1547.459) (-1542.039) (-1542.937) [-1546.555] * (-1548.446) (-1551.195) [-1547.293] (-1545.042) -- 0:01:47
554500 -- (-1546.774) (-1543.311) [-1545.392] (-1549.954) * [-1544.173] (-1547.689) (-1548.180) (-1551.347) -- 0:01:47
555000 -- [-1544.679] (-1551.555) (-1553.612) (-1557.638) * (-1548.134) (-1550.467) (-1544.632) [-1544.837] -- 0:01:47
Average standard deviation of split frequencies: 0.019501
555500 -- (-1550.365) (-1552.019) [-1541.707] (-1553.146) * (-1545.919) (-1554.350) (-1542.613) [-1549.854] -- 0:01:47
556000 -- [-1541.721] (-1548.823) (-1545.203) (-1554.899) * [-1545.428] (-1556.172) (-1542.765) (-1545.273) -- 0:01:47
556500 -- (-1546.873) (-1545.252) [-1549.597] (-1548.948) * [-1541.449] (-1553.872) (-1546.701) (-1550.656) -- 0:01:47
557000 -- (-1546.116) [-1545.242] (-1545.973) (-1545.244) * (-1546.161) [-1545.058] (-1544.669) (-1551.719) -- 0:01:47
557500 -- (-1546.577) (-1547.122) [-1548.110] (-1546.651) * (-1545.502) (-1545.162) [-1546.613] (-1550.142) -- 0:01:47
558000 -- [-1544.005] (-1547.164) (-1549.904) (-1544.857) * (-1543.096) (-1545.559) [-1547.647] (-1546.641) -- 0:01:46
558500 -- (-1550.143) (-1549.716) [-1545.226] (-1542.315) * (-1547.563) (-1549.341) [-1545.687] (-1542.932) -- 0:01:46
559000 -- (-1552.723) (-1561.852) [-1551.794] (-1547.955) * (-1550.727) [-1544.831] (-1549.477) (-1547.453) -- 0:01:46
559500 -- [-1545.924] (-1545.135) (-1549.767) (-1549.214) * [-1545.138] (-1548.355) (-1551.726) (-1547.247) -- 0:01:46
560000 -- [-1546.147] (-1546.580) (-1549.798) (-1545.259) * (-1552.995) [-1547.327] (-1545.254) (-1545.513) -- 0:01:46
Average standard deviation of split frequencies: 0.019618
560500 -- [-1542.350] (-1547.648) (-1550.406) (-1555.547) * [-1545.173] (-1551.440) (-1545.374) (-1549.362) -- 0:01:46
561000 -- [-1544.835] (-1549.116) (-1548.816) (-1544.611) * (-1550.740) (-1548.487) (-1550.591) [-1543.547] -- 0:01:46
561500 -- [-1543.417] (-1548.942) (-1548.885) (-1543.175) * (-1543.348) [-1543.242] (-1549.515) (-1556.555) -- 0:01:46
562000 -- [-1543.505] (-1547.399) (-1547.328) (-1547.622) * (-1543.033) (-1547.657) [-1545.370] (-1547.852) -- 0:01:45
562500 -- (-1546.894) [-1544.625] (-1557.445) (-1549.567) * [-1545.381] (-1551.627) (-1548.097) (-1545.131) -- 0:01:45
563000 -- (-1548.693) (-1549.759) [-1540.539] (-1549.830) * (-1542.866) (-1550.382) [-1542.465] (-1545.052) -- 0:01:45
563500 -- (-1549.981) [-1547.067] (-1547.864) (-1555.061) * [-1550.358] (-1545.432) (-1546.123) (-1546.596) -- 0:01:45
564000 -- [-1546.829] (-1550.300) (-1542.691) (-1544.460) * [-1549.288] (-1543.375) (-1546.710) (-1544.728) -- 0:01:45
564500 -- (-1547.668) (-1555.119) [-1544.463] (-1544.002) * (-1543.327) (-1546.323) (-1548.051) [-1542.472] -- 0:01:45
565000 -- [-1551.635] (-1551.737) (-1547.436) (-1548.425) * [-1546.374] (-1542.452) (-1547.255) (-1547.074) -- 0:01:45
Average standard deviation of split frequencies: 0.019989
565500 -- (-1547.417) (-1545.054) [-1544.255] (-1551.794) * (-1549.031) [-1543.026] (-1545.132) (-1549.707) -- 0:01:45
566000 -- (-1541.925) (-1548.975) [-1545.383] (-1554.837) * (-1547.169) [-1539.721] (-1550.017) (-1551.955) -- 0:01:45
566500 -- (-1545.738) (-1546.288) [-1544.666] (-1553.672) * (-1545.583) [-1540.710] (-1551.637) (-1551.237) -- 0:01:44
567000 -- (-1543.845) (-1550.002) [-1543.956] (-1547.949) * (-1546.570) [-1544.842] (-1549.921) (-1551.304) -- 0:01:44
567500 -- (-1544.318) (-1548.950) [-1543.078] (-1549.734) * (-1548.385) (-1545.491) [-1544.456] (-1560.635) -- 0:01:44
568000 -- (-1547.518) (-1550.450) [-1544.884] (-1543.267) * (-1544.854) [-1548.812] (-1552.687) (-1542.254) -- 0:01:44
568500 -- (-1542.008) (-1549.423) [-1543.980] (-1545.254) * (-1548.023) (-1552.129) (-1549.477) [-1542.119] -- 0:01:44
569000 -- (-1542.068) (-1548.451) (-1549.268) [-1544.569] * (-1544.173) (-1550.870) (-1546.369) [-1543.908] -- 0:01:44
569500 -- [-1551.458] (-1549.450) (-1544.121) (-1544.491) * (-1547.074) [-1548.673] (-1544.191) (-1543.585) -- 0:01:44
570000 -- (-1544.307) (-1548.122) [-1542.252] (-1549.830) * (-1547.673) (-1546.968) (-1545.481) [-1548.926] -- 0:01:44
Average standard deviation of split frequencies: 0.019275
570500 -- (-1543.014) (-1550.376) (-1544.772) [-1548.682] * (-1547.111) (-1545.062) [-1548.731] (-1546.928) -- 0:01:43
571000 -- (-1541.415) [-1547.339] (-1548.372) (-1548.447) * [-1550.638] (-1551.343) (-1547.207) (-1547.836) -- 0:01:43
571500 -- (-1546.067) [-1542.178] (-1547.539) (-1555.810) * (-1548.141) (-1543.253) (-1549.008) [-1542.791] -- 0:01:43
572000 -- (-1545.663) [-1548.208] (-1552.546) (-1549.874) * (-1551.100) [-1555.705] (-1546.368) (-1547.831) -- 0:01:43
572500 -- (-1545.224) [-1545.559] (-1549.425) (-1545.833) * (-1544.067) (-1550.157) (-1553.137) [-1546.483] -- 0:01:43
573000 -- [-1548.390] (-1548.042) (-1554.234) (-1548.502) * [-1545.456] (-1547.171) (-1544.903) (-1542.252) -- 0:01:43
573500 -- [-1551.476] (-1551.341) (-1545.830) (-1541.842) * [-1544.934] (-1552.213) (-1547.820) (-1546.470) -- 0:01:43
574000 -- (-1549.893) (-1548.690) [-1548.288] (-1543.294) * (-1549.979) (-1552.455) [-1541.450] (-1545.982) -- 0:01:43
574500 -- (-1552.978) (-1550.631) (-1551.598) [-1542.325] * (-1543.708) (-1550.566) [-1541.820] (-1543.990) -- 0:01:42
575000 -- (-1553.633) (-1552.386) [-1549.894] (-1547.702) * [-1544.029] (-1550.566) (-1548.274) (-1544.637) -- 0:01:42
Average standard deviation of split frequencies: 0.020187
575500 -- (-1554.562) (-1544.309) (-1551.141) [-1543.983] * (-1543.723) (-1544.236) [-1546.841] (-1548.832) -- 0:01:42
576000 -- (-1551.444) [-1542.429] (-1551.212) (-1547.236) * (-1551.953) (-1560.013) [-1547.411] (-1545.634) -- 0:01:42
576500 -- (-1548.346) (-1548.503) [-1546.989] (-1553.028) * (-1550.046) (-1550.651) [-1543.072] (-1542.644) -- 0:01:42
577000 -- [-1551.015] (-1548.485) (-1551.444) (-1547.186) * (-1545.891) (-1551.527) [-1543.003] (-1549.606) -- 0:01:42
577500 -- [-1544.061] (-1553.366) (-1547.998) (-1549.498) * (-1544.883) (-1546.583) (-1551.415) [-1548.455] -- 0:01:42
578000 -- (-1544.699) (-1548.424) [-1548.104] (-1548.026) * (-1545.764) (-1544.034) [-1548.501] (-1546.921) -- 0:01:42
578500 -- (-1547.684) (-1542.968) [-1542.881] (-1552.323) * (-1554.216) [-1545.947] (-1546.214) (-1544.208) -- 0:01:42
579000 -- (-1544.199) [-1544.538] (-1546.801) (-1556.096) * (-1543.256) (-1544.316) (-1542.554) [-1544.773] -- 0:01:41
579500 -- (-1546.026) [-1544.215] (-1544.786) (-1551.821) * [-1552.805] (-1547.366) (-1555.141) (-1546.617) -- 0:01:41
580000 -- (-1544.787) [-1543.398] (-1547.109) (-1549.209) * (-1546.503) (-1543.083) [-1544.718] (-1546.746) -- 0:01:41
Average standard deviation of split frequencies: 0.018402
580500 -- [-1546.138] (-1547.122) (-1552.675) (-1549.180) * [-1550.948] (-1543.422) (-1547.994) (-1546.676) -- 0:01:41
581000 -- (-1549.355) (-1555.723) [-1546.929] (-1547.807) * (-1544.799) (-1554.290) (-1546.524) [-1550.721] -- 0:01:41
581500 -- (-1552.811) (-1550.292) [-1545.455] (-1546.740) * [-1547.481] (-1554.421) (-1548.049) (-1547.594) -- 0:01:41
582000 -- [-1549.664] (-1552.578) (-1545.201) (-1545.532) * (-1545.348) (-1546.327) [-1544.733] (-1547.376) -- 0:01:41
582500 -- (-1559.900) (-1546.505) (-1545.726) [-1540.964] * (-1545.268) (-1544.748) [-1546.232] (-1546.135) -- 0:01:41
583000 -- (-1557.283) [-1549.346] (-1547.396) (-1542.484) * (-1543.032) (-1551.365) [-1544.255] (-1548.331) -- 0:01:40
583500 -- (-1549.297) [-1544.313] (-1548.669) (-1543.625) * [-1549.983] (-1548.610) (-1540.725) (-1558.361) -- 0:01:40
584000 -- (-1543.420) [-1548.771] (-1549.857) (-1547.509) * (-1551.044) (-1547.596) [-1544.006] (-1545.049) -- 0:01:40
584500 -- (-1547.506) [-1552.360] (-1550.313) (-1540.469) * (-1552.854) (-1549.114) [-1550.879] (-1545.874) -- 0:01:40
585000 -- (-1548.364) [-1554.722] (-1551.425) (-1544.590) * (-1553.580) [-1543.635] (-1554.257) (-1542.587) -- 0:01:40
Average standard deviation of split frequencies: 0.018502
585500 -- (-1548.334) [-1541.629] (-1552.051) (-1548.417) * (-1541.254) [-1541.911] (-1551.758) (-1547.404) -- 0:01:40
586000 -- [-1540.032] (-1545.197) (-1552.830) (-1550.979) * (-1548.405) [-1544.980] (-1544.719) (-1553.817) -- 0:01:40
586500 -- [-1542.976] (-1552.997) (-1554.455) (-1544.327) * (-1554.706) (-1546.356) [-1545.687] (-1552.217) -- 0:01:40
587000 -- (-1543.828) (-1554.358) (-1555.415) [-1545.971] * (-1545.824) (-1549.112) (-1541.878) [-1542.989] -- 0:01:39
587500 -- (-1546.639) [-1555.573] (-1549.549) (-1542.362) * (-1549.394) (-1544.963) (-1549.642) [-1546.257] -- 0:01:39
588000 -- [-1543.590] (-1554.169) (-1550.787) (-1553.583) * (-1548.933) (-1540.616) (-1550.243) [-1544.514] -- 0:01:39
588500 -- [-1543.207] (-1562.741) (-1549.308) (-1545.477) * (-1553.093) (-1550.713) [-1544.288] (-1549.424) -- 0:01:39
589000 -- (-1544.819) (-1554.100) (-1554.386) [-1545.582] * (-1546.867) [-1542.867] (-1550.440) (-1554.677) -- 0:01:39
589500 -- (-1543.929) [-1558.767] (-1554.558) (-1545.077) * [-1543.839] (-1547.674) (-1544.574) (-1554.367) -- 0:01:39
590000 -- [-1543.798] (-1558.623) (-1549.698) (-1543.788) * (-1546.381) (-1550.825) [-1546.431] (-1546.717) -- 0:01:39
Average standard deviation of split frequencies: 0.017026
590500 -- (-1543.774) [-1552.270] (-1549.428) (-1546.142) * [-1542.123] (-1547.783) (-1544.199) (-1549.375) -- 0:01:39
591000 -- [-1548.882] (-1553.724) (-1542.375) (-1545.555) * (-1546.189) [-1543.825] (-1553.910) (-1546.950) -- 0:01:38
591500 -- (-1544.118) (-1550.007) (-1543.317) [-1545.650] * [-1545.005] (-1544.462) (-1554.351) (-1552.790) -- 0:01:38
592000 -- (-1546.971) (-1550.796) [-1545.525] (-1545.453) * (-1544.836) (-1545.321) (-1549.936) [-1549.523] -- 0:01:38
592500 -- (-1545.442) [-1545.988] (-1552.954) (-1545.700) * [-1544.709] (-1545.014) (-1549.374) (-1550.711) -- 0:01:38
593000 -- (-1547.870) (-1549.531) (-1543.104) [-1549.850] * (-1550.838) (-1549.637) (-1548.282) [-1548.486] -- 0:01:38
593500 -- (-1551.813) [-1542.057] (-1542.796) (-1547.669) * (-1553.182) (-1548.268) [-1545.915] (-1544.903) -- 0:01:38
594000 -- (-1551.078) (-1548.831) [-1546.310] (-1546.570) * (-1556.052) (-1554.642) [-1544.119] (-1544.973) -- 0:01:38
594500 -- (-1550.034) (-1550.926) [-1554.317] (-1544.439) * (-1549.930) (-1548.184) (-1549.019) [-1548.643] -- 0:01:38
595000 -- (-1552.743) (-1557.695) (-1548.562) [-1546.041] * (-1548.705) (-1546.772) (-1546.410) [-1547.509] -- 0:01:38
Average standard deviation of split frequencies: 0.017137
595500 -- (-1553.036) (-1550.348) (-1542.893) [-1543.165] * (-1549.515) [-1544.533] (-1547.086) (-1549.881) -- 0:01:37
596000 -- [-1543.114] (-1547.739) (-1549.094) (-1547.645) * (-1546.525) (-1543.878) [-1545.555] (-1550.033) -- 0:01:37
596500 -- [-1544.918] (-1546.325) (-1551.103) (-1546.618) * [-1542.751] (-1553.588) (-1548.171) (-1560.445) -- 0:01:37
597000 -- (-1545.304) (-1542.361) (-1546.426) [-1548.929] * (-1545.973) (-1549.986) [-1548.054] (-1548.342) -- 0:01:37
597500 -- (-1546.050) (-1552.763) (-1545.497) [-1544.360] * (-1557.012) [-1548.244] (-1546.560) (-1550.751) -- 0:01:37
598000 -- (-1546.835) (-1550.624) [-1544.051] (-1547.545) * (-1546.066) (-1553.785) [-1544.398] (-1550.319) -- 0:01:37
598500 -- [-1550.871] (-1554.002) (-1543.338) (-1551.813) * [-1544.469] (-1546.374) (-1546.100) (-1545.424) -- 0:01:37
599000 -- (-1557.859) (-1565.753) (-1545.500) [-1548.759] * (-1550.591) [-1548.562] (-1544.805) (-1543.822) -- 0:01:37
599500 -- (-1547.289) (-1553.922) (-1545.813) [-1543.450] * (-1542.727) [-1553.122] (-1544.148) (-1548.091) -- 0:01:36
600000 -- (-1543.314) [-1548.418] (-1545.471) (-1552.818) * (-1549.021) [-1543.076] (-1546.307) (-1546.586) -- 0:01:36
Average standard deviation of split frequencies: 0.020405
600500 -- [-1544.503] (-1551.291) (-1540.792) (-1548.580) * (-1547.759) (-1547.231) (-1546.108) [-1550.280] -- 0:01:36
601000 -- (-1541.427) (-1545.007) (-1544.767) [-1549.140] * (-1543.956) [-1546.692] (-1549.409) (-1542.809) -- 0:01:36
601500 -- (-1557.747) (-1549.017) [-1545.486] (-1555.725) * (-1549.534) (-1547.949) [-1542.630] (-1545.853) -- 0:01:36
602000 -- (-1548.002) (-1547.116) (-1543.702) [-1551.032] * (-1549.060) (-1551.852) [-1543.182] (-1547.608) -- 0:01:36
602500 -- (-1546.792) [-1546.075] (-1546.833) (-1552.918) * (-1548.624) (-1557.162) (-1547.877) [-1542.893] -- 0:01:36
603000 -- [-1544.732] (-1548.900) (-1547.062) (-1548.508) * [-1541.485] (-1553.790) (-1544.817) (-1549.215) -- 0:01:36
603500 -- (-1544.673) (-1545.528) (-1549.826) [-1548.318] * (-1548.890) (-1547.628) (-1548.005) [-1550.097] -- 0:01:35
604000 -- (-1547.802) [-1543.263] (-1549.509) (-1544.091) * (-1547.141) [-1549.772] (-1546.785) (-1544.259) -- 0:01:35
604500 -- [-1543.562] (-1543.002) (-1548.438) (-1546.586) * (-1544.719) (-1554.357) (-1552.877) [-1545.825] -- 0:01:35
605000 -- (-1552.870) (-1545.176) (-1551.616) [-1548.127] * (-1549.572) (-1547.807) (-1550.213) [-1542.896] -- 0:01:35
Average standard deviation of split frequencies: 0.020225
605500 -- (-1551.025) [-1544.790] (-1545.425) (-1547.052) * [-1544.403] (-1542.155) (-1545.564) (-1544.551) -- 0:01:35
606000 -- (-1555.785) (-1547.043) [-1543.708] (-1552.466) * (-1546.958) [-1548.888] (-1547.920) (-1543.300) -- 0:01:35
606500 -- (-1547.991) (-1548.170) (-1548.592) [-1547.809] * (-1545.937) [-1542.315] (-1547.503) (-1543.044) -- 0:01:35
607000 -- (-1548.678) (-1546.644) (-1545.933) [-1545.929] * (-1547.884) (-1551.015) [-1545.503] (-1545.603) -- 0:01:35
607500 -- (-1546.489) [-1545.396] (-1544.109) (-1547.119) * (-1547.494) (-1544.273) [-1541.728] (-1547.581) -- 0:01:34
608000 -- (-1549.596) [-1543.937] (-1545.079) (-1545.169) * (-1546.320) (-1547.071) (-1547.322) [-1543.738] -- 0:01:34
608500 -- [-1546.538] (-1543.217) (-1542.000) (-1545.035) * (-1549.960) [-1554.136] (-1550.801) (-1547.824) -- 0:01:34
609000 -- [-1548.781] (-1548.517) (-1545.096) (-1543.947) * [-1549.621] (-1557.229) (-1548.610) (-1548.463) -- 0:01:34
609500 -- (-1550.884) (-1545.546) [-1551.409] (-1549.391) * (-1552.519) [-1545.626] (-1549.607) (-1544.968) -- 0:01:34
610000 -- (-1546.863) [-1543.372] (-1545.576) (-1543.394) * (-1545.443) [-1552.699] (-1547.620) (-1543.555) -- 0:01:34
Average standard deviation of split frequencies: 0.018784
610500 -- (-1554.633) (-1541.475) [-1550.626] (-1544.552) * (-1551.853) [-1549.305] (-1547.156) (-1549.296) -- 0:01:34
611000 -- (-1550.859) (-1544.464) (-1545.377) [-1545.674] * (-1550.107) [-1548.535] (-1550.079) (-1548.611) -- 0:01:34
611500 -- [-1543.946] (-1549.171) (-1548.279) (-1545.468) * (-1552.758) (-1549.623) [-1541.003] (-1550.927) -- 0:01:34
612000 -- (-1552.639) (-1547.309) [-1545.835] (-1555.440) * (-1549.129) [-1548.035] (-1542.759) (-1545.651) -- 0:01:33
612500 -- (-1548.579) [-1546.655] (-1545.021) (-1547.774) * (-1552.602) [-1550.214] (-1547.295) (-1549.874) -- 0:01:33
613000 -- (-1545.731) (-1550.368) (-1546.419) [-1549.373] * (-1552.867) (-1545.327) (-1543.421) [-1545.454] -- 0:01:33
613500 -- (-1549.230) [-1550.427] (-1548.460) (-1553.494) * (-1552.657) [-1544.793] (-1545.630) (-1550.465) -- 0:01:33
614000 -- (-1548.326) (-1554.993) (-1543.332) [-1554.520] * (-1549.082) (-1544.933) [-1545.763] (-1551.911) -- 0:01:33
614500 -- [-1545.311] (-1550.077) (-1547.762) (-1546.392) * (-1547.571) (-1547.234) [-1547.255] (-1550.297) -- 0:01:33
615000 -- (-1550.742) [-1547.925] (-1543.003) (-1547.404) * (-1548.577) [-1547.512] (-1549.174) (-1553.865) -- 0:01:33
Average standard deviation of split frequencies: 0.016071
615500 -- (-1544.176) (-1553.089) [-1543.974] (-1552.024) * (-1551.021) (-1547.139) [-1542.776] (-1545.571) -- 0:01:33
616000 -- [-1545.064] (-1547.810) (-1546.520) (-1548.262) * [-1546.668] (-1553.680) (-1545.731) (-1544.582) -- 0:01:32
616500 -- (-1551.645) (-1548.283) [-1548.557] (-1549.917) * (-1554.090) [-1546.987] (-1544.554) (-1545.815) -- 0:01:32
617000 -- (-1551.814) [-1544.977] (-1548.544) (-1547.084) * [-1553.718] (-1547.409) (-1547.512) (-1550.247) -- 0:01:32
617500 -- (-1543.381) [-1544.900] (-1547.102) (-1554.047) * [-1546.992] (-1544.796) (-1545.352) (-1540.911) -- 0:01:32
618000 -- (-1543.190) (-1552.207) [-1542.932] (-1543.714) * [-1544.802] (-1545.905) (-1543.882) (-1552.451) -- 0:01:32
618500 -- [-1546.597] (-1552.971) (-1549.859) (-1549.366) * (-1550.689) [-1547.120] (-1544.717) (-1543.049) -- 0:01:32
619000 -- (-1545.964) [-1545.730] (-1547.722) (-1547.688) * [-1545.933] (-1543.623) (-1552.613) (-1545.481) -- 0:01:32
619500 -- (-1545.527) [-1544.350] (-1545.698) (-1545.499) * [-1543.751] (-1542.238) (-1554.787) (-1549.577) -- 0:01:32
620000 -- (-1546.700) (-1551.561) (-1550.303) [-1546.328] * (-1548.854) (-1545.875) (-1560.791) [-1546.424] -- 0:01:31
Average standard deviation of split frequencies: 0.015950
620500 -- (-1547.113) (-1549.286) [-1545.822] (-1547.765) * [-1547.525] (-1551.369) (-1554.246) (-1547.773) -- 0:01:31
621000 -- [-1552.180] (-1543.501) (-1549.849) (-1544.502) * [-1543.853] (-1545.859) (-1551.031) (-1546.729) -- 0:01:31
621500 -- (-1554.640) (-1553.404) (-1548.617) [-1543.071] * [-1550.960] (-1548.079) (-1546.141) (-1544.679) -- 0:01:31
622000 -- (-1548.431) [-1558.131] (-1550.640) (-1543.240) * (-1551.192) (-1544.519) (-1544.161) [-1550.066] -- 0:01:31
622500 -- (-1547.399) (-1547.093) [-1546.684] (-1548.374) * (-1552.030) [-1544.438] (-1548.871) (-1548.289) -- 0:01:31
623000 -- [-1541.662] (-1544.942) (-1549.849) (-1544.902) * [-1547.553] (-1547.781) (-1544.966) (-1542.069) -- 0:01:31
623500 -- (-1555.872) (-1544.545) (-1545.196) [-1546.784] * (-1559.139) (-1545.384) (-1541.881) [-1545.510] -- 0:01:31
624000 -- [-1549.159] (-1541.909) (-1544.973) (-1547.737) * (-1546.704) (-1552.685) (-1547.450) [-1542.460] -- 0:01:30
624500 -- (-1547.520) (-1546.052) (-1546.762) [-1542.878] * [-1544.677] (-1549.761) (-1549.729) (-1542.747) -- 0:01:30
625000 -- (-1557.811) [-1545.954] (-1544.172) (-1546.226) * (-1547.881) (-1553.477) (-1546.099) [-1545.162] -- 0:01:30
Average standard deviation of split frequencies: 0.015312
625500 -- [-1546.659] (-1546.207) (-1544.303) (-1542.099) * (-1546.731) (-1544.397) [-1545.590] (-1549.086) -- 0:01:30
626000 -- (-1544.909) (-1546.103) (-1545.366) [-1543.972] * (-1546.640) (-1543.502) [-1546.212] (-1544.798) -- 0:01:30
626500 -- (-1547.053) [-1547.846] (-1547.621) (-1543.822) * (-1544.257) (-1547.488) (-1551.340) [-1546.895] -- 0:01:30
627000 -- (-1543.748) [-1543.741] (-1547.385) (-1548.054) * (-1544.353) (-1545.971) (-1547.229) [-1545.765] -- 0:01:30
627500 -- (-1553.932) (-1553.406) [-1546.496] (-1549.345) * (-1543.652) [-1555.646] (-1551.712) (-1544.724) -- 0:01:30
628000 -- [-1544.637] (-1551.477) (-1547.308) (-1549.860) * (-1546.492) (-1550.649) (-1545.298) [-1544.047] -- 0:01:30
628500 -- (-1547.170) (-1548.302) (-1548.564) [-1551.681] * (-1542.975) (-1546.034) (-1544.371) [-1548.983] -- 0:01:29
629000 -- (-1545.631) [-1542.543] (-1543.081) (-1549.418) * [-1549.092] (-1547.460) (-1548.588) (-1546.566) -- 0:01:29
629500 -- (-1549.032) [-1547.783] (-1550.830) (-1551.147) * [-1545.889] (-1559.772) (-1546.531) (-1551.935) -- 0:01:29
630000 -- [-1544.166] (-1543.577) (-1547.721) (-1545.558) * [-1545.354] (-1544.914) (-1545.490) (-1545.046) -- 0:01:29
Average standard deviation of split frequencies: 0.016195
630500 -- (-1547.380) [-1542.309] (-1547.374) (-1548.964) * (-1547.039) [-1545.451] (-1544.573) (-1547.619) -- 0:01:29
631000 -- (-1544.535) (-1547.926) (-1544.727) [-1546.953] * [-1545.704] (-1547.100) (-1552.792) (-1548.166) -- 0:01:29
631500 -- [-1549.492] (-1544.251) (-1546.911) (-1550.673) * (-1541.069) (-1551.174) [-1540.253] (-1553.013) -- 0:01:29
632000 -- (-1552.229) (-1552.900) [-1541.873] (-1547.829) * [-1545.440] (-1555.556) (-1549.987) (-1553.329) -- 0:01:29
632500 -- (-1548.200) (-1550.778) (-1543.903) [-1546.725] * (-1546.225) (-1544.380) [-1542.850] (-1544.706) -- 0:01:28
633000 -- [-1543.860] (-1546.596) (-1549.389) (-1545.492) * (-1552.016) (-1547.774) (-1544.927) [-1548.632] -- 0:01:28
633500 -- [-1546.234] (-1548.605) (-1548.426) (-1550.196) * [-1550.748] (-1546.635) (-1543.516) (-1548.486) -- 0:01:28
634000 -- (-1543.290) [-1545.642] (-1552.493) (-1545.493) * (-1558.716) (-1545.393) [-1541.812] (-1545.554) -- 0:01:28
634500 -- (-1548.883) (-1543.985) [-1547.769] (-1546.126) * (-1543.918) (-1544.870) [-1545.257] (-1549.424) -- 0:01:28
635000 -- (-1545.543) [-1543.755] (-1549.047) (-1547.967) * (-1546.775) (-1544.261) [-1544.777] (-1551.111) -- 0:01:28
Average standard deviation of split frequencies: 0.014330
635500 -- (-1549.922) [-1550.468] (-1545.843) (-1546.675) * [-1544.324] (-1550.824) (-1552.450) (-1546.084) -- 0:01:28
636000 -- [-1544.501] (-1550.143) (-1543.778) (-1545.899) * [-1546.041] (-1543.001) (-1553.729) (-1553.747) -- 0:01:28
636500 -- (-1548.068) (-1552.620) [-1543.458] (-1545.594) * (-1545.146) [-1547.473] (-1544.716) (-1554.261) -- 0:01:27
637000 -- [-1541.908] (-1552.245) (-1543.351) (-1557.624) * (-1544.627) [-1541.883] (-1545.528) (-1553.218) -- 0:01:27
637500 -- [-1555.354] (-1547.738) (-1546.305) (-1546.005) * (-1553.056) (-1544.268) (-1545.920) [-1545.386] -- 0:01:27
638000 -- (-1549.704) (-1551.120) (-1545.222) [-1546.789] * [-1542.644] (-1551.778) (-1547.682) (-1550.191) -- 0:01:27
638500 -- [-1548.210] (-1544.096) (-1546.015) (-1544.932) * (-1542.992) [-1547.632] (-1548.381) (-1548.127) -- 0:01:27
639000 -- (-1548.179) [-1546.376] (-1552.794) (-1550.506) * (-1546.457) (-1548.355) [-1546.334] (-1547.647) -- 0:01:27
639500 -- (-1549.593) [-1547.483] (-1545.730) (-1555.020) * (-1546.094) (-1544.629) [-1546.335] (-1556.851) -- 0:01:27
640000 -- [-1555.854] (-1550.586) (-1549.516) (-1555.130) * (-1544.315) [-1543.376] (-1547.242) (-1546.631) -- 0:01:27
Average standard deviation of split frequencies: 0.013980
640500 -- [-1545.748] (-1550.381) (-1546.207) (-1546.624) * (-1551.556) (-1550.288) [-1557.280] (-1551.332) -- 0:01:26
641000 -- [-1541.662] (-1549.349) (-1547.488) (-1546.657) * (-1554.233) (-1545.071) (-1551.030) [-1547.194] -- 0:01:26
641500 -- [-1546.143] (-1549.335) (-1550.149) (-1547.979) * (-1561.534) [-1545.610] (-1547.191) (-1547.849) -- 0:01:26
642000 -- (-1543.581) [-1546.031] (-1550.484) (-1542.194) * (-1552.406) (-1548.824) [-1544.773] (-1546.000) -- 0:01:26
642500 -- [-1546.186] (-1544.864) (-1551.668) (-1552.363) * (-1547.608) (-1545.439) (-1544.294) [-1548.011] -- 0:01:26
643000 -- (-1544.161) [-1548.398] (-1553.062) (-1547.483) * (-1541.948) (-1550.608) (-1549.938) [-1553.664] -- 0:01:26
643500 -- [-1544.866] (-1549.819) (-1548.572) (-1552.327) * (-1552.318) (-1547.102) (-1554.367) [-1551.088] -- 0:01:26
644000 -- [-1543.439] (-1548.853) (-1553.611) (-1546.461) * (-1549.012) (-1547.237) (-1560.168) [-1551.247] -- 0:01:26
644500 -- (-1546.284) [-1549.526] (-1546.383) (-1542.309) * (-1545.335) (-1547.345) [-1547.332] (-1545.723) -- 0:01:26
645000 -- [-1544.991] (-1545.969) (-1552.437) (-1547.922) * (-1548.978) (-1549.929) [-1547.554] (-1546.858) -- 0:01:25
Average standard deviation of split frequencies: 0.012649
645500 -- [-1542.971] (-1543.264) (-1550.960) (-1548.004) * [-1547.368] (-1546.259) (-1547.331) (-1547.818) -- 0:01:25
646000 -- (-1552.134) [-1548.771] (-1549.136) (-1545.736) * (-1552.370) (-1546.256) [-1544.380] (-1547.107) -- 0:01:25
646500 -- [-1546.896] (-1545.296) (-1552.898) (-1543.740) * (-1549.748) (-1548.930) (-1548.219) [-1543.256] -- 0:01:25
647000 -- (-1546.835) (-1547.484) [-1546.272] (-1547.613) * (-1549.123) (-1544.553) (-1545.287) [-1542.440] -- 0:01:25
647500 -- (-1544.736) [-1548.593] (-1551.976) (-1549.789) * (-1553.489) [-1550.348] (-1551.817) (-1551.548) -- 0:01:25
648000 -- (-1545.896) [-1544.271] (-1551.807) (-1553.760) * (-1546.549) (-1546.608) (-1546.210) [-1546.092] -- 0:01:25
648500 -- [-1546.860] (-1550.120) (-1544.029) (-1545.572) * (-1550.825) (-1548.452) (-1549.559) [-1556.324] -- 0:01:25
649000 -- (-1552.935) (-1548.499) [-1545.798] (-1548.398) * (-1550.757) [-1545.102] (-1545.010) (-1547.387) -- 0:01:24
649500 -- (-1549.659) [-1545.406] (-1545.116) (-1545.993) * [-1544.510] (-1545.145) (-1546.264) (-1548.358) -- 0:01:24
650000 -- (-1552.971) [-1547.702] (-1546.957) (-1544.145) * [-1547.326] (-1547.882) (-1548.877) (-1545.297) -- 0:01:24
Average standard deviation of split frequencies: 0.013524
650500 -- (-1555.139) [-1545.460] (-1548.869) (-1552.634) * (-1548.935) (-1550.257) (-1542.746) [-1546.900] -- 0:01:24
651000 -- (-1550.211) [-1543.441] (-1550.123) (-1546.413) * (-1545.332) (-1552.251) [-1546.293] (-1546.753) -- 0:01:24
651500 -- (-1550.354) [-1541.100] (-1552.101) (-1544.146) * [-1544.295] (-1547.077) (-1544.499) (-1551.017) -- 0:01:24
652000 -- (-1550.684) (-1549.898) [-1552.563] (-1547.776) * (-1546.382) (-1543.670) [-1548.013] (-1549.936) -- 0:01:24
652500 -- (-1546.557) (-1547.565) [-1546.828] (-1546.965) * [-1544.091] (-1549.383) (-1547.634) (-1553.064) -- 0:01:24
653000 -- [-1540.394] (-1546.554) (-1544.035) (-1552.977) * (-1546.760) (-1555.442) [-1545.138] (-1547.741) -- 0:01:23
653500 -- (-1543.190) (-1545.309) [-1544.482] (-1547.286) * [-1545.245] (-1562.997) (-1548.435) (-1544.898) -- 0:01:23
654000 -- (-1546.767) [-1543.891] (-1545.275) (-1547.408) * (-1542.826) (-1551.009) (-1542.663) [-1543.985] -- 0:01:23
654500 -- [-1543.297] (-1551.430) (-1543.640) (-1559.617) * (-1548.691) (-1548.570) [-1547.153] (-1548.250) -- 0:01:23
655000 -- (-1547.059) (-1554.073) (-1543.336) [-1546.407] * (-1549.077) [-1547.887] (-1548.494) (-1543.327) -- 0:01:23
Average standard deviation of split frequencies: 0.012216
655500 -- [-1543.551] (-1542.878) (-1550.640) (-1545.759) * (-1543.110) (-1550.317) (-1548.400) [-1548.243] -- 0:01:23
656000 -- (-1542.244) (-1551.121) (-1547.726) [-1548.242] * [-1542.792] (-1551.575) (-1540.048) (-1548.885) -- 0:01:23
656500 -- [-1547.055] (-1548.817) (-1549.232) (-1550.634) * (-1543.622) (-1547.379) (-1549.495) [-1544.308] -- 0:01:23
657000 -- [-1540.595] (-1548.628) (-1549.009) (-1551.852) * (-1543.119) (-1550.075) [-1541.491] (-1551.313) -- 0:01:23
657500 -- [-1547.460] (-1547.550) (-1547.142) (-1545.191) * (-1544.438) [-1545.649] (-1542.222) (-1544.149) -- 0:01:22
658000 -- [-1544.630] (-1546.628) (-1547.334) (-1547.177) * (-1548.193) (-1549.947) [-1543.308] (-1548.915) -- 0:01:22
658500 -- (-1542.608) (-1553.643) (-1554.034) [-1552.117] * (-1548.679) (-1551.654) [-1548.694] (-1542.752) -- 0:01:22
659000 -- [-1546.713] (-1553.836) (-1544.751) (-1547.467) * (-1546.703) [-1546.003] (-1550.419) (-1552.748) -- 0:01:22
659500 -- (-1543.076) (-1546.910) (-1548.578) [-1546.264] * (-1545.207) (-1543.154) [-1546.530] (-1546.941) -- 0:01:22
660000 -- [-1542.194] (-1547.832) (-1544.154) (-1547.182) * (-1549.238) [-1543.186] (-1547.741) (-1541.962) -- 0:01:22
Average standard deviation of split frequencies: 0.011654
660500 -- (-1542.080) (-1553.099) [-1546.410] (-1547.886) * (-1546.922) (-1545.464) (-1550.184) [-1544.363] -- 0:01:22
661000 -- (-1551.377) (-1552.584) (-1541.843) [-1550.577] * (-1541.048) (-1549.864) [-1547.344] (-1547.175) -- 0:01:22
661500 -- (-1546.190) [-1541.727] (-1547.407) (-1552.684) * [-1545.639] (-1544.074) (-1543.586) (-1549.277) -- 0:01:21
662000 -- [-1546.409] (-1548.319) (-1548.698) (-1547.592) * (-1545.836) (-1552.328) [-1543.644] (-1546.025) -- 0:01:21
662500 -- (-1548.567) (-1544.768) (-1551.977) [-1547.041] * (-1545.994) [-1544.375] (-1544.855) (-1543.166) -- 0:01:21
663000 -- (-1559.173) [-1548.654] (-1544.094) (-1543.710) * (-1544.465) (-1547.555) [-1546.442] (-1548.197) -- 0:01:21
663500 -- (-1545.480) (-1547.537) [-1545.202] (-1549.158) * (-1552.321) (-1543.084) [-1548.169] (-1549.302) -- 0:01:21
664000 -- (-1542.802) (-1553.149) (-1543.202) [-1545.289] * (-1544.919) (-1549.563) [-1546.121] (-1550.039) -- 0:01:21
664500 -- [-1544.221] (-1551.996) (-1543.942) (-1550.147) * (-1549.684) (-1552.461) (-1544.001) [-1548.599] -- 0:01:21
665000 -- (-1549.436) [-1556.666] (-1547.856) (-1547.037) * (-1557.649) (-1545.143) [-1548.236] (-1544.337) -- 0:01:21
Average standard deviation of split frequencies: 0.011561
665500 -- [-1548.614] (-1550.318) (-1543.824) (-1553.170) * [-1556.890] (-1547.921) (-1550.299) (-1543.817) -- 0:01:20
666000 -- (-1550.569) (-1554.153) (-1545.810) [-1545.490] * (-1550.850) (-1549.887) (-1548.927) [-1542.766] -- 0:01:20
666500 -- [-1545.984] (-1550.293) (-1546.785) (-1547.942) * (-1549.406) (-1548.794) [-1547.026] (-1550.693) -- 0:01:20
667000 -- (-1553.168) [-1548.732] (-1542.987) (-1545.489) * (-1546.768) (-1545.467) [-1543.558] (-1550.173) -- 0:01:20
667500 -- [-1546.698] (-1560.324) (-1542.548) (-1545.170) * [-1543.388] (-1550.300) (-1547.912) (-1553.332) -- 0:01:20
668000 -- (-1547.894) (-1548.526) [-1541.953] (-1544.618) * [-1544.511] (-1553.981) (-1547.254) (-1553.421) -- 0:01:20
668500 -- (-1554.464) (-1549.829) [-1553.792] (-1545.385) * (-1548.494) (-1547.816) [-1547.356] (-1547.486) -- 0:01:20
669000 -- (-1549.364) (-1553.970) [-1544.195] (-1547.903) * [-1546.471] (-1552.033) (-1549.391) (-1547.873) -- 0:01:20
669500 -- (-1551.513) [-1554.693] (-1546.112) (-1547.392) * (-1547.958) [-1548.710] (-1546.695) (-1548.480) -- 0:01:19
670000 -- (-1548.275) [-1544.491] (-1547.209) (-1549.125) * [-1542.340] (-1546.491) (-1546.119) (-1542.692) -- 0:01:19
Average standard deviation of split frequencies: 0.012183
670500 -- [-1544.376] (-1549.210) (-1547.359) (-1545.224) * (-1545.599) (-1552.619) (-1549.897) [-1542.545] -- 0:01:19
671000 -- (-1547.652) (-1551.296) (-1546.999) [-1548.964] * [-1543.571] (-1551.467) (-1549.045) (-1543.474) -- 0:01:19
671500 -- (-1548.904) (-1552.478) [-1551.547] (-1547.217) * (-1548.893) (-1543.074) [-1554.188] (-1546.198) -- 0:01:19
672000 -- (-1550.769) [-1548.636] (-1544.845) (-1544.327) * (-1552.663) (-1544.982) (-1545.592) [-1543.889] -- 0:01:19
672500 -- (-1551.284) [-1549.084] (-1545.270) (-1548.221) * (-1547.876) (-1541.580) (-1550.895) [-1547.409] -- 0:01:19
673000 -- [-1544.493] (-1554.011) (-1552.080) (-1552.833) * [-1544.195] (-1551.132) (-1542.220) (-1547.287) -- 0:01:19
673500 -- (-1547.822) [-1547.373] (-1552.314) (-1548.359) * (-1554.097) (-1543.879) (-1547.597) [-1549.743] -- 0:01:19
674000 -- [-1546.050] (-1548.449) (-1554.358) (-1551.322) * (-1547.534) [-1550.245] (-1558.511) (-1549.540) -- 0:01:18
674500 -- (-1541.386) [-1543.135] (-1557.592) (-1548.791) * (-1551.248) [-1545.799] (-1548.832) (-1546.711) -- 0:01:18
675000 -- (-1549.479) [-1542.902] (-1544.582) (-1546.765) * (-1544.936) (-1553.312) (-1555.897) [-1547.577] -- 0:01:18
Average standard deviation of split frequencies: 0.012785
675500 -- (-1546.168) (-1548.673) (-1549.770) [-1547.076] * (-1545.627) (-1558.685) [-1544.777] (-1550.377) -- 0:01:18
676000 -- (-1558.913) (-1544.448) (-1545.862) [-1543.216] * [-1541.434] (-1553.090) (-1544.582) (-1544.098) -- 0:01:18
676500 -- (-1546.977) (-1547.952) [-1547.527] (-1549.760) * [-1544.334] (-1553.844) (-1541.933) (-1544.864) -- 0:01:18
677000 -- (-1550.729) (-1547.355) (-1545.441) [-1547.840] * (-1549.214) (-1548.759) (-1547.713) [-1545.359] -- 0:01:18
677500 -- [-1550.114] (-1548.269) (-1543.558) (-1547.128) * [-1547.927] (-1550.461) (-1545.348) (-1551.911) -- 0:01:18
678000 -- (-1552.122) [-1554.000] (-1547.514) (-1544.728) * [-1549.080] (-1545.988) (-1550.472) (-1545.221) -- 0:01:17
678500 -- (-1551.730) (-1548.792) (-1550.939) [-1551.275] * (-1547.430) (-1545.689) [-1541.624] (-1541.592) -- 0:01:17
679000 -- [-1545.922] (-1548.372) (-1546.214) (-1552.447) * (-1551.179) (-1546.714) (-1551.147) [-1546.608] -- 0:01:17
679500 -- [-1540.873] (-1550.362) (-1549.601) (-1547.275) * (-1546.042) [-1544.331] (-1548.579) (-1545.100) -- 0:01:17
680000 -- [-1543.049] (-1551.565) (-1548.192) (-1544.184) * (-1543.072) (-1547.409) [-1546.761] (-1543.239) -- 0:01:17
Average standard deviation of split frequencies: 0.010619
680500 -- (-1553.251) [-1544.279] (-1555.224) (-1548.106) * (-1557.409) (-1543.453) (-1545.617) [-1545.851] -- 0:01:17
681000 -- (-1542.118) (-1549.644) (-1552.516) [-1543.498] * [-1545.274] (-1544.408) (-1545.909) (-1546.133) -- 0:01:17
681500 -- (-1550.113) [-1544.579] (-1548.899) (-1550.507) * (-1550.862) (-1547.166) [-1547.494] (-1546.402) -- 0:01:17
682000 -- [-1548.406] (-1543.497) (-1558.108) (-1547.458) * (-1547.080) [-1548.270] (-1546.765) (-1544.271) -- 0:01:16
682500 -- (-1553.037) [-1543.206] (-1549.314) (-1545.988) * (-1547.451) [-1549.843] (-1551.152) (-1553.240) -- 0:01:16
683000 -- [-1546.710] (-1546.450) (-1553.205) (-1550.212) * (-1547.471) (-1547.015) [-1546.313] (-1546.636) -- 0:01:16
683500 -- (-1544.203) (-1547.786) [-1554.940] (-1548.725) * (-1547.057) (-1547.708) (-1550.651) [-1544.688] -- 0:01:16
684000 -- (-1544.306) (-1547.672) (-1547.969) [-1543.172] * [-1546.826] (-1542.841) (-1546.837) (-1549.260) -- 0:01:16
684500 -- (-1545.130) [-1543.024] (-1548.876) (-1549.030) * (-1547.357) (-1548.413) [-1552.285] (-1561.595) -- 0:01:16
685000 -- [-1550.733] (-1547.236) (-1552.289) (-1547.089) * (-1545.760) (-1545.001) (-1547.981) [-1552.075] -- 0:01:16
Average standard deviation of split frequencies: 0.011224
685500 -- [-1545.097] (-1557.287) (-1545.149) (-1544.470) * (-1553.702) [-1553.417] (-1548.427) (-1545.581) -- 0:01:16
686000 -- (-1549.142) [-1549.072] (-1548.106) (-1550.141) * (-1547.513) (-1555.786) [-1542.476] (-1547.925) -- 0:01:15
686500 -- (-1543.578) [-1545.774] (-1542.970) (-1548.696) * [-1546.113] (-1548.006) (-1549.546) (-1545.061) -- 0:01:15
687000 -- [-1543.781] (-1542.983) (-1550.447) (-1544.873) * (-1545.430) (-1547.960) (-1549.423) [-1544.351] -- 0:01:15
687500 -- (-1547.674) (-1545.648) [-1547.656] (-1547.543) * (-1549.070) (-1546.737) [-1547.559] (-1547.151) -- 0:01:15
688000 -- [-1548.843] (-1542.234) (-1545.388) (-1549.163) * [-1551.009] (-1545.820) (-1543.870) (-1545.166) -- 0:01:15
688500 -- (-1544.175) [-1544.329] (-1543.164) (-1543.460) * (-1547.156) [-1548.112] (-1548.155) (-1545.144) -- 0:01:15
689000 -- (-1548.058) (-1544.543) (-1545.903) [-1549.177] * [-1543.230] (-1548.634) (-1546.211) (-1549.265) -- 0:01:15
689500 -- (-1544.560) (-1547.177) [-1544.673] (-1547.007) * (-1559.061) (-1544.615) [-1543.702] (-1545.450) -- 0:01:15
690000 -- (-1545.760) [-1545.857] (-1546.211) (-1551.801) * (-1550.991) (-1551.290) (-1555.800) [-1548.035] -- 0:01:15
Average standard deviation of split frequencies: 0.011376
690500 -- (-1544.037) (-1541.327) (-1548.058) [-1543.158] * (-1552.516) [-1550.178] (-1542.051) (-1548.259) -- 0:01:14
691000 -- (-1553.658) (-1550.668) (-1552.088) [-1546.370] * [-1549.181] (-1547.886) (-1543.382) (-1548.404) -- 0:01:14
691500 -- (-1550.420) [-1542.337] (-1548.003) (-1547.707) * (-1550.021) (-1543.442) (-1547.165) [-1541.788] -- 0:01:14
692000 -- (-1547.318) (-1541.100) (-1547.581) [-1543.510] * [-1545.550] (-1550.517) (-1548.936) (-1543.140) -- 0:01:14
692500 -- (-1550.786) [-1544.450] (-1548.322) (-1544.811) * (-1549.513) (-1547.012) (-1548.679) [-1542.610] -- 0:01:14
693000 -- [-1545.085] (-1548.764) (-1543.521) (-1546.034) * [-1542.990] (-1547.945) (-1547.984) (-1549.310) -- 0:01:14
693500 -- (-1548.105) [-1544.712] (-1547.475) (-1552.528) * (-1546.206) (-1549.012) [-1546.848] (-1547.274) -- 0:01:14
694000 -- [-1544.587] (-1548.541) (-1541.500) (-1549.033) * [-1548.697] (-1544.651) (-1545.669) (-1549.368) -- 0:01:14
694500 -- [-1548.731] (-1547.823) (-1547.246) (-1548.127) * (-1550.687) (-1551.610) (-1552.582) [-1544.267] -- 0:01:13
695000 -- (-1545.050) (-1547.796) [-1545.421] (-1545.157) * (-1548.586) [-1547.087] (-1552.850) (-1549.867) -- 0:01:13
Average standard deviation of split frequencies: 0.010160
695500 -- (-1543.978) [-1548.647] (-1543.740) (-1541.740) * (-1552.842) (-1543.830) [-1551.573] (-1547.371) -- 0:01:13
696000 -- (-1547.452) [-1547.901] (-1549.901) (-1544.779) * (-1553.417) (-1543.543) [-1545.739] (-1548.184) -- 0:01:13
696500 -- (-1546.869) (-1555.990) (-1548.134) [-1544.160] * (-1550.764) [-1550.168] (-1554.720) (-1553.021) -- 0:01:13
697000 -- (-1548.602) [-1547.358] (-1548.580) (-1545.158) * (-1546.386) [-1544.504] (-1540.762) (-1544.528) -- 0:01:13
697500 -- (-1548.565) (-1545.464) [-1552.493] (-1547.023) * (-1555.416) (-1549.701) [-1544.078] (-1549.869) -- 0:01:13
698000 -- (-1550.933) (-1546.044) [-1546.651] (-1551.189) * [-1545.918] (-1550.982) (-1541.780) (-1550.658) -- 0:01:13
698500 -- (-1542.459) (-1548.332) [-1545.065] (-1547.708) * (-1547.411) (-1548.721) (-1546.249) [-1543.130] -- 0:01:12
699000 -- [-1553.350] (-1542.360) (-1548.533) (-1550.076) * [-1550.229] (-1543.514) (-1549.090) (-1548.998) -- 0:01:12
699500 -- (-1546.441) (-1544.036) (-1547.559) [-1544.739] * (-1544.499) (-1544.816) (-1545.780) [-1546.229] -- 0:01:12
700000 -- (-1552.271) (-1544.281) (-1553.001) [-1543.690] * (-1550.391) (-1543.578) (-1550.203) [-1549.112] -- 0:01:12
Average standard deviation of split frequencies: 0.011662
700500 -- (-1550.782) (-1549.168) (-1546.660) [-1544.346] * [-1545.407] (-1547.768) (-1551.892) (-1545.558) -- 0:01:12
701000 -- (-1552.350) [-1548.642] (-1546.478) (-1546.300) * (-1547.502) (-1552.746) [-1550.072] (-1550.366) -- 0:01:12
701500 -- (-1549.854) (-1546.202) (-1547.602) [-1545.105] * (-1556.982) (-1552.270) [-1549.803] (-1547.239) -- 0:01:12
702000 -- (-1556.350) [-1546.497] (-1549.271) (-1545.066) * (-1543.545) (-1556.089) (-1551.271) [-1544.365] -- 0:01:12
702500 -- (-1544.404) (-1549.623) [-1545.089] (-1553.053) * [-1546.178] (-1552.867) (-1547.749) (-1551.038) -- 0:01:11
703000 -- [-1548.832] (-1541.886) (-1547.089) (-1545.854) * (-1548.122) (-1548.756) (-1551.431) [-1543.484] -- 0:01:11
703500 -- (-1547.046) [-1546.253] (-1547.748) (-1550.164) * (-1560.233) [-1546.401] (-1548.980) (-1546.285) -- 0:01:12
704000 -- (-1546.455) (-1550.423) [-1542.605] (-1552.936) * [-1545.361] (-1544.885) (-1544.844) (-1553.104) -- 0:01:11
704500 -- (-1545.677) [-1552.458] (-1543.407) (-1549.401) * (-1545.333) (-1546.364) [-1544.674] (-1548.306) -- 0:01:11
705000 -- (-1541.566) (-1544.868) [-1545.152] (-1544.592) * [-1543.050] (-1551.410) (-1544.406) (-1542.965) -- 0:01:11
Average standard deviation of split frequencies: 0.010461
705500 -- (-1544.901) (-1542.598) [-1550.726] (-1545.822) * [-1548.376] (-1545.687) (-1547.840) (-1546.924) -- 0:01:11
706000 -- [-1545.095] (-1545.201) (-1544.673) (-1548.087) * [-1550.124] (-1552.666) (-1545.504) (-1544.930) -- 0:01:11
706500 -- (-1541.158) (-1553.256) [-1544.453] (-1544.188) * (-1547.292) (-1552.503) (-1546.431) [-1542.961] -- 0:01:11
707000 -- [-1543.096] (-1552.268) (-1547.518) (-1547.469) * (-1550.759) (-1550.313) [-1546.567] (-1551.092) -- 0:01:11
707500 -- (-1549.396) [-1545.491] (-1544.688) (-1550.087) * [-1548.951] (-1547.971) (-1546.315) (-1547.018) -- 0:01:11
708000 -- [-1550.847] (-1544.832) (-1546.844) (-1546.388) * [-1545.412] (-1546.693) (-1542.445) (-1547.042) -- 0:01:10
708500 -- (-1546.200) (-1546.501) (-1543.910) [-1543.080] * (-1542.006) [-1547.599] (-1549.514) (-1548.950) -- 0:01:10
709000 -- (-1549.887) (-1547.238) [-1544.480] (-1546.074) * [-1547.494] (-1548.066) (-1552.983) (-1549.887) -- 0:01:10
709500 -- [-1546.930] (-1548.280) (-1545.567) (-1543.768) * (-1551.547) (-1547.482) (-1557.235) [-1544.350] -- 0:01:10
710000 -- [-1546.395] (-1549.275) (-1543.774) (-1542.694) * (-1548.384) (-1545.016) (-1546.312) [-1545.541] -- 0:01:10
Average standard deviation of split frequencies: 0.009950
710500 -- (-1548.097) (-1545.630) [-1547.395] (-1550.999) * (-1550.805) (-1547.582) (-1545.765) [-1542.882] -- 0:01:10
711000 -- [-1546.711] (-1548.734) (-1544.895) (-1549.513) * (-1546.810) [-1546.026] (-1549.926) (-1544.339) -- 0:01:09
711500 -- (-1550.835) (-1546.373) [-1546.926] (-1556.438) * (-1541.114) (-1542.399) [-1554.244] (-1543.025) -- 0:01:10
712000 -- (-1546.767) (-1556.060) (-1550.826) [-1545.400] * (-1551.444) (-1545.635) (-1547.887) [-1548.164] -- 0:01:09
712500 -- (-1549.841) (-1548.015) [-1546.489] (-1555.828) * (-1547.098) (-1547.105) (-1546.357) [-1544.518] -- 0:01:09
713000 -- (-1546.826) (-1555.317) [-1549.289] (-1547.507) * (-1544.519) [-1542.129] (-1546.167) (-1544.189) -- 0:01:09
713500 -- (-1546.138) (-1549.282) (-1546.051) [-1547.353] * (-1547.890) [-1545.485] (-1546.307) (-1545.163) -- 0:01:09
714000 -- (-1546.211) [-1552.314] (-1553.078) (-1551.749) * [-1545.601] (-1544.598) (-1548.452) (-1546.306) -- 0:01:09
714500 -- [-1545.566] (-1545.172) (-1551.296) (-1554.971) * (-1544.208) (-1552.910) (-1552.103) [-1543.913] -- 0:01:09
715000 -- (-1545.921) [-1545.889] (-1550.922) (-1549.467) * (-1547.952) (-1544.467) (-1547.407) [-1546.080] -- 0:01:08
Average standard deviation of split frequencies: 0.011193
715500 -- (-1546.071) (-1550.329) (-1542.122) [-1548.518] * [-1550.472] (-1549.732) (-1546.971) (-1549.717) -- 0:01:09
716000 -- [-1546.406] (-1545.044) (-1546.939) (-1544.991) * (-1544.679) [-1553.099] (-1543.232) (-1545.760) -- 0:01:09
716500 -- (-1545.094) (-1545.259) (-1555.879) [-1551.417] * (-1547.335) (-1548.927) [-1543.665] (-1549.527) -- 0:01:08
717000 -- (-1551.152) [-1549.145] (-1551.650) (-1554.984) * [-1547.419] (-1548.307) (-1549.258) (-1546.884) -- 0:01:08
717500 -- (-1545.199) (-1549.898) [-1542.432] (-1555.434) * (-1549.739) (-1542.763) (-1547.558) [-1545.122] -- 0:01:08
718000 -- [-1545.122] (-1546.626) (-1542.619) (-1544.975) * [-1548.522] (-1551.145) (-1549.264) (-1553.048) -- 0:01:08
718500 -- (-1549.244) (-1554.325) (-1545.001) [-1545.398] * (-1554.473) (-1548.827) (-1545.971) [-1545.440] -- 0:01:08
719000 -- (-1546.048) (-1550.540) [-1546.651] (-1542.362) * (-1548.611) [-1546.643] (-1548.512) (-1549.099) -- 0:01:08
719500 -- [-1541.320] (-1545.336) (-1553.798) (-1546.734) * (-1547.954) (-1545.350) [-1540.575] (-1546.294) -- 0:01:08
720000 -- (-1549.324) (-1544.341) (-1554.458) [-1549.910] * (-1545.127) (-1543.316) (-1541.761) [-1548.024] -- 0:01:08
Average standard deviation of split frequencies: 0.011774
720500 -- (-1545.488) (-1549.032) [-1544.773] (-1545.394) * (-1555.765) [-1550.319] (-1556.512) (-1551.239) -- 0:01:07
721000 -- [-1545.026] (-1541.563) (-1552.264) (-1544.820) * (-1549.512) (-1547.363) (-1547.273) [-1545.518] -- 0:01:07
721500 -- (-1544.859) [-1546.147] (-1550.384) (-1541.808) * [-1543.239] (-1547.015) (-1547.441) (-1550.308) -- 0:01:07
722000 -- (-1554.089) [-1544.859] (-1546.660) (-1549.223) * (-1544.798) (-1550.030) [-1550.774] (-1544.618) -- 0:01:07
722500 -- (-1548.054) [-1543.541] (-1545.572) (-1542.648) * (-1546.394) (-1559.466) (-1550.889) [-1544.403] -- 0:01:07
723000 -- (-1545.574) [-1550.880] (-1544.512) (-1552.859) * (-1548.611) (-1548.643) [-1543.555] (-1545.534) -- 0:01:07
723500 -- (-1545.070) (-1552.207) (-1547.246) [-1548.506] * (-1545.387) (-1548.876) (-1545.305) [-1549.671] -- 0:01:07
724000 -- [-1542.302] (-1553.045) (-1549.460) (-1548.803) * (-1549.915) (-1549.639) [-1541.620] (-1549.551) -- 0:01:07
724500 -- (-1548.432) [-1546.740] (-1552.728) (-1549.603) * [-1545.521] (-1549.731) (-1546.117) (-1549.124) -- 0:01:06
725000 -- (-1548.204) (-1547.578) (-1554.908) [-1542.181] * (-1552.259) (-1543.700) [-1550.567] (-1546.707) -- 0:01:06
Average standard deviation of split frequencies: 0.011038
725500 -- (-1545.523) (-1542.837) [-1548.330] (-1544.394) * (-1555.600) [-1547.813] (-1543.341) (-1546.339) -- 0:01:06
726000 -- (-1547.898) (-1550.293) [-1543.573] (-1548.161) * (-1546.884) (-1547.804) (-1549.137) [-1552.686] -- 0:01:06
726500 -- [-1548.074] (-1551.108) (-1543.163) (-1545.654) * (-1547.059) (-1544.079) (-1551.136) [-1548.331] -- 0:01:06
727000 -- (-1543.635) (-1545.424) [-1550.227] (-1551.323) * (-1540.657) (-1545.468) (-1544.981) [-1546.418] -- 0:01:06
727500 -- (-1548.967) (-1546.670) (-1552.485) [-1546.386] * [-1540.833] (-1543.735) (-1547.237) (-1546.635) -- 0:01:06
728000 -- (-1546.758) [-1544.281] (-1546.630) (-1549.715) * (-1547.145) (-1545.921) [-1543.909] (-1552.430) -- 0:01:06
728500 -- [-1549.846] (-1541.970) (-1545.539) (-1553.448) * (-1550.839) (-1551.739) (-1548.846) [-1545.519] -- 0:01:05
729000 -- (-1550.481) (-1543.548) (-1546.641) [-1549.279] * (-1547.674) (-1544.438) (-1550.100) [-1546.224] -- 0:01:05
729500 -- (-1555.113) (-1546.012) (-1552.945) [-1545.828] * (-1544.809) (-1549.673) (-1542.837) [-1542.088] -- 0:01:06
730000 -- (-1546.524) (-1547.447) (-1550.871) [-1542.853] * (-1547.625) (-1546.084) [-1546.606] (-1549.318) -- 0:01:05
Average standard deviation of split frequencies: 0.009678
730500 -- (-1543.784) (-1550.732) [-1547.377] (-1549.092) * (-1544.561) (-1548.067) (-1545.588) [-1546.199] -- 0:01:05
731000 -- (-1541.701) [-1545.075] (-1553.630) (-1547.727) * (-1547.619) (-1544.936) [-1545.583] (-1548.561) -- 0:01:05
731500 -- (-1548.642) [-1543.240] (-1558.712) (-1550.042) * [-1546.358] (-1547.964) (-1552.726) (-1551.536) -- 0:01:05
732000 -- [-1545.645] (-1550.245) (-1545.302) (-1545.210) * (-1545.502) [-1546.163] (-1546.671) (-1547.688) -- 0:01:05
732500 -- [-1543.743] (-1545.638) (-1543.802) (-1549.389) * [-1543.311] (-1545.079) (-1545.373) (-1543.781) -- 0:01:05
733000 -- (-1548.549) (-1547.262) [-1543.608] (-1555.123) * (-1548.681) [-1543.626] (-1550.189) (-1541.759) -- 0:01:04
733500 -- (-1547.670) [-1545.347] (-1549.454) (-1548.874) * (-1547.184) [-1551.471] (-1549.373) (-1545.430) -- 0:01:05
734000 -- [-1552.697] (-1542.358) (-1546.584) (-1545.962) * (-1549.433) (-1548.173) (-1548.805) [-1544.189] -- 0:01:04
734500 -- (-1548.743) (-1544.890) [-1547.329] (-1545.656) * (-1553.862) (-1547.345) [-1550.883] (-1542.373) -- 0:01:04
735000 -- (-1550.320) [-1547.233] (-1550.099) (-1549.301) * (-1549.657) (-1545.163) (-1544.755) [-1544.277] -- 0:01:04
Average standard deviation of split frequencies: 0.008967
735500 -- (-1544.507) (-1545.530) (-1552.292) [-1544.635] * (-1551.038) [-1543.756] (-1549.059) (-1547.232) -- 0:01:04
736000 -- (-1545.034) (-1543.881) (-1545.314) [-1548.935] * (-1545.799) [-1541.439] (-1548.395) (-1551.222) -- 0:01:04
736500 -- (-1551.001) (-1546.427) [-1546.539] (-1546.447) * [-1547.379] (-1551.566) (-1550.587) (-1549.971) -- 0:01:04
737000 -- (-1546.461) (-1554.929) [-1547.605] (-1544.299) * [-1547.129] (-1551.803) (-1557.495) (-1551.288) -- 0:01:03
737500 -- (-1548.120) (-1543.120) (-1552.327) [-1543.735] * (-1547.094) (-1549.447) [-1543.208] (-1548.442) -- 0:01:03
738000 -- [-1547.457] (-1544.353) (-1550.478) (-1547.790) * (-1546.177) (-1546.283) (-1541.106) [-1547.128] -- 0:01:03
738500 -- (-1543.011) [-1541.569] (-1548.132) (-1547.244) * [-1549.996] (-1547.909) (-1550.501) (-1546.617) -- 0:01:03
739000 -- [-1548.589] (-1547.697) (-1542.830) (-1544.853) * [-1540.259] (-1552.740) (-1554.395) (-1547.950) -- 0:01:03
739500 -- (-1553.322) (-1549.318) [-1544.372] (-1544.589) * (-1548.605) (-1548.873) (-1553.602) [-1542.239] -- 0:01:03
740000 -- (-1551.534) (-1545.788) (-1552.868) [-1544.154] * [-1544.558] (-1544.357) (-1547.540) (-1549.579) -- 0:01:03
Average standard deviation of split frequencies: 0.008486
740500 -- (-1553.899) [-1543.495] (-1548.631) (-1546.527) * (-1543.298) [-1549.375] (-1549.454) (-1550.608) -- 0:01:03
741000 -- (-1551.823) (-1545.326) (-1546.288) [-1545.164] * (-1547.215) (-1541.501) (-1550.558) [-1549.986] -- 0:01:03
741500 -- (-1549.484) (-1549.277) [-1545.801] (-1546.999) * [-1546.159] (-1551.949) (-1547.623) (-1543.643) -- 0:01:03
742000 -- [-1549.406] (-1550.647) (-1551.049) (-1556.986) * (-1545.874) (-1543.139) (-1552.134) [-1544.558] -- 0:01:02
742500 -- [-1547.127] (-1544.456) (-1554.146) (-1549.767) * [-1550.360] (-1545.450) (-1546.195) (-1539.894) -- 0:01:02
743000 -- (-1547.278) (-1544.440) (-1550.748) [-1551.807] * [-1546.672] (-1546.399) (-1546.796) (-1548.725) -- 0:01:02
743500 -- [-1542.119] (-1550.240) (-1554.355) (-1552.585) * (-1546.047) [-1546.458] (-1545.392) (-1556.836) -- 0:01:02
744000 -- (-1542.998) (-1553.030) [-1548.423] (-1546.395) * [-1550.567] (-1546.069) (-1547.120) (-1551.651) -- 0:01:02
744500 -- [-1546.328] (-1543.564) (-1551.499) (-1546.844) * (-1549.174) [-1543.987] (-1541.706) (-1546.573) -- 0:01:02
745000 -- (-1545.951) (-1550.136) [-1551.736] (-1550.426) * (-1542.811) (-1545.640) (-1545.212) [-1547.947] -- 0:01:02
Average standard deviation of split frequencies: 0.008847
745500 -- (-1551.068) (-1549.174) (-1553.926) [-1548.629] * (-1547.061) [-1544.478] (-1557.029) (-1544.639) -- 0:01:02
746000 -- [-1544.050] (-1546.343) (-1545.558) (-1549.368) * (-1550.612) (-1549.305) [-1546.155] (-1543.819) -- 0:01:01
746500 -- (-1553.782) [-1546.540] (-1551.982) (-1548.204) * (-1554.842) [-1556.573] (-1546.939) (-1548.423) -- 0:01:01
747000 -- (-1545.888) (-1542.130) [-1548.642] (-1547.247) * [-1545.895] (-1546.928) (-1551.551) (-1542.631) -- 0:01:01
747500 -- (-1549.227) (-1547.477) (-1552.283) [-1546.180] * (-1550.896) [-1543.483] (-1546.013) (-1547.965) -- 0:01:01
748000 -- (-1551.641) [-1549.550] (-1547.181) (-1544.726) * (-1546.265) [-1552.427] (-1548.918) (-1548.365) -- 0:01:01
748500 -- (-1547.136) (-1550.452) [-1544.844] (-1544.506) * [-1548.656] (-1558.218) (-1549.686) (-1550.075) -- 0:01:01
749000 -- (-1549.654) (-1548.036) [-1544.922] (-1543.588) * [-1545.730] (-1557.147) (-1550.806) (-1546.907) -- 0:01:01
749500 -- (-1549.454) (-1554.085) [-1545.719] (-1544.635) * (-1546.730) (-1555.571) [-1547.520] (-1546.128) -- 0:01:01
750000 -- (-1547.563) (-1548.658) [-1546.890] (-1545.633) * [-1551.669] (-1555.183) (-1547.775) (-1553.293) -- 0:01:01
Average standard deviation of split frequencies: 0.009210
750500 -- (-1546.125) [-1556.754] (-1553.762) (-1541.875) * [-1542.496] (-1545.447) (-1551.741) (-1548.961) -- 0:01:00
751000 -- [-1546.975] (-1549.257) (-1555.935) (-1541.824) * [-1548.011] (-1542.147) (-1547.642) (-1553.188) -- 0:01:00
751500 -- (-1545.967) [-1546.605] (-1548.183) (-1544.848) * (-1544.535) (-1546.534) [-1547.716] (-1545.850) -- 0:01:00
752000 -- (-1544.731) [-1547.830] (-1547.478) (-1547.313) * (-1541.441) (-1546.342) [-1544.679] (-1547.036) -- 0:01:00
752500 -- [-1549.710] (-1548.573) (-1544.058) (-1554.813) * (-1550.418) [-1547.270] (-1546.111) (-1544.519) -- 0:01:00
753000 -- (-1548.233) (-1545.876) [-1544.199] (-1551.263) * (-1545.762) [-1553.284] (-1551.205) (-1547.907) -- 0:01:00
753500 -- (-1551.235) (-1546.358) (-1548.532) [-1547.853] * (-1547.682) [-1543.659] (-1548.367) (-1546.027) -- 0:01:00
754000 -- (-1545.626) [-1545.124] (-1555.053) (-1551.153) * (-1543.491) (-1546.288) (-1544.002) [-1548.365] -- 0:01:00
754500 -- [-1545.785] (-1545.467) (-1551.317) (-1549.609) * (-1546.496) [-1551.067] (-1548.989) (-1551.219) -- 0:00:59
755000 -- (-1543.838) (-1544.433) [-1543.177] (-1545.202) * (-1543.762) [-1546.980] (-1544.142) (-1551.089) -- 0:00:59
Average standard deviation of split frequencies: 0.006859
755500 -- (-1543.809) (-1550.787) [-1544.535] (-1548.413) * [-1544.658] (-1547.525) (-1548.943) (-1548.499) -- 0:00:59
756000 -- (-1546.623) (-1550.085) [-1543.576] (-1547.528) * (-1545.765) (-1545.842) (-1552.170) [-1549.869] -- 0:00:59
756500 -- (-1546.274) (-1544.568) [-1544.832] (-1548.995) * (-1551.042) (-1550.903) [-1543.941] (-1547.581) -- 0:00:59
757000 -- [-1546.082] (-1545.897) (-1549.670) (-1542.475) * (-1546.826) (-1551.095) [-1543.975] (-1546.795) -- 0:00:59
757500 -- [-1547.181] (-1549.313) (-1550.963) (-1542.723) * (-1547.004) (-1548.639) [-1555.046] (-1546.700) -- 0:00:59
758000 -- [-1553.628] (-1549.031) (-1554.590) (-1547.415) * (-1543.370) (-1541.597) (-1546.160) [-1545.601] -- 0:00:59
758500 -- (-1544.898) (-1541.865) (-1550.478) [-1547.969] * (-1551.149) (-1548.033) [-1546.689] (-1550.609) -- 0:00:58
759000 -- (-1548.364) (-1544.124) (-1555.332) [-1549.631] * [-1549.610] (-1550.383) (-1548.678) (-1547.245) -- 0:00:58
759500 -- (-1546.776) (-1542.939) [-1542.934] (-1548.540) * (-1552.136) [-1554.856] (-1547.322) (-1553.522) -- 0:00:58
760000 -- (-1548.246) (-1549.101) [-1546.189] (-1550.154) * [-1545.929] (-1544.228) (-1549.430) (-1548.637) -- 0:00:58
Average standard deviation of split frequencies: 0.007437
760500 -- [-1546.125] (-1557.904) (-1552.020) (-1549.480) * [-1544.762] (-1544.036) (-1544.353) (-1549.411) -- 0:00:58
761000 -- (-1557.660) (-1547.339) [-1548.954] (-1546.925) * (-1553.177) (-1547.991) [-1544.226] (-1549.478) -- 0:00:58
761500 -- [-1543.839] (-1542.892) (-1545.599) (-1542.482) * (-1543.480) (-1546.843) (-1544.693) [-1546.726] -- 0:00:58
762000 -- (-1546.578) (-1547.140) [-1545.957] (-1548.724) * [-1556.181] (-1545.779) (-1545.715) (-1547.850) -- 0:00:58
762500 -- (-1547.503) [-1549.352] (-1546.734) (-1545.925) * (-1543.399) [-1546.615] (-1545.009) (-1545.283) -- 0:00:57
763000 -- (-1552.405) [-1548.996] (-1544.776) (-1549.772) * (-1547.796) (-1551.925) (-1550.072) [-1546.608] -- 0:00:57
763500 -- (-1542.925) (-1548.645) (-1546.370) [-1549.527] * (-1540.627) (-1547.605) [-1551.054] (-1550.317) -- 0:00:57
764000 -- [-1548.675] (-1551.545) (-1554.319) (-1548.348) * [-1542.953] (-1552.231) (-1551.327) (-1549.692) -- 0:00:57
764500 -- [-1546.759] (-1546.347) (-1547.527) (-1550.841) * (-1544.747) [-1546.748] (-1544.264) (-1543.214) -- 0:00:57
765000 -- (-1543.454) [-1547.113] (-1549.996) (-1546.873) * (-1548.928) [-1545.911] (-1549.792) (-1545.301) -- 0:00:57
Average standard deviation of split frequencies: 0.005334
765500 -- (-1544.273) (-1547.866) (-1546.439) [-1547.162] * (-1548.563) (-1552.688) (-1549.952) [-1545.318] -- 0:00:57
766000 -- [-1543.646] (-1556.302) (-1546.870) (-1548.499) * (-1553.050) (-1544.664) (-1548.421) [-1543.011] -- 0:00:57
766500 -- (-1545.825) (-1547.058) [-1547.197] (-1551.852) * (-1550.979) (-1549.441) [-1545.000] (-1542.211) -- 0:00:56
767000 -- [-1544.144] (-1546.507) (-1545.039) (-1543.414) * [-1543.036] (-1546.545) (-1547.201) (-1549.194) -- 0:00:56
767500 -- (-1543.700) [-1545.390] (-1539.835) (-1544.073) * [-1548.697] (-1545.369) (-1547.698) (-1550.437) -- 0:00:56
768000 -- [-1549.008] (-1551.989) (-1542.824) (-1543.419) * (-1548.375) [-1546.553] (-1546.558) (-1546.675) -- 0:00:56
768500 -- (-1557.852) (-1557.446) [-1542.261] (-1543.816) * (-1553.084) (-1545.123) [-1548.184] (-1548.596) -- 0:00:56
769000 -- (-1558.142) (-1544.108) [-1544.209] (-1541.442) * [-1545.179] (-1547.446) (-1543.187) (-1548.108) -- 0:00:56
769500 -- (-1548.338) (-1543.815) (-1544.910) [-1547.584] * (-1547.429) (-1548.402) (-1544.197) [-1545.142] -- 0:00:56
770000 -- (-1549.572) [-1547.707] (-1544.660) (-1551.958) * (-1545.980) [-1545.415] (-1552.035) (-1553.334) -- 0:00:56
Average standard deviation of split frequencies: 0.006932
770500 -- (-1545.977) (-1547.553) [-1545.113] (-1544.787) * [-1547.929] (-1550.003) (-1547.849) (-1543.823) -- 0:00:55
771000 -- (-1546.744) [-1543.768] (-1547.872) (-1551.214) * (-1544.343) (-1545.122) (-1547.114) [-1546.715] -- 0:00:55
771500 -- (-1549.173) (-1544.241) [-1545.198] (-1549.908) * (-1544.727) [-1542.408] (-1541.954) (-1547.175) -- 0:00:55
772000 -- [-1544.609] (-1549.489) (-1549.554) (-1545.826) * (-1559.431) (-1544.608) [-1545.798] (-1548.833) -- 0:00:55
772500 -- (-1543.513) [-1545.922] (-1550.304) (-1547.867) * (-1546.352) (-1547.936) [-1543.550] (-1546.443) -- 0:00:55
773000 -- (-1554.696) [-1544.308] (-1548.358) (-1549.416) * (-1544.184) (-1550.608) [-1544.502] (-1547.754) -- 0:00:55
773500 -- [-1545.036] (-1550.167) (-1544.801) (-1546.910) * (-1544.435) (-1549.456) (-1545.691) [-1543.841] -- 0:00:55
774000 -- (-1543.498) (-1553.352) (-1544.612) [-1546.926] * (-1544.519) (-1555.218) [-1546.717] (-1543.803) -- 0:00:55
774500 -- (-1544.666) (-1549.157) [-1545.492] (-1556.308) * (-1547.687) (-1550.239) (-1546.560) [-1544.939] -- 0:00:55
775000 -- (-1546.588) (-1548.087) [-1543.913] (-1544.819) * (-1547.774) [-1547.202] (-1545.573) (-1544.934) -- 0:00:54
Average standard deviation of split frequencies: 0.008100
775500 -- (-1546.035) (-1546.769) (-1545.547) [-1548.741] * (-1556.875) (-1547.623) [-1543.584] (-1547.612) -- 0:00:55
776000 -- (-1544.600) [-1544.469] (-1545.830) (-1546.732) * (-1543.479) (-1545.743) (-1545.135) [-1545.270] -- 0:00:54
776500 -- (-1547.128) [-1543.133] (-1551.663) (-1547.588) * [-1546.389] (-1549.021) (-1546.933) (-1547.871) -- 0:00:54
777000 -- (-1551.391) (-1545.800) [-1547.283] (-1549.699) * (-1546.731) [-1547.194] (-1545.227) (-1548.227) -- 0:00:54
777500 -- [-1547.024] (-1547.718) (-1556.453) (-1547.965) * [-1545.184] (-1543.948) (-1547.765) (-1551.850) -- 0:00:54
778000 -- (-1547.617) (-1552.377) (-1550.725) [-1544.199] * (-1550.162) [-1543.926] (-1546.340) (-1547.316) -- 0:00:54
778500 -- (-1547.571) [-1548.613] (-1552.653) (-1546.760) * (-1557.897) [-1544.117] (-1548.637) (-1548.055) -- 0:00:54
779000 -- [-1543.527] (-1546.502) (-1540.469) (-1543.676) * (-1549.108) [-1540.565] (-1545.571) (-1547.544) -- 0:00:54
779500 -- [-1543.445] (-1544.841) (-1546.976) (-1547.824) * (-1551.640) (-1544.085) [-1549.721] (-1545.611) -- 0:00:54
780000 -- (-1541.675) [-1546.679] (-1549.930) (-1549.414) * (-1556.315) [-1541.713] (-1549.017) (-1551.477) -- 0:00:53
Average standard deviation of split frequencies: 0.008454
780500 -- (-1550.411) (-1546.741) (-1551.562) [-1545.766] * [-1544.464] (-1548.229) (-1549.321) (-1549.916) -- 0:00:53
781000 -- [-1543.733] (-1557.087) (-1547.011) (-1547.041) * (-1550.944) (-1547.567) [-1545.579] (-1544.942) -- 0:00:53
781500 -- (-1544.225) (-1547.272) [-1541.893] (-1545.973) * (-1549.450) [-1551.885] (-1548.985) (-1545.673) -- 0:00:53
782000 -- (-1545.492) [-1545.586] (-1548.799) (-1545.370) * (-1546.699) (-1547.404) [-1543.451] (-1546.178) -- 0:00:53
782500 -- (-1548.651) [-1551.652] (-1550.674) (-1545.370) * (-1552.635) [-1547.034] (-1544.474) (-1544.952) -- 0:00:53
783000 -- (-1544.965) (-1548.521) (-1551.042) [-1554.379] * (-1552.029) (-1554.983) [-1545.260] (-1551.254) -- 0:00:53
783500 -- [-1554.112] (-1546.884) (-1552.758) (-1546.369) * [-1551.097] (-1546.807) (-1545.395) (-1545.051) -- 0:00:53
784000 -- [-1546.830] (-1555.683) (-1544.372) (-1550.001) * (-1551.160) (-1549.506) (-1540.964) [-1545.304] -- 0:00:52
784500 -- (-1548.873) (-1549.042) (-1551.183) [-1548.555] * (-1552.701) [-1546.877] (-1546.149) (-1549.008) -- 0:00:52
785000 -- (-1550.210) (-1549.945) (-1543.828) [-1552.188] * (-1545.489) [-1543.231] (-1554.132) (-1547.139) -- 0:00:52
Average standard deviation of split frequencies: 0.006797
785500 -- (-1548.948) [-1547.547] (-1546.625) (-1547.398) * (-1548.424) [-1542.377] (-1546.643) (-1545.161) -- 0:00:52
786000 -- [-1543.183] (-1552.869) (-1552.046) (-1546.279) * (-1545.859) (-1547.426) [-1545.612] (-1551.796) -- 0:00:52
786500 -- (-1548.954) (-1548.321) [-1561.187] (-1555.606) * (-1550.028) (-1549.631) [-1545.636] (-1544.641) -- 0:00:52
787000 -- (-1548.823) [-1541.896] (-1544.732) (-1542.638) * (-1544.383) (-1553.946) (-1547.955) [-1542.520] -- 0:00:52
787500 -- (-1547.401) (-1545.727) (-1548.874) [-1544.625] * (-1545.469) (-1553.735) (-1544.845) [-1551.350] -- 0:00:52
788000 -- (-1547.102) (-1550.593) [-1543.048] (-1548.736) * (-1552.682) [-1547.246] (-1549.204) (-1543.153) -- 0:00:51
788500 -- (-1542.696) [-1550.354] (-1549.947) (-1549.950) * [-1544.392] (-1546.884) (-1552.607) (-1542.902) -- 0:00:51
789000 -- (-1548.646) (-1550.575) [-1542.546] (-1545.556) * (-1555.439) [-1543.460] (-1549.805) (-1542.562) -- 0:00:51
789500 -- (-1543.827) (-1545.508) (-1553.009) [-1545.999] * (-1548.448) (-1550.781) [-1545.950] (-1542.847) -- 0:00:51
790000 -- [-1550.445] (-1548.450) (-1544.174) (-1545.310) * [-1544.533] (-1547.866) (-1545.848) (-1547.502) -- 0:00:51
Average standard deviation of split frequencies: 0.006558
790500 -- [-1543.192] (-1545.451) (-1544.296) (-1542.643) * (-1553.297) (-1552.104) [-1546.233] (-1555.934) -- 0:00:51
791000 -- (-1549.759) (-1547.426) (-1555.603) [-1543.671] * (-1550.232) (-1548.968) [-1543.590] (-1551.030) -- 0:00:51
791500 -- [-1541.551] (-1549.026) (-1543.958) (-1549.980) * (-1548.523) [-1546.500] (-1551.802) (-1551.928) -- 0:00:51
792000 -- [-1546.038] (-1544.661) (-1550.803) (-1550.376) * (-1547.399) [-1545.254] (-1550.198) (-1548.091) -- 0:00:50
792500 -- (-1549.933) [-1545.449] (-1544.391) (-1547.041) * (-1551.109) (-1549.483) [-1547.166] (-1548.280) -- 0:00:50
793000 -- (-1544.578) (-1545.552) [-1545.401] (-1544.791) * (-1545.909) (-1545.572) (-1546.387) [-1551.046] -- 0:00:50
793500 -- (-1547.671) [-1548.109] (-1553.702) (-1547.961) * (-1545.222) [-1547.015] (-1553.251) (-1546.352) -- 0:00:50
794000 -- [-1544.531] (-1546.687) (-1545.092) (-1547.749) * [-1548.763] (-1551.136) (-1544.645) (-1552.909) -- 0:00:50
794500 -- (-1545.418) (-1546.219) (-1546.551) [-1549.933] * [-1542.677] (-1544.679) (-1547.678) (-1546.881) -- 0:00:50
795000 -- (-1549.270) [-1545.284] (-1543.072) (-1550.558) * [-1542.731] (-1542.495) (-1550.442) (-1544.968) -- 0:00:50
Average standard deviation of split frequencies: 0.007304
795500 -- (-1553.470) [-1548.691] (-1550.612) (-1545.608) * [-1547.429] (-1542.890) (-1546.468) (-1552.105) -- 0:00:50
796000 -- (-1550.278) (-1547.558) [-1552.770] (-1547.650) * [-1544.516] (-1546.210) (-1547.876) (-1553.310) -- 0:00:49
796500 -- (-1549.741) (-1545.015) [-1544.399] (-1552.913) * [-1547.767] (-1544.276) (-1546.776) (-1544.673) -- 0:00:49
797000 -- (-1554.358) (-1550.165) (-1551.944) [-1549.651] * (-1550.151) [-1545.719] (-1540.789) (-1546.825) -- 0:00:49
797500 -- (-1545.811) (-1544.808) [-1548.086] (-1545.054) * (-1548.249) [-1546.044] (-1549.994) (-1541.976) -- 0:00:49
798000 -- (-1542.967) [-1541.584] (-1548.034) (-1554.060) * (-1545.083) (-1543.040) (-1547.023) [-1541.365] -- 0:00:49
798500 -- (-1543.445) (-1546.938) (-1550.435) [-1553.080] * (-1548.729) (-1543.624) [-1545.794] (-1554.725) -- 0:00:49
799000 -- [-1544.008] (-1552.732) (-1543.636) (-1557.391) * (-1550.923) (-1550.861) [-1544.836] (-1542.154) -- 0:00:49
799500 -- (-1545.780) (-1548.461) (-1546.209) [-1545.764] * (-1552.312) (-1543.760) [-1544.161] (-1548.511) -- 0:00:49
800000 -- (-1545.257) [-1546.887] (-1547.879) (-1551.565) * (-1543.627) (-1545.028) [-1543.110] (-1548.014) -- 0:00:49
Average standard deviation of split frequencies: 0.008243
800500 -- [-1544.957] (-1549.017) (-1551.174) (-1547.511) * (-1547.830) (-1547.875) (-1551.083) [-1544.283] -- 0:00:49
801000 -- (-1547.153) (-1547.788) (-1548.342) [-1546.339] * (-1548.201) (-1552.767) [-1544.519] (-1543.064) -- 0:00:49
801500 -- (-1549.869) (-1546.550) [-1548.880] (-1546.325) * (-1546.739) (-1542.460) [-1544.545] (-1542.094) -- 0:00:49
802000 -- [-1545.509] (-1545.638) (-1547.148) (-1547.469) * (-1545.104) (-1549.870) [-1542.504] (-1548.964) -- 0:00:48
802500 -- [-1543.001] (-1543.661) (-1541.038) (-1550.456) * (-1543.201) [-1548.850] (-1545.529) (-1546.434) -- 0:00:48
803000 -- (-1551.571) (-1545.369) (-1546.101) [-1549.060] * [-1544.985] (-1548.589) (-1546.816) (-1547.340) -- 0:00:48
803500 -- (-1546.316) (-1548.320) [-1543.952] (-1547.632) * (-1543.040) (-1544.222) (-1547.419) [-1542.639] -- 0:00:48
804000 -- (-1543.252) (-1545.772) [-1542.023] (-1550.556) * [-1544.534] (-1546.550) (-1545.061) (-1544.592) -- 0:00:48
804500 -- (-1547.483) (-1545.739) [-1550.189] (-1560.689) * [-1546.641] (-1549.315) (-1547.288) (-1546.678) -- 0:00:48
805000 -- [-1543.684] (-1550.745) (-1547.158) (-1551.430) * [-1544.773] (-1546.996) (-1554.060) (-1547.855) -- 0:00:48
Average standard deviation of split frequencies: 0.008578
805500 -- (-1544.412) (-1548.365) (-1551.388) [-1547.168] * (-1549.516) [-1546.004] (-1556.393) (-1544.527) -- 0:00:48
806000 -- [-1545.778] (-1548.288) (-1544.514) (-1546.362) * (-1550.184) [-1541.251] (-1550.827) (-1545.057) -- 0:00:48
806500 -- [-1549.946] (-1550.188) (-1545.981) (-1550.718) * (-1545.832) (-1545.063) [-1545.719] (-1544.152) -- 0:00:48
807000 -- (-1544.137) (-1545.489) [-1546.574] (-1544.766) * (-1544.797) (-1545.437) [-1543.448] (-1544.177) -- 0:00:48
807500 -- (-1546.693) (-1545.959) (-1548.666) [-1548.344] * (-1552.174) [-1544.404] (-1545.839) (-1547.430) -- 0:00:48
808000 -- (-1549.262) [-1550.898] (-1549.507) (-1549.739) * [-1549.048] (-1549.347) (-1554.845) (-1542.584) -- 0:00:48
808500 -- (-1547.370) (-1547.356) [-1544.822] (-1546.815) * (-1546.222) (-1548.071) (-1547.869) [-1544.812] -- 0:00:48
809000 -- (-1547.579) [-1541.711] (-1551.089) (-1547.601) * (-1546.352) (-1550.365) [-1542.828] (-1546.589) -- 0:00:48
809500 -- (-1552.011) (-1541.580) (-1547.442) [-1546.204] * (-1544.656) [-1550.392] (-1549.586) (-1551.763) -- 0:00:48
810000 -- (-1552.885) (-1549.158) (-1544.943) [-1544.346] * [-1544.013] (-1544.247) (-1547.522) (-1548.681) -- 0:00:48
Average standard deviation of split frequencies: 0.008916
810500 -- (-1549.175) [-1543.973] (-1551.500) (-1545.985) * (-1549.045) (-1553.060) [-1541.294] (-1544.666) -- 0:00:48
811000 -- (-1546.878) [-1545.196] (-1550.095) (-1542.896) * (-1546.589) (-1549.038) (-1545.721) [-1548.577] -- 0:00:48
811500 -- (-1552.219) [-1545.123] (-1553.636) (-1542.829) * [-1542.439] (-1546.569) (-1544.398) (-1543.179) -- 0:00:48
812000 -- (-1543.474) (-1543.930) (-1557.916) [-1546.380] * [-1546.800] (-1549.381) (-1551.805) (-1546.030) -- 0:00:48
812500 -- (-1546.273) (-1550.028) (-1555.738) [-1544.469] * (-1544.503) (-1551.841) [-1542.505] (-1547.233) -- 0:00:48
813000 -- [-1546.423] (-1544.878) (-1551.586) (-1546.905) * (-1545.875) (-1550.326) (-1556.024) [-1545.070] -- 0:00:48
813500 -- [-1543.120] (-1544.155) (-1553.054) (-1550.647) * (-1545.188) [-1545.556] (-1550.078) (-1544.568) -- 0:00:48
814000 -- (-1546.646) (-1543.517) (-1548.135) [-1547.656] * (-1548.519) (-1546.976) (-1549.092) [-1545.903] -- 0:00:47
814500 -- [-1546.405] (-1545.263) (-1543.694) (-1548.558) * [-1547.064] (-1549.562) (-1555.391) (-1551.714) -- 0:00:47
815000 -- (-1544.697) [-1549.266] (-1546.671) (-1546.561) * (-1554.973) [-1546.668] (-1544.733) (-1547.687) -- 0:00:47
Average standard deviation of split frequencies: 0.009628
815500 -- (-1550.145) (-1545.035) [-1546.435] (-1543.804) * (-1543.340) (-1555.539) [-1546.259] (-1548.773) -- 0:00:48
816000 -- (-1550.863) (-1542.207) [-1543.901] (-1547.263) * (-1548.333) (-1553.044) (-1543.323) [-1543.246] -- 0:00:48
816500 -- (-1551.468) (-1545.892) (-1551.952) [-1546.460] * (-1546.408) (-1540.825) [-1542.293] (-1547.608) -- 0:00:48
817000 -- (-1549.023) (-1543.206) (-1550.067) [-1542.097] * (-1545.707) [-1547.411] (-1548.974) (-1548.637) -- 0:00:48
817500 -- (-1552.109) (-1545.620) (-1545.605) [-1542.799] * [-1543.549] (-1542.222) (-1547.936) (-1542.861) -- 0:00:47
818000 -- (-1546.256) (-1544.654) [-1547.047] (-1547.918) * (-1558.515) (-1549.722) (-1546.545) [-1541.572] -- 0:00:47
818500 -- (-1548.901) [-1545.383] (-1544.376) (-1556.982) * [-1546.281] (-1545.947) (-1543.972) (-1547.705) -- 0:00:47
819000 -- (-1547.890) (-1547.304) (-1550.784) [-1545.597] * (-1556.929) (-1547.528) (-1549.581) [-1542.223] -- 0:00:47
819500 -- (-1547.211) (-1543.229) [-1543.720] (-1546.497) * [-1549.058] (-1547.773) (-1543.104) (-1546.319) -- 0:00:47
820000 -- [-1549.495] (-1545.517) (-1550.371) (-1547.134) * (-1549.683) (-1549.013) (-1545.320) [-1549.676] -- 0:00:47
Average standard deviation of split frequencies: 0.010339
820500 -- (-1552.455) (-1549.012) (-1547.343) [-1544.787] * [-1546.219] (-1547.818) (-1553.047) (-1547.529) -- 0:00:47
821000 -- (-1553.241) [-1546.917] (-1544.586) (-1545.153) * [-1547.881] (-1544.478) (-1546.113) (-1549.367) -- 0:00:47
821500 -- (-1550.820) (-1545.118) (-1545.522) [-1544.511] * (-1545.048) (-1550.999) (-1549.719) [-1545.967] -- 0:00:47
822000 -- [-1547.814] (-1548.089) (-1550.015) (-1545.145) * (-1556.904) (-1551.681) [-1547.579] (-1548.654) -- 0:00:47
822500 -- (-1549.619) [-1547.053] (-1548.130) (-1549.449) * (-1550.443) (-1546.315) (-1545.757) [-1548.007] -- 0:00:47
823000 -- (-1547.456) (-1545.568) [-1547.898] (-1553.324) * [-1545.689] (-1550.347) (-1546.520) (-1548.750) -- 0:00:47
823500 -- [-1542.169] (-1546.954) (-1551.385) (-1554.209) * (-1546.431) (-1548.500) (-1552.289) [-1544.312] -- 0:00:47
824000 -- (-1546.411) [-1545.032] (-1553.957) (-1547.986) * (-1550.822) (-1543.759) (-1547.114) [-1548.068] -- 0:00:46
824500 -- (-1552.482) (-1542.957) [-1546.608] (-1548.927) * (-1553.674) (-1541.820) [-1550.987] (-1547.372) -- 0:00:47
825000 -- (-1550.357) (-1545.185) [-1545.320] (-1550.641) * (-1555.132) (-1551.945) [-1547.030] (-1544.836) -- 0:00:46
Average standard deviation of split frequencies: 0.010273
825500 -- (-1549.798) (-1542.819) (-1545.440) [-1545.927] * (-1545.323) [-1543.829] (-1543.132) (-1551.193) -- 0:00:46
826000 -- (-1550.723) [-1542.502] (-1543.578) (-1554.026) * (-1544.102) (-1542.188) (-1546.522) [-1547.526] -- 0:00:46
826500 -- (-1550.045) [-1546.410] (-1545.590) (-1551.318) * (-1548.399) (-1542.709) (-1551.115) [-1549.844] -- 0:00:46
827000 -- (-1548.332) (-1543.279) (-1547.548) [-1549.073] * (-1549.888) (-1546.656) [-1550.858] (-1546.576) -- 0:00:46
827500 -- (-1545.895) (-1548.345) (-1544.931) [-1553.218] * (-1547.525) (-1554.538) [-1544.457] (-1549.503) -- 0:00:46
828000 -- (-1547.422) (-1546.888) [-1547.392] (-1552.538) * (-1543.540) (-1547.346) (-1548.148) [-1542.673] -- 0:00:46
828500 -- (-1545.831) (-1548.185) (-1541.598) [-1547.140] * (-1545.280) (-1548.917) (-1549.385) [-1546.928] -- 0:00:46
829000 -- (-1546.648) (-1547.184) (-1549.227) [-1546.793] * (-1546.731) [-1543.022] (-1550.832) (-1555.361) -- 0:00:46
829500 -- (-1542.318) (-1550.068) [-1544.942] (-1546.476) * (-1545.874) (-1551.451) (-1549.265) [-1548.955] -- 0:00:46
830000 -- (-1545.616) (-1549.932) [-1542.428] (-1552.168) * (-1547.248) (-1557.332) [-1542.642] (-1549.241) -- 0:00:46
Average standard deviation of split frequencies: 0.010026
830500 -- [-1543.342] (-1552.290) (-1547.385) (-1542.823) * [-1553.904] (-1550.606) (-1543.773) (-1550.377) -- 0:00:45
831000 -- [-1541.043] (-1553.799) (-1553.252) (-1546.636) * (-1544.697) (-1554.234) (-1552.837) [-1548.324] -- 0:00:45
831500 -- (-1544.712) (-1557.181) (-1549.128) [-1544.087] * (-1549.213) (-1554.023) [-1544.505] (-1551.726) -- 0:00:45
832000 -- (-1551.093) [-1545.999] (-1549.493) (-1543.904) * (-1548.440) [-1552.806] (-1546.477) (-1541.982) -- 0:00:45
832500 -- (-1550.142) (-1552.655) [-1550.618] (-1548.914) * (-1548.293) (-1547.193) [-1549.328] (-1545.649) -- 0:00:45
833000 -- [-1542.243] (-1552.448) (-1545.231) (-1543.440) * (-1552.275) [-1543.916] (-1550.568) (-1549.168) -- 0:00:45
833500 -- [-1544.680] (-1549.746) (-1547.106) (-1544.829) * (-1549.703) (-1544.425) (-1545.802) [-1546.127] -- 0:00:45
834000 -- [-1543.319] (-1548.578) (-1548.369) (-1546.773) * [-1546.505] (-1549.129) (-1546.134) (-1544.603) -- 0:00:45
834500 -- [-1544.493] (-1550.506) (-1549.121) (-1548.764) * [-1543.498] (-1547.831) (-1548.224) (-1544.863) -- 0:00:45
835000 -- (-1542.326) (-1553.148) [-1548.754] (-1549.998) * (-1548.939) (-1549.679) [-1549.155] (-1554.832) -- 0:00:45
Average standard deviation of split frequencies: 0.009398
835500 -- [-1545.298] (-1546.817) (-1547.278) (-1550.799) * (-1547.830) (-1556.271) [-1549.230] (-1548.732) -- 0:00:45
836000 -- [-1545.385] (-1545.430) (-1547.416) (-1554.385) * (-1550.109) (-1550.399) (-1554.647) [-1543.201] -- 0:00:44
836500 -- (-1549.100) (-1544.253) (-1554.448) [-1546.068] * (-1545.132) [-1542.922] (-1545.750) (-1551.149) -- 0:00:44
837000 -- (-1544.929) (-1547.230) [-1552.956] (-1550.115) * (-1544.644) (-1543.486) [-1546.290] (-1547.572) -- 0:00:44
837500 -- [-1542.943] (-1547.426) (-1550.454) (-1545.774) * (-1548.143) (-1547.174) [-1546.076] (-1543.960) -- 0:00:44
838000 -- [-1546.915] (-1543.018) (-1543.165) (-1547.203) * (-1548.821) (-1551.769) (-1545.702) [-1546.702] -- 0:00:44
838500 -- (-1551.168) [-1542.244] (-1552.903) (-1543.592) * (-1554.625) (-1550.091) [-1553.611] (-1547.075) -- 0:00:44
839000 -- (-1550.090) (-1548.541) [-1547.402] (-1543.956) * (-1545.916) [-1544.177] (-1545.380) (-1549.467) -- 0:00:44
839500 -- (-1547.977) (-1545.893) (-1543.683) [-1544.077] * (-1550.316) [-1554.536] (-1550.474) (-1552.649) -- 0:00:44
840000 -- (-1543.046) (-1546.993) [-1545.877] (-1545.183) * [-1552.219] (-1548.265) (-1556.203) (-1557.160) -- 0:00:44
Average standard deviation of split frequencies: 0.009159
840500 -- (-1548.018) (-1543.116) [-1544.680] (-1545.251) * (-1547.699) [-1547.224] (-1553.545) (-1551.990) -- 0:00:44
841000 -- (-1547.789) [-1550.581] (-1544.350) (-1547.024) * [-1544.941] (-1553.901) (-1559.924) (-1549.690) -- 0:00:44
841500 -- (-1542.589) (-1558.414) (-1542.863) [-1545.313] * [-1545.178] (-1552.313) (-1549.288) (-1553.791) -- 0:00:43
842000 -- (-1549.050) (-1546.414) [-1544.411] (-1552.209) * [-1542.202] (-1545.385) (-1548.683) (-1552.626) -- 0:00:43
842500 -- (-1547.462) (-1548.717) (-1546.410) [-1553.257] * (-1545.397) [-1545.286] (-1543.556) (-1554.290) -- 0:00:43
843000 -- (-1547.301) (-1543.279) (-1551.439) [-1541.992] * [-1546.583] (-1548.393) (-1546.213) (-1550.323) -- 0:00:43
843500 -- [-1545.778] (-1548.072) (-1549.930) (-1543.747) * (-1542.071) (-1546.819) [-1548.340] (-1552.278) -- 0:00:43
844000 -- [-1546.493] (-1545.806) (-1545.793) (-1548.014) * [-1544.236] (-1548.357) (-1546.485) (-1547.955) -- 0:00:43
844500 -- (-1550.070) [-1548.152] (-1547.074) (-1547.768) * (-1545.816) [-1546.105] (-1553.569) (-1551.190) -- 0:00:43
845000 -- (-1544.237) [-1542.776] (-1552.236) (-1544.706) * (-1547.038) (-1545.881) [-1542.355] (-1549.293) -- 0:00:43
Average standard deviation of split frequencies: 0.008915
845500 -- (-1543.453) (-1543.353) [-1546.089] (-1547.804) * (-1549.025) (-1543.865) (-1546.265) [-1548.873] -- 0:00:42
846000 -- [-1546.875] (-1548.341) (-1553.269) (-1554.367) * [-1545.418] (-1549.272) (-1550.734) (-1545.172) -- 0:00:42
846500 -- (-1545.605) (-1549.785) (-1549.452) [-1546.500] * [-1546.200] (-1549.287) (-1548.370) (-1554.039) -- 0:00:42
847000 -- (-1548.049) (-1550.274) [-1543.577] (-1545.164) * [-1546.479] (-1554.291) (-1546.602) (-1548.631) -- 0:00:42
847500 -- (-1544.952) (-1546.936) (-1545.669) [-1548.071] * (-1555.779) (-1555.182) [-1545.844] (-1552.400) -- 0:00:42
848000 -- (-1543.611) (-1548.001) [-1545.778] (-1549.455) * (-1546.369) (-1554.368) [-1551.924] (-1546.101) -- 0:00:42
848500 -- [-1542.042] (-1550.129) (-1546.811) (-1546.469) * (-1544.394) (-1548.687) (-1548.769) [-1546.047] -- 0:00:42
849000 -- (-1541.185) (-1550.646) (-1556.129) [-1549.901] * (-1551.673) (-1545.146) (-1547.127) [-1549.556] -- 0:00:42
849500 -- (-1544.461) (-1546.815) (-1553.258) [-1546.952] * [-1543.514] (-1548.253) (-1546.917) (-1548.138) -- 0:00:42
850000 -- (-1546.814) [-1544.624] (-1548.715) (-1542.234) * (-1544.174) [-1544.195] (-1545.000) (-1557.578) -- 0:00:41
Average standard deviation of split frequencies: 0.009051
850500 -- (-1543.717) [-1542.945] (-1550.613) (-1552.508) * (-1543.508) (-1548.427) (-1545.537) [-1543.534] -- 0:00:42
851000 -- (-1542.728) (-1544.986) (-1551.174) [-1549.429] * (-1545.275) (-1547.179) [-1545.947] (-1545.774) -- 0:00:42
851500 -- (-1546.723) [-1555.853] (-1550.878) (-1543.803) * [-1544.317] (-1548.847) (-1544.574) (-1545.821) -- 0:00:42
852000 -- [-1542.920] (-1552.891) (-1550.963) (-1546.922) * (-1544.355) (-1547.745) [-1547.939] (-1553.082) -- 0:00:41
852500 -- (-1545.162) (-1544.483) (-1559.525) [-1545.042] * [-1548.038] (-1547.872) (-1546.496) (-1546.664) -- 0:00:41
853000 -- (-1551.055) [-1544.539] (-1548.875) (-1549.065) * (-1547.820) [-1543.474] (-1546.707) (-1542.900) -- 0:00:41
853500 -- [-1542.636] (-1547.917) (-1541.963) (-1544.987) * (-1553.585) [-1542.641] (-1547.963) (-1546.251) -- 0:00:41
854000 -- [-1545.553] (-1551.043) (-1548.124) (-1553.462) * (-1544.265) [-1542.045] (-1542.207) (-1548.880) -- 0:00:41
854500 -- (-1550.806) (-1545.748) [-1543.601] (-1547.807) * (-1546.925) (-1546.983) [-1542.628] (-1550.180) -- 0:00:41
855000 -- [-1551.109] (-1546.525) (-1552.524) (-1543.542) * (-1548.484) (-1543.247) [-1548.055] (-1544.464) -- 0:00:41
Average standard deviation of split frequencies: 0.008628
855500 -- (-1550.878) (-1543.350) [-1553.849] (-1547.545) * (-1551.616) [-1547.643] (-1544.960) (-1549.039) -- 0:00:41
856000 -- [-1548.260] (-1545.284) (-1555.797) (-1549.535) * [-1541.020] (-1547.979) (-1547.739) (-1544.317) -- 0:00:41
856500 -- (-1545.954) [-1543.366] (-1547.393) (-1549.693) * (-1552.655) (-1544.239) (-1546.151) [-1544.814] -- 0:00:41
857000 -- (-1544.788) (-1543.911) [-1545.713] (-1542.329) * (-1552.656) (-1545.979) [-1547.238] (-1559.104) -- 0:00:41
857500 -- (-1562.958) (-1542.018) [-1544.802] (-1544.081) * (-1547.501) (-1548.250) [-1545.132] (-1552.228) -- 0:00:40
858000 -- (-1548.612) [-1545.546] (-1548.350) (-1545.930) * (-1548.256) (-1543.353) (-1549.196) [-1544.925] -- 0:00:40
858500 -- (-1547.896) (-1550.425) (-1543.454) [-1540.933] * (-1546.847) (-1546.394) (-1552.993) [-1546.122] -- 0:00:40
859000 -- (-1550.401) [-1542.009] (-1546.328) (-1553.822) * (-1548.483) [-1540.229] (-1550.924) (-1548.949) -- 0:00:40
859500 -- (-1544.494) (-1549.211) (-1548.895) [-1547.498] * (-1543.477) (-1551.096) (-1553.930) [-1552.556] -- 0:00:40
860000 -- (-1548.568) (-1546.772) (-1542.795) [-1544.908] * (-1542.701) (-1547.064) (-1549.083) [-1544.779] -- 0:00:40
Average standard deviation of split frequencies: 0.007486
860500 -- [-1547.003] (-1543.343) (-1543.671) (-1543.405) * (-1544.451) (-1549.220) (-1546.839) [-1546.341] -- 0:00:40
861000 -- (-1550.401) [-1544.153] (-1546.230) (-1546.109) * [-1544.695] (-1549.384) (-1547.446) (-1544.547) -- 0:00:40
861500 -- (-1554.221) (-1545.557) [-1544.933] (-1552.473) * [-1549.996] (-1548.517) (-1547.470) (-1544.859) -- 0:00:40
862000 -- (-1545.393) (-1545.665) [-1545.232] (-1548.819) * [-1547.418] (-1543.802) (-1541.245) (-1544.462) -- 0:00:40
862500 -- [-1545.668] (-1549.130) (-1546.954) (-1547.681) * [-1548.559] (-1545.771) (-1546.875) (-1546.489) -- 0:00:40
863000 -- (-1547.543) (-1547.771) (-1547.660) [-1547.168] * (-1549.906) [-1546.290] (-1548.640) (-1542.115) -- 0:00:40
863500 -- [-1545.755] (-1547.301) (-1548.562) (-1548.098) * (-1554.939) (-1547.169) (-1546.976) [-1547.351] -- 0:00:40
864000 -- [-1546.255] (-1547.476) (-1543.194) (-1544.175) * (-1550.008) [-1545.955] (-1547.993) (-1545.284) -- 0:00:40
864500 -- (-1546.700) (-1544.420) [-1543.452] (-1544.516) * (-1555.413) (-1543.552) [-1543.938] (-1558.221) -- 0:00:40
865000 -- (-1544.304) [-1550.754] (-1545.367) (-1546.294) * (-1548.571) [-1543.078] (-1544.922) (-1551.864) -- 0:00:39
Average standard deviation of split frequencies: 0.007621
865500 -- (-1548.259) (-1549.056) (-1543.717) [-1544.403] * (-1551.329) (-1547.138) (-1547.926) [-1543.901] -- 0:00:40
866000 -- (-1543.221) (-1552.057) (-1543.406) [-1546.393] * (-1543.649) (-1548.163) (-1551.096) [-1545.421] -- 0:00:39
866500 -- (-1547.709) [-1544.176] (-1542.751) (-1551.403) * (-1544.579) [-1541.642] (-1552.934) (-1552.056) -- 0:00:39
867000 -- (-1545.841) (-1551.513) (-1548.794) [-1546.309] * (-1545.338) (-1542.229) (-1548.432) [-1549.076] -- 0:00:39
867500 -- [-1546.365] (-1545.376) (-1550.793) (-1544.774) * (-1545.660) [-1551.166] (-1552.777) (-1550.240) -- 0:00:39
868000 -- (-1547.567) (-1549.166) (-1547.330) [-1550.451] * (-1540.343) (-1547.707) (-1553.719) [-1548.377] -- 0:00:39
868500 -- (-1547.710) [-1546.493] (-1547.472) (-1549.804) * (-1543.269) [-1546.871] (-1549.299) (-1556.190) -- 0:00:39
869000 -- [-1546.948] (-1541.504) (-1547.285) (-1547.701) * (-1547.233) (-1545.399) [-1550.217] (-1553.341) -- 0:00:39
869500 -- [-1541.916] (-1543.340) (-1544.854) (-1547.349) * (-1554.324) [-1543.949] (-1550.203) (-1548.224) -- 0:00:39
870000 -- (-1550.154) (-1545.333) [-1553.296] (-1545.657) * (-1552.156) (-1548.248) [-1547.045] (-1548.571) -- 0:00:39
Average standard deviation of split frequencies: 0.006136
870500 -- (-1546.616) (-1546.152) [-1544.352] (-1550.058) * [-1544.798] (-1548.257) (-1548.702) (-1546.802) -- 0:00:39
871000 -- (-1546.923) (-1546.274) [-1553.458] (-1543.040) * (-1543.369) (-1550.269) (-1555.143) [-1549.319] -- 0:00:39
871500 -- (-1551.620) (-1545.956) (-1546.470) [-1544.322] * (-1546.779) (-1550.727) (-1552.523) [-1549.163] -- 0:00:38
872000 -- (-1548.328) (-1542.808) (-1544.897) [-1549.058] * (-1543.014) [-1552.292] (-1548.139) (-1548.781) -- 0:00:38
872500 -- (-1552.203) [-1547.373] (-1545.948) (-1544.122) * (-1547.461) [-1545.336] (-1544.298) (-1549.162) -- 0:00:38
873000 -- (-1551.251) [-1548.855] (-1543.741) (-1548.080) * (-1548.933) [-1552.433] (-1552.196) (-1544.130) -- 0:00:38
873500 -- [-1548.890] (-1548.715) (-1551.747) (-1542.894) * (-1547.318) [-1548.305] (-1553.900) (-1549.279) -- 0:00:38
874000 -- (-1559.744) (-1542.778) [-1546.737] (-1548.314) * [-1544.063] (-1549.254) (-1545.817) (-1546.020) -- 0:00:38
874500 -- (-1549.053) (-1544.160) (-1551.891) [-1547.820] * [-1547.445] (-1552.579) (-1545.972) (-1548.547) -- 0:00:38
875000 -- (-1551.779) [-1542.664] (-1544.320) (-1542.443) * (-1545.022) (-1551.898) (-1550.276) [-1541.559] -- 0:00:38
Average standard deviation of split frequencies: 0.006458
875500 -- [-1551.705] (-1543.899) (-1541.990) (-1542.883) * [-1545.367] (-1547.979) (-1547.890) (-1544.980) -- 0:00:38
876000 -- [-1547.090] (-1548.274) (-1548.180) (-1547.279) * (-1547.525) [-1544.393] (-1542.703) (-1549.187) -- 0:00:38
876500 -- [-1546.673] (-1553.323) (-1548.744) (-1548.863) * [-1548.272] (-1551.304) (-1547.390) (-1555.237) -- 0:00:37
877000 -- [-1543.837] (-1544.692) (-1549.679) (-1544.378) * (-1544.282) (-1555.866) [-1549.235] (-1547.207) -- 0:00:37
877500 -- [-1546.735] (-1544.312) (-1550.126) (-1540.811) * (-1546.691) (-1545.687) [-1547.052] (-1551.980) -- 0:00:37
878000 -- [-1551.002] (-1546.416) (-1549.381) (-1555.573) * (-1553.881) (-1549.844) (-1545.653) [-1543.825] -- 0:00:37
878500 -- (-1550.938) [-1541.727] (-1549.046) (-1544.079) * (-1553.953) (-1547.671) [-1550.103] (-1549.935) -- 0:00:37
879000 -- (-1545.063) [-1546.362] (-1560.712) (-1547.967) * [-1546.626] (-1550.964) (-1546.626) (-1547.942) -- 0:00:37
879500 -- [-1545.349] (-1545.358) (-1551.409) (-1548.649) * [-1548.048] (-1545.718) (-1547.930) (-1546.850) -- 0:00:36
880000 -- (-1546.829) (-1546.596) (-1557.414) [-1549.715] * [-1549.763] (-1543.877) (-1549.360) (-1550.479) -- 0:00:36
Average standard deviation of split frequencies: 0.005531
880500 -- (-1548.285) [-1549.559] (-1552.282) (-1543.588) * (-1551.603) [-1543.861] (-1545.268) (-1558.661) -- 0:00:36
881000 -- (-1549.117) (-1548.998) [-1548.582] (-1546.717) * (-1542.448) [-1544.791] (-1543.419) (-1551.713) -- 0:00:36
881500 -- [-1546.697] (-1551.274) (-1545.521) (-1546.708) * (-1546.743) (-1553.071) (-1548.891) [-1548.430] -- 0:00:36
882000 -- (-1541.935) (-1549.429) (-1547.511) [-1545.069] * [-1545.740] (-1546.624) (-1548.060) (-1549.481) -- 0:00:36
882500 -- [-1545.293] (-1546.709) (-1548.115) (-1546.370) * (-1542.132) (-1546.613) (-1544.365) [-1548.839] -- 0:00:36
883000 -- [-1541.993] (-1546.107) (-1550.356) (-1547.998) * (-1543.097) (-1548.113) [-1545.085] (-1546.496) -- 0:00:35
883500 -- (-1549.802) (-1545.226) (-1553.432) [-1544.715] * (-1543.135) (-1555.454) [-1547.214] (-1543.220) -- 0:00:35
884000 -- [-1540.559] (-1543.181) (-1550.502) (-1546.804) * [-1543.460] (-1552.746) (-1543.878) (-1547.716) -- 0:00:35
884500 -- [-1543.569] (-1549.733) (-1551.693) (-1547.662) * (-1542.828) [-1550.941] (-1553.314) (-1546.487) -- 0:00:35
885000 -- (-1545.582) (-1548.631) [-1547.401] (-1543.604) * [-1549.485] (-1545.831) (-1547.254) (-1543.749) -- 0:00:35
Average standard deviation of split frequencies: 0.005143
885500 -- [-1547.786] (-1543.241) (-1557.569) (-1549.985) * [-1547.864] (-1553.926) (-1549.300) (-1541.449) -- 0:00:35
886000 -- (-1548.828) [-1545.822] (-1544.899) (-1546.434) * [-1545.457] (-1544.558) (-1547.092) (-1546.626) -- 0:00:34
886500 -- (-1551.067) [-1545.514] (-1547.432) (-1551.564) * [-1542.929] (-1550.786) (-1548.872) (-1556.720) -- 0:00:34
887000 -- (-1546.152) [-1544.270] (-1550.049) (-1549.444) * (-1547.787) (-1547.062) [-1546.622] (-1547.299) -- 0:00:34
887500 -- [-1546.398] (-1547.275) (-1543.935) (-1544.314) * (-1549.338) (-1550.263) [-1551.911] (-1546.729) -- 0:00:34
888000 -- (-1554.211) (-1547.141) [-1542.796] (-1549.049) * (-1546.208) [-1546.386] (-1555.924) (-1550.324) -- 0:00:34
888500 -- (-1549.533) [-1552.564] (-1552.305) (-1547.228) * (-1546.760) (-1551.250) [-1550.730] (-1544.444) -- 0:00:34
889000 -- [-1545.826] (-1548.965) (-1545.896) (-1542.041) * [-1541.580] (-1546.776) (-1546.595) (-1546.553) -- 0:00:33
889500 -- (-1545.594) [-1541.255] (-1543.610) (-1542.370) * [-1551.187] (-1545.143) (-1557.392) (-1544.469) -- 0:00:33
890000 -- (-1551.074) (-1547.719) [-1545.406] (-1552.148) * (-1556.426) [-1553.093] (-1550.422) (-1545.179) -- 0:00:33
Average standard deviation of split frequencies: 0.004411
890500 -- (-1549.728) (-1542.246) [-1545.131] (-1546.298) * [-1546.564] (-1549.800) (-1550.610) (-1544.196) -- 0:00:33
891000 -- (-1551.731) [-1542.410] (-1544.729) (-1550.052) * (-1547.846) (-1552.013) (-1545.804) [-1543.127] -- 0:00:33
891500 -- (-1552.800) (-1548.897) [-1551.266] (-1552.205) * (-1543.560) (-1546.132) [-1545.444] (-1547.804) -- 0:00:33
892000 -- (-1545.967) (-1553.374) [-1544.382] (-1550.161) * (-1545.727) (-1545.628) [-1543.504] (-1556.729) -- 0:00:33
892500 -- (-1545.552) (-1546.204) [-1549.993] (-1545.851) * (-1545.278) (-1548.746) [-1547.644] (-1549.620) -- 0:00:32
893000 -- (-1542.932) [-1544.307] (-1548.552) (-1553.582) * [-1544.881] (-1545.247) (-1551.629) (-1547.598) -- 0:00:32
893500 -- (-1559.347) (-1542.193) (-1550.691) [-1549.888] * (-1546.110) (-1546.642) [-1546.145] (-1548.261) -- 0:00:32
894000 -- (-1547.054) (-1546.593) (-1548.102) [-1549.178] * (-1549.536) (-1544.448) (-1549.450) [-1543.483] -- 0:00:32
894500 -- (-1544.341) [-1551.718] (-1551.293) (-1548.367) * (-1552.605) (-1543.387) [-1547.138] (-1546.199) -- 0:00:32
895000 -- (-1550.189) (-1543.180) [-1545.736] (-1547.258) * [-1546.819] (-1545.351) (-1546.747) (-1548.406) -- 0:00:32
Average standard deviation of split frequencies: 0.004384
895500 -- (-1544.759) (-1547.060) [-1546.050] (-1558.695) * [-1542.901] (-1546.853) (-1555.503) (-1543.677) -- 0:00:31
896000 -- (-1549.044) (-1547.168) (-1542.610) [-1546.885] * [-1545.769] (-1542.598) (-1553.567) (-1543.028) -- 0:00:31
896500 -- [-1554.381] (-1550.091) (-1545.017) (-1551.357) * (-1546.186) [-1543.635] (-1551.929) (-1545.516) -- 0:00:31
897000 -- (-1546.511) [-1553.103] (-1546.352) (-1553.782) * (-1544.618) (-1549.208) (-1552.137) [-1549.537] -- 0:00:31
897500 -- (-1541.308) [-1546.481] (-1549.182) (-1544.266) * (-1542.813) (-1544.744) (-1549.377) [-1543.803] -- 0:00:31
898000 -- (-1548.281) (-1547.211) [-1545.994] (-1548.707) * (-1549.369) (-1547.990) (-1548.655) [-1548.877] -- 0:00:31
898500 -- (-1550.273) (-1545.825) [-1544.250] (-1550.161) * [-1548.684] (-1552.577) (-1556.695) (-1548.714) -- 0:00:31
899000 -- (-1553.193) (-1541.879) [-1549.778] (-1549.222) * [-1547.050] (-1551.684) (-1538.990) (-1548.316) -- 0:00:30
899500 -- (-1544.768) (-1547.527) [-1544.773] (-1543.551) * (-1544.267) (-1546.362) [-1543.706] (-1544.498) -- 0:00:30
900000 -- [-1548.353] (-1548.766) (-1546.436) (-1545.782) * (-1547.301) (-1547.548) (-1542.250) [-1544.855] -- 0:00:30
Average standard deviation of split frequencies: 0.004885
900500 -- (-1548.380) [-1546.413] (-1547.757) (-1549.381) * (-1545.907) (-1544.739) [-1546.719] (-1545.619) -- 0:00:30
901000 -- [-1545.395] (-1543.926) (-1548.341) (-1547.133) * (-1543.433) (-1547.580) (-1543.565) [-1545.505] -- 0:00:30
901500 -- (-1552.390) (-1555.295) [-1543.372] (-1543.669) * (-1549.871) (-1556.700) [-1547.385] (-1545.956) -- 0:00:30
902000 -- [-1554.196] (-1549.850) (-1544.550) (-1549.268) * (-1545.959) [-1544.969] (-1555.760) (-1544.794) -- 0:00:29
902500 -- [-1548.835] (-1541.886) (-1544.934) (-1548.914) * (-1544.193) (-1546.763) (-1547.361) [-1542.752] -- 0:00:29
903000 -- (-1549.540) (-1547.039) (-1543.298) [-1546.124] * (-1542.690) (-1551.026) [-1546.938] (-1548.625) -- 0:00:29
903500 -- (-1552.681) (-1550.695) [-1548.890] (-1544.847) * (-1546.737) (-1552.224) [-1544.915] (-1549.567) -- 0:00:29
904000 -- (-1554.662) (-1546.699) [-1541.904] (-1548.890) * [-1549.634] (-1545.597) (-1543.151) (-1546.918) -- 0:00:29
904500 -- (-1549.370) (-1552.652) (-1546.987) [-1544.316] * [-1542.479] (-1553.436) (-1547.242) (-1549.358) -- 0:00:29
905000 -- (-1544.825) [-1551.723] (-1549.154) (-1546.541) * (-1546.661) (-1549.710) [-1543.192] (-1543.169) -- 0:00:29
Average standard deviation of split frequencies: 0.006070
905500 -- [-1553.765] (-1547.209) (-1548.907) (-1547.173) * (-1548.644) (-1542.526) (-1544.436) [-1543.401] -- 0:00:28
906000 -- (-1549.163) (-1549.471) [-1548.661] (-1550.353) * (-1546.936) [-1543.947] (-1548.714) (-1541.813) -- 0:00:28
906500 -- (-1545.373) (-1555.059) [-1546.502] (-1545.105) * (-1541.215) [-1547.038] (-1545.122) (-1545.121) -- 0:00:28
907000 -- (-1545.291) (-1552.009) [-1548.535] (-1548.179) * [-1542.693] (-1543.366) (-1550.301) (-1551.814) -- 0:00:28
907500 -- (-1542.658) (-1545.531) (-1546.479) [-1553.765] * (-1544.509) [-1544.036] (-1552.321) (-1544.274) -- 0:00:28
908000 -- [-1549.324] (-1551.647) (-1545.358) (-1550.668) * (-1546.499) [-1546.747] (-1540.885) (-1549.505) -- 0:00:28
908500 -- [-1543.003] (-1543.003) (-1544.443) (-1551.614) * [-1543.388] (-1549.687) (-1552.278) (-1545.543) -- 0:00:27
909000 -- (-1545.478) (-1546.713) [-1546.009] (-1549.889) * (-1547.003) (-1550.286) (-1547.823) [-1543.529] -- 0:00:27
909500 -- (-1545.884) (-1560.424) [-1542.115] (-1544.453) * (-1546.152) [-1548.964] (-1547.020) (-1548.538) -- 0:00:27
910000 -- [-1552.042] (-1552.563) (-1543.722) (-1546.401) * [-1544.077] (-1544.341) (-1547.598) (-1546.842) -- 0:00:27
Average standard deviation of split frequencies: 0.007075
910500 -- (-1546.340) (-1555.149) [-1543.338] (-1547.283) * (-1547.604) [-1543.754] (-1552.713) (-1548.263) -- 0:00:27
911000 -- [-1548.438] (-1551.536) (-1544.410) (-1545.751) * (-1551.596) (-1553.150) [-1542.972] (-1548.336) -- 0:00:27
911500 -- (-1551.237) [-1553.020] (-1546.022) (-1541.833) * (-1545.690) [-1542.778] (-1545.488) (-1552.892) -- 0:00:26
912000 -- (-1546.394) (-1546.435) [-1547.419] (-1543.649) * (-1551.006) (-1546.207) (-1554.154) [-1546.352] -- 0:00:26
912500 -- (-1545.182) (-1548.954) [-1543.039] (-1542.088) * (-1546.795) (-1547.807) [-1551.748] (-1544.723) -- 0:00:26
913000 -- [-1542.927] (-1549.189) (-1547.901) (-1553.558) * (-1551.903) (-1546.874) (-1550.610) [-1544.254] -- 0:00:26
913500 -- [-1544.532] (-1548.915) (-1550.683) (-1542.510) * (-1545.994) [-1550.461] (-1542.787) (-1545.254) -- 0:00:26
914000 -- [-1545.041] (-1554.447) (-1546.900) (-1541.010) * [-1543.480] (-1552.382) (-1550.237) (-1549.914) -- 0:00:26
914500 -- (-1550.596) (-1556.507) (-1552.251) [-1545.424] * (-1545.147) [-1545.484] (-1540.045) (-1547.647) -- 0:00:26
915000 -- (-1552.964) (-1554.741) [-1545.925] (-1545.884) * [-1544.948] (-1548.175) (-1551.118) (-1546.962) -- 0:00:25
Average standard deviation of split frequencies: 0.008063
915500 -- (-1546.570) (-1545.166) [-1540.160] (-1543.699) * (-1549.047) [-1548.041] (-1547.458) (-1545.628) -- 0:00:25
916000 -- [-1545.461] (-1552.021) (-1550.559) (-1546.712) * (-1554.405) [-1543.426] (-1547.805) (-1548.639) -- 0:00:25
916500 -- (-1548.760) (-1551.255) [-1547.610] (-1546.679) * [-1554.088] (-1541.673) (-1551.524) (-1546.669) -- 0:00:25
917000 -- [-1546.852] (-1554.256) (-1547.558) (-1545.821) * (-1546.827) (-1554.544) (-1544.796) [-1544.234] -- 0:00:25
917500 -- [-1547.726] (-1550.536) (-1546.691) (-1550.592) * (-1551.508) [-1547.592] (-1544.755) (-1549.407) -- 0:00:25
918000 -- (-1551.870) (-1552.868) [-1543.957] (-1548.464) * [-1542.931] (-1546.385) (-1550.255) (-1543.853) -- 0:00:25
918500 -- (-1558.232) (-1551.369) (-1548.588) [-1548.566] * (-1546.577) (-1556.035) (-1543.760) [-1547.417] -- 0:00:24
919000 -- (-1551.788) (-1549.796) (-1546.768) [-1547.167] * (-1549.782) (-1543.602) [-1542.628] (-1546.411) -- 0:00:24
919500 -- [-1546.540] (-1547.803) (-1549.498) (-1550.239) * (-1547.700) (-1547.328) (-1553.292) [-1548.526] -- 0:00:24
920000 -- (-1545.877) (-1555.116) [-1552.243] (-1551.047) * (-1542.165) [-1542.859] (-1545.433) (-1547.312) -- 0:00:24
Average standard deviation of split frequencies: 0.006998
920500 -- [-1553.075] (-1545.267) (-1553.017) (-1555.028) * [-1543.993] (-1543.089) (-1543.723) (-1555.013) -- 0:00:24
921000 -- (-1550.940) [-1547.816] (-1544.510) (-1553.705) * (-1545.492) [-1545.155] (-1545.470) (-1550.212) -- 0:00:24
921500 -- (-1545.270) [-1549.840] (-1543.761) (-1548.203) * (-1543.027) [-1547.442] (-1544.037) (-1542.880) -- 0:00:23
922000 -- (-1546.457) (-1553.947) (-1550.547) [-1550.707] * (-1545.933) (-1549.449) (-1552.333) [-1548.561] -- 0:00:23
922500 -- (-1547.399) (-1551.889) (-1552.280) [-1543.828] * [-1543.995] (-1550.274) (-1545.217) (-1547.103) -- 0:00:23
923000 -- (-1553.179) (-1549.146) (-1542.120) [-1546.097] * (-1551.700) (-1555.445) [-1547.177] (-1548.759) -- 0:00:23
923500 -- (-1546.962) [-1552.308] (-1552.790) (-1552.010) * (-1553.475) (-1564.712) [-1550.975] (-1547.189) -- 0:00:23
924000 -- [-1545.578] (-1543.823) (-1556.745) (-1549.971) * (-1547.962) (-1552.717) (-1555.437) [-1551.537] -- 0:00:23
924500 -- [-1541.381] (-1550.395) (-1545.088) (-1547.724) * (-1548.987) (-1546.154) [-1545.873] (-1548.436) -- 0:00:23
925000 -- (-1544.352) (-1546.067) (-1549.197) [-1546.243] * [-1543.745] (-1548.436) (-1552.824) (-1544.163) -- 0:00:22
Average standard deviation of split frequencies: 0.007466
925500 -- (-1544.489) [-1551.313] (-1547.784) (-1551.362) * (-1559.681) (-1543.597) (-1546.290) [-1550.052] -- 0:00:22
926000 -- (-1545.059) (-1549.769) (-1547.523) [-1545.144] * (-1550.833) (-1549.124) (-1552.813) [-1549.154] -- 0:00:22
926500 -- (-1549.518) (-1553.906) (-1546.419) [-1543.097] * [-1544.159] (-1551.452) (-1547.076) (-1548.462) -- 0:00:22
927000 -- (-1546.232) (-1552.233) [-1552.885] (-1546.987) * [-1549.011] (-1547.082) (-1547.139) (-1551.814) -- 0:00:22
927500 -- [-1545.681] (-1553.301) (-1547.599) (-1550.996) * (-1547.465) (-1547.180) (-1545.418) [-1552.223] -- 0:00:22
928000 -- (-1546.118) [-1549.584] (-1549.272) (-1547.848) * (-1552.964) (-1550.239) [-1550.148] (-1550.471) -- 0:00:21
928500 -- [-1550.078] (-1550.203) (-1547.638) (-1546.079) * (-1547.224) (-1549.227) [-1551.654] (-1546.779) -- 0:00:21
929000 -- [-1542.362] (-1551.919) (-1552.827) (-1548.982) * (-1546.123) (-1557.843) [-1544.573] (-1546.615) -- 0:00:21
929500 -- [-1545.188] (-1549.586) (-1554.174) (-1550.510) * (-1545.755) (-1553.821) [-1550.705] (-1547.910) -- 0:00:21
930000 -- [-1546.340] (-1553.904) (-1550.939) (-1544.922) * (-1550.379) (-1551.672) (-1545.245) [-1544.229] -- 0:00:21
Average standard deviation of split frequencies: 0.007260
930500 -- (-1552.485) [-1548.503] (-1552.364) (-1542.982) * [-1544.158] (-1545.165) (-1554.324) (-1545.869) -- 0:00:21
931000 -- [-1544.806] (-1545.574) (-1557.076) (-1549.574) * [-1544.743] (-1553.316) (-1554.334) (-1543.987) -- 0:00:20
931500 -- (-1543.815) (-1551.023) (-1548.845) [-1546.959] * (-1544.137) (-1543.341) (-1552.757) [-1550.201] -- 0:00:20
932000 -- (-1546.397) (-1545.801) (-1554.543) [-1547.788] * (-1543.739) [-1550.949] (-1548.434) (-1546.046) -- 0:00:20
932500 -- (-1544.739) [-1542.914] (-1555.216) (-1550.185) * (-1545.241) [-1545.886] (-1543.685) (-1542.942) -- 0:00:20
933000 -- (-1551.219) (-1548.589) [-1552.463] (-1547.024) * (-1542.920) [-1545.627] (-1545.421) (-1552.717) -- 0:00:20
933500 -- (-1550.167) (-1546.832) (-1545.048) [-1546.420] * (-1542.972) [-1548.352] (-1546.359) (-1550.720) -- 0:00:20
934000 -- (-1556.490) [-1546.887] (-1556.105) (-1546.810) * (-1542.864) (-1552.768) [-1551.211] (-1544.459) -- 0:00:20
934500 -- (-1549.016) [-1545.900] (-1546.134) (-1553.055) * (-1543.836) [-1542.372] (-1557.771) (-1550.848) -- 0:00:19
935000 -- (-1546.247) (-1544.692) [-1547.654] (-1549.859) * (-1547.470) [-1544.542] (-1547.535) (-1547.936) -- 0:00:19
Average standard deviation of split frequencies: 0.006547
935500 -- [-1548.893] (-1548.188) (-1555.071) (-1551.698) * (-1541.373) (-1555.781) (-1547.356) [-1547.999] -- 0:00:19
936000 -- (-1546.847) (-1544.966) (-1550.624) [-1547.930] * [-1544.394] (-1546.312) (-1547.251) (-1544.481) -- 0:00:19
936500 -- (-1546.500) [-1545.735] (-1549.187) (-1550.319) * (-1547.636) [-1546.682] (-1550.277) (-1553.530) -- 0:00:19
937000 -- (-1547.021) (-1545.245) [-1546.569] (-1544.314) * (-1546.512) (-1548.738) (-1548.861) [-1546.475] -- 0:00:19
937500 -- (-1546.471) [-1550.893] (-1541.212) (-1552.655) * (-1547.191) (-1555.510) (-1544.807) [-1542.978] -- 0:00:19
938000 -- (-1543.527) [-1547.680] (-1553.749) (-1543.284) * (-1558.193) (-1553.140) [-1543.269] (-1543.999) -- 0:00:18
938500 -- [-1550.121] (-1544.490) (-1549.842) (-1549.215) * [-1546.107] (-1558.747) (-1543.380) (-1547.546) -- 0:00:18
939000 -- (-1553.340) (-1549.406) [-1551.224] (-1553.292) * [-1549.279] (-1542.866) (-1547.351) (-1545.127) -- 0:00:18
939500 -- (-1546.509) [-1555.349] (-1543.386) (-1557.603) * (-1552.018) (-1545.360) [-1545.665] (-1545.902) -- 0:00:18
940000 -- (-1543.816) (-1548.401) [-1546.066] (-1552.559) * (-1555.966) (-1546.937) (-1552.138) [-1545.727] -- 0:00:18
Average standard deviation of split frequencies: 0.006682
940500 -- (-1545.561) (-1548.918) (-1549.265) [-1543.960] * (-1547.589) [-1551.643] (-1546.849) (-1543.200) -- 0:00:18
941000 -- (-1545.032) [-1550.137] (-1548.746) (-1550.514) * (-1548.403) [-1548.132] (-1548.809) (-1546.333) -- 0:00:17
941500 -- (-1544.258) [-1543.543] (-1548.800) (-1559.048) * (-1558.749) [-1545.025] (-1549.474) (-1546.496) -- 0:00:17
942000 -- (-1547.512) [-1544.078] (-1546.294) (-1549.191) * (-1552.112) [-1547.245] (-1544.927) (-1547.589) -- 0:00:17
942500 -- (-1543.520) (-1544.042) [-1543.024] (-1548.829) * (-1552.939) (-1548.770) [-1549.600] (-1552.520) -- 0:00:17
943000 -- (-1543.477) (-1549.573) (-1543.748) [-1547.118] * (-1555.010) (-1542.948) (-1548.897) [-1548.334] -- 0:00:17
943500 -- [-1547.668] (-1551.992) (-1550.027) (-1548.547) * (-1547.479) (-1553.008) [-1546.324] (-1542.387) -- 0:00:17
944000 -- (-1546.515) (-1549.635) (-1545.588) [-1554.836] * (-1549.047) (-1543.452) (-1545.718) [-1549.034] -- 0:00:17
944500 -- (-1544.820) (-1549.441) (-1548.144) [-1549.673] * (-1544.224) (-1545.908) [-1546.857] (-1553.581) -- 0:00:16
945000 -- [-1545.052] (-1551.029) (-1554.458) (-1549.786) * (-1544.039) [-1544.969] (-1549.674) (-1548.813) -- 0:00:16
Average standard deviation of split frequencies: 0.006976
945500 -- (-1544.775) [-1543.721] (-1554.097) (-1546.045) * (-1547.888) [-1548.412] (-1548.373) (-1544.789) -- 0:00:16
946000 -- (-1549.958) [-1550.504] (-1551.084) (-1545.221) * [-1543.197] (-1548.064) (-1553.926) (-1548.858) -- 0:00:16
946500 -- (-1550.676) (-1543.530) (-1546.928) [-1545.995] * [-1543.849] (-1549.032) (-1546.697) (-1550.510) -- 0:00:16
947000 -- (-1553.393) (-1545.486) (-1544.063) [-1550.155] * (-1545.246) (-1549.246) [-1544.358] (-1551.481) -- 0:00:16
947500 -- (-1546.883) [-1545.047] (-1547.561) (-1555.295) * (-1552.187) (-1546.249) [-1544.036] (-1547.953) -- 0:00:15
948000 -- (-1547.917) (-1541.011) [-1548.887] (-1544.841) * (-1552.800) (-1556.415) [-1543.362] (-1548.904) -- 0:00:15
948500 -- (-1552.590) (-1543.653) [-1546.112] (-1547.980) * (-1544.311) [-1548.362] (-1556.844) (-1550.900) -- 0:00:15
949000 -- (-1545.006) (-1545.773) (-1551.543) [-1543.003] * (-1550.769) [-1548.953] (-1555.395) (-1545.309) -- 0:00:15
949500 -- (-1544.262) (-1549.479) (-1543.251) [-1545.348] * (-1549.918) [-1550.513] (-1549.745) (-1543.940) -- 0:00:15
950000 -- (-1548.962) (-1547.129) (-1546.671) [-1547.547] * [-1551.337] (-1546.032) (-1544.224) (-1547.583) -- 0:00:15
Average standard deviation of split frequencies: 0.007934
950500 -- (-1547.424) (-1543.939) [-1543.134] (-1542.006) * (-1549.442) (-1545.658) [-1545.152] (-1548.858) -- 0:00:14
951000 -- (-1547.259) [-1548.083] (-1544.757) (-1549.893) * (-1544.482) (-1544.118) [-1548.382] (-1553.987) -- 0:00:14
951500 -- (-1550.401) (-1550.161) (-1548.016) [-1544.923] * (-1549.354) [-1548.072] (-1545.432) (-1549.027) -- 0:00:14
952000 -- (-1553.854) [-1547.596] (-1554.916) (-1545.710) * (-1549.588) (-1550.648) (-1548.502) [-1545.382] -- 0:00:14
952500 -- (-1547.710) (-1545.326) [-1544.923] (-1553.752) * (-1546.313) (-1554.748) [-1543.565] (-1545.045) -- 0:00:14
953000 -- (-1545.894) (-1545.744) (-1556.338) [-1548.049] * (-1547.306) (-1545.147) [-1545.703] (-1542.996) -- 0:00:14
953500 -- [-1541.371] (-1547.785) (-1548.886) (-1546.266) * (-1547.480) (-1549.256) (-1554.871) [-1543.773] -- 0:00:14
954000 -- (-1547.923) (-1549.428) (-1548.760) [-1546.269] * (-1552.419) (-1550.229) [-1547.186] (-1542.402) -- 0:00:13
954500 -- [-1552.578] (-1549.385) (-1544.176) (-1542.413) * (-1548.027) (-1548.369) (-1549.101) [-1545.461] -- 0:00:13
955000 -- (-1549.124) (-1544.235) (-1546.616) [-1545.217] * [-1545.907] (-1547.026) (-1549.590) (-1543.037) -- 0:00:13
Average standard deviation of split frequencies: 0.007890
955500 -- [-1541.926] (-1554.919) (-1548.748) (-1543.289) * [-1548.380] (-1551.146) (-1550.521) (-1552.463) -- 0:00:13
956000 -- (-1545.593) (-1546.185) [-1547.501] (-1545.180) * (-1545.844) (-1545.855) (-1547.866) [-1546.364] -- 0:00:13
956500 -- (-1546.593) (-1549.443) [-1545.258] (-1550.350) * (-1552.832) (-1547.720) [-1544.290] (-1545.981) -- 0:00:13
957000 -- (-1553.726) (-1546.249) [-1545.396] (-1552.749) * (-1547.397) (-1550.892) [-1547.780] (-1549.357) -- 0:00:13
957500 -- (-1547.816) [-1549.683] (-1546.406) (-1552.885) * (-1551.193) [-1544.750] (-1544.972) (-1548.678) -- 0:00:12
958000 -- [-1542.518] (-1546.909) (-1545.725) (-1543.163) * (-1545.813) (-1545.926) (-1554.981) [-1542.149] -- 0:00:12
958500 -- (-1550.463) [-1544.735] (-1549.996) (-1543.711) * [-1542.846] (-1545.643) (-1558.347) (-1547.988) -- 0:00:12
959000 -- (-1548.814) (-1544.775) [-1551.547] (-1541.311) * [-1542.597] (-1541.155) (-1546.945) (-1545.891) -- 0:00:12
959500 -- (-1545.363) [-1547.552] (-1549.849) (-1543.860) * (-1547.317) (-1550.354) [-1549.853] (-1556.549) -- 0:00:12
960000 -- (-1550.950) (-1552.857) [-1551.792] (-1545.966) * (-1548.235) (-1548.363) [-1547.362] (-1547.766) -- 0:00:12
Average standard deviation of split frequencies: 0.008015
960500 -- (-1552.809) (-1548.473) (-1552.838) [-1548.879] * (-1546.748) (-1547.250) [-1553.870] (-1542.230) -- 0:00:11
961000 -- [-1549.253] (-1549.122) (-1551.848) (-1547.800) * (-1547.390) (-1548.367) [-1542.616] (-1544.044) -- 0:00:11
961500 -- [-1545.208] (-1544.025) (-1553.620) (-1548.660) * (-1545.404) (-1547.261) [-1545.856] (-1552.744) -- 0:00:11
962000 -- (-1545.337) (-1548.261) (-1543.571) [-1546.171] * (-1549.046) (-1548.890) (-1545.717) [-1544.936] -- 0:00:11
962500 -- (-1550.730) [-1546.333] (-1546.952) (-1552.060) * (-1548.290) [-1544.033] (-1544.264) (-1549.468) -- 0:00:11
963000 -- [-1547.074] (-1544.793) (-1549.092) (-1549.905) * (-1545.535) (-1546.614) (-1548.222) [-1542.637] -- 0:00:11
963500 -- (-1543.391) (-1545.894) [-1548.991] (-1548.879) * (-1556.411) (-1556.421) [-1544.097] (-1543.113) -- 0:00:11
964000 -- (-1548.313) [-1548.419] (-1544.403) (-1551.572) * (-1550.749) (-1552.975) [-1545.292] (-1546.519) -- 0:00:10
964500 -- (-1547.538) (-1550.885) (-1552.017) [-1545.314] * (-1547.124) (-1559.382) (-1544.761) [-1552.829] -- 0:00:10
965000 -- [-1553.985] (-1548.518) (-1548.887) (-1544.970) * (-1548.758) (-1557.503) [-1547.614] (-1548.100) -- 0:00:10
Average standard deviation of split frequencies: 0.007645
965500 -- (-1549.598) (-1558.184) [-1544.176] (-1548.037) * [-1541.890] (-1558.715) (-1545.969) (-1546.888) -- 0:00:10
966000 -- (-1545.036) (-1557.469) [-1543.709] (-1551.618) * (-1550.301) [-1551.168] (-1548.992) (-1544.699) -- 0:00:10
966500 -- (-1546.817) (-1546.150) [-1542.809] (-1554.958) * (-1546.072) (-1549.316) [-1543.129] (-1548.090) -- 0:00:10
967000 -- (-1550.840) (-1551.789) [-1542.330] (-1551.052) * [-1546.168] (-1553.379) (-1548.530) (-1547.547) -- 0:00:09
967500 -- (-1551.179) [-1545.768] (-1548.954) (-1549.454) * (-1546.985) (-1549.413) (-1548.692) [-1544.226] -- 0:00:09
968000 -- (-1548.526) [-1544.163] (-1545.716) (-1553.244) * (-1542.961) (-1544.450) [-1551.740] (-1548.444) -- 0:00:09
968500 -- (-1547.526) (-1543.912) [-1545.117] (-1555.589) * (-1543.774) [-1544.597] (-1551.751) (-1541.212) -- 0:00:09
969000 -- (-1552.968) [-1546.118] (-1552.642) (-1547.263) * (-1546.617) (-1545.058) (-1549.901) [-1551.784] -- 0:00:09
969500 -- (-1543.355) [-1545.568] (-1549.370) (-1549.290) * (-1546.137) [-1545.900] (-1544.873) (-1546.802) -- 0:00:09
970000 -- (-1547.722) (-1546.841) [-1549.275] (-1552.456) * (-1544.781) (-1544.109) (-1550.899) [-1549.574] -- 0:00:09
Average standard deviation of split frequencies: 0.007770
970500 -- (-1549.099) (-1543.388) (-1550.916) [-1546.421] * (-1552.802) (-1547.261) [-1540.719] (-1544.834) -- 0:00:08
971000 -- (-1546.404) (-1546.868) [-1544.403] (-1550.112) * (-1545.149) (-1547.074) (-1545.035) [-1545.726] -- 0:00:08
971500 -- (-1545.410) (-1544.474) (-1548.322) [-1550.425] * (-1546.930) [-1547.306] (-1549.245) (-1545.006) -- 0:00:08
972000 -- (-1546.579) (-1549.799) (-1543.785) [-1549.206] * (-1546.688) [-1541.476] (-1546.708) (-1546.246) -- 0:00:08
972500 -- (-1547.186) (-1553.931) (-1550.976) [-1545.925] * (-1549.430) (-1547.728) (-1551.390) [-1545.614] -- 0:00:08
973000 -- [-1541.453] (-1548.460) (-1547.297) (-1550.139) * (-1548.568) (-1547.551) (-1543.352) [-1547.734] -- 0:00:08
973500 -- [-1546.176] (-1545.591) (-1551.331) (-1548.052) * [-1548.966] (-1543.830) (-1546.723) (-1546.125) -- 0:00:08
974000 -- [-1547.384] (-1548.207) (-1549.694) (-1553.698) * (-1546.388) [-1543.876] (-1547.798) (-1547.021) -- 0:00:07
974500 -- [-1545.694] (-1543.439) (-1546.568) (-1544.549) * (-1554.577) (-1549.165) (-1547.494) [-1542.650] -- 0:00:07
975000 -- (-1546.689) [-1542.938] (-1544.714) (-1551.645) * (-1556.438) (-1552.900) [-1546.598] (-1542.261) -- 0:00:07
Average standard deviation of split frequencies: 0.007889
975500 -- (-1547.090) (-1549.210) [-1543.881] (-1548.662) * [-1547.333] (-1546.866) (-1553.802) (-1546.831) -- 0:00:07
976000 -- (-1558.381) (-1551.169) (-1547.531) [-1546.800] * (-1548.845) [-1547.495] (-1545.880) (-1547.734) -- 0:00:07
976500 -- [-1546.385] (-1543.937) (-1547.785) (-1546.307) * [-1554.496] (-1553.157) (-1549.104) (-1541.970) -- 0:00:07
977000 -- [-1545.390] (-1543.335) (-1545.255) (-1544.597) * (-1547.778) [-1551.768] (-1551.852) (-1549.859) -- 0:00:06
977500 -- (-1546.035) (-1553.458) (-1543.187) [-1544.133] * [-1547.971] (-1550.920) (-1548.438) (-1542.046) -- 0:00:06
978000 -- (-1543.640) (-1546.625) (-1550.104) [-1547.585] * (-1546.553) (-1545.626) (-1553.829) [-1543.825] -- 0:00:06
978500 -- (-1546.789) (-1550.689) [-1547.228] (-1545.259) * (-1546.187) [-1544.797] (-1547.751) (-1550.027) -- 0:00:06
979000 -- (-1547.122) (-1544.368) (-1545.185) [-1544.764] * [-1544.859] (-1549.831) (-1551.616) (-1546.181) -- 0:00:06
979500 -- [-1545.556] (-1547.562) (-1545.533) (-1543.119) * (-1547.803) (-1547.555) (-1546.850) [-1548.057] -- 0:00:06
980000 -- (-1547.281) [-1546.123] (-1548.431) (-1545.639) * (-1541.014) (-1549.026) (-1548.137) [-1555.256] -- 0:00:06
Average standard deviation of split frequencies: 0.007050
980500 -- (-1543.984) (-1551.395) (-1545.136) [-1545.302] * [-1544.297] (-1546.459) (-1542.881) (-1542.997) -- 0:00:05
981000 -- [-1549.827] (-1549.443) (-1551.106) (-1544.083) * (-1545.939) [-1543.430] (-1547.512) (-1542.038) -- 0:00:05
981500 -- (-1550.567) (-1546.982) [-1542.124] (-1545.047) * (-1548.382) (-1546.933) (-1543.178) [-1542.299] -- 0:00:05
982000 -- (-1547.369) (-1547.639) [-1546.659] (-1550.894) * (-1552.900) (-1547.445) [-1547.742] (-1544.810) -- 0:00:05
982500 -- (-1547.597) (-1548.515) [-1546.007] (-1555.493) * (-1550.681) (-1545.916) (-1552.299) [-1545.420] -- 0:00:05
983000 -- (-1551.965) (-1546.220) (-1552.242) [-1540.723] * (-1549.977) (-1541.749) (-1548.384) [-1552.356] -- 0:00:05
983500 -- [-1545.187] (-1554.128) (-1545.595) (-1548.012) * (-1551.491) [-1544.318] (-1547.968) (-1550.576) -- 0:00:04
984000 -- (-1554.015) (-1547.753) [-1541.025] (-1546.052) * [-1543.784] (-1547.172) (-1551.453) (-1542.085) -- 0:00:04
984500 -- (-1561.083) (-1552.725) [-1548.646] (-1550.442) * (-1541.249) (-1548.133) [-1544.521] (-1552.132) -- 0:00:04
985000 -- (-1551.688) (-1547.763) [-1550.669] (-1547.049) * (-1548.441) (-1547.671) (-1545.663) [-1543.231] -- 0:00:04
Average standard deviation of split frequencies: 0.006215
985500 -- (-1549.796) [-1544.234] (-1544.676) (-1543.966) * (-1546.378) (-1551.974) (-1549.578) [-1546.245] -- 0:00:04
986000 -- (-1548.277) (-1542.700) [-1544.099] (-1546.596) * [-1547.714] (-1546.202) (-1548.025) (-1546.104) -- 0:00:04
986500 -- (-1548.235) (-1548.596) (-1547.929) [-1543.629] * (-1556.412) (-1549.039) [-1546.342] (-1550.314) -- 0:00:04
987000 -- (-1547.843) (-1550.878) [-1549.555] (-1553.794) * (-1546.604) (-1548.167) (-1551.614) [-1549.363] -- 0:00:03
987500 -- (-1548.141) (-1551.367) (-1553.667) [-1546.143] * (-1546.867) (-1545.785) [-1546.163] (-1548.508) -- 0:00:03
988000 -- [-1546.161] (-1549.540) (-1549.437) (-1547.735) * (-1546.366) (-1547.247) [-1547.260] (-1545.294) -- 0:00:03
988500 -- (-1555.060) [-1544.081] (-1545.961) (-1552.031) * [-1544.926] (-1550.380) (-1549.933) (-1547.072) -- 0:00:03
989000 -- (-1551.013) (-1549.952) (-1552.979) [-1545.716] * (-1545.651) [-1546.637] (-1546.114) (-1549.815) -- 0:00:03
989500 -- (-1547.871) [-1548.127] (-1543.817) (-1544.163) * (-1556.711) (-1547.331) (-1543.904) [-1545.804] -- 0:00:03
990000 -- [-1552.942] (-1551.952) (-1543.650) (-1546.824) * (-1547.161) [-1548.190] (-1552.960) (-1545.855) -- 0:00:03
Average standard deviation of split frequencies: 0.004917
990500 -- [-1551.049] (-1550.343) (-1548.469) (-1550.629) * [-1547.653] (-1551.079) (-1546.321) (-1545.336) -- 0:00:02
991000 -- (-1550.924) (-1545.334) (-1548.368) [-1546.807] * [-1548.278] (-1551.959) (-1550.560) (-1544.754) -- 0:00:02
991500 -- (-1546.299) (-1545.146) [-1543.449] (-1550.613) * (-1548.787) (-1546.526) [-1544.265] (-1545.565) -- 0:00:02
992000 -- [-1544.761] (-1547.493) (-1548.626) (-1552.902) * (-1549.742) [-1544.145] (-1551.206) (-1548.009) -- 0:00:02
992500 -- (-1543.779) [-1545.317] (-1545.251) (-1559.306) * [-1547.339] (-1550.945) (-1547.637) (-1550.459) -- 0:00:02
993000 -- (-1547.850) [-1547.267] (-1548.632) (-1548.457) * (-1551.938) (-1547.494) [-1548.096] (-1551.862) -- 0:00:02
993500 -- (-1551.078) [-1549.985] (-1549.724) (-1546.652) * (-1551.677) [-1547.972] (-1544.036) (-1546.630) -- 0:00:01
994000 -- (-1543.328) (-1542.164) [-1543.647] (-1546.633) * [-1549.500] (-1546.990) (-1544.075) (-1549.464) -- 0:00:01
994500 -- [-1546.316] (-1546.699) (-1546.868) (-1551.661) * (-1544.816) [-1543.506] (-1547.271) (-1543.085) -- 0:00:01
995000 -- (-1548.247) (-1545.476) [-1546.767] (-1548.333) * (-1553.816) (-1545.128) [-1546.136] (-1544.354) -- 0:00:01
Average standard deviation of split frequencies: 0.005522
995500 -- (-1545.900) [-1543.942] (-1547.869) (-1547.353) * (-1549.035) (-1549.093) (-1546.960) [-1547.187] -- 0:00:01
996000 -- (-1548.916) (-1550.471) (-1552.000) [-1546.710] * (-1552.253) [-1543.574] (-1546.697) (-1553.646) -- 0:00:01
996500 -- (-1545.408) [-1542.670] (-1547.376) (-1547.577) * (-1551.556) (-1546.497) [-1546.237] (-1547.759) -- 0:00:01
997000 -- (-1544.402) (-1547.339) [-1548.285] (-1549.275) * (-1547.852) (-1545.215) (-1546.769) [-1544.214] -- 0:00:00
997500 -- [-1544.480] (-1551.126) (-1555.168) (-1546.207) * (-1546.587) (-1545.018) (-1548.077) [-1543.740] -- 0:00:00
998000 -- (-1544.541) [-1549.278] (-1555.176) (-1553.535) * (-1545.247) (-1561.798) (-1544.528) [-1547.899] -- 0:00:00
998500 -- [-1547.425] (-1548.913) (-1550.536) (-1545.951) * (-1543.909) (-1548.133) (-1543.395) [-1549.208] -- 0:00:00
999000 -- (-1547.176) (-1544.697) (-1542.222) [-1546.400] * [-1546.934] (-1546.755) (-1546.275) (-1549.751) -- 0:00:00
999500 -- (-1556.168) (-1544.835) [-1546.055] (-1549.521) * (-1549.018) [-1550.317] (-1550.283) (-1545.104) -- 0:00:00
1000000 -- (-1553.121) (-1545.111) [-1546.031] (-1551.697) * (-1551.612) [-1551.914] (-1542.700) (-1560.250) -- 0:00:00
Average standard deviation of split frequencies: 0.005496
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1553.121493 -- 17.345799
Chain 1 -- -1553.121493 -- 17.345799
Chain 2 -- -1545.110987 -- 15.341531
Chain 2 -- -1545.110991 -- 15.341531
Chain 3 -- -1546.031150 -- 11.717295
Chain 3 -- -1546.031147 -- 11.717295
Chain 4 -- -1551.697468 -- 17.217506
Chain 4 -- -1551.697465 -- 17.217506
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1551.612463 -- 14.563169
Chain 1 -- -1551.612449 -- 14.563169
Chain 2 -- -1551.913819 -- 16.916889
Chain 2 -- -1551.913819 -- 16.916889
Chain 3 -- -1542.699736 -- 16.629263
Chain 3 -- -1542.699735 -- 16.629263
Chain 4 -- -1560.250370 -- 14.571839
Chain 4 -- -1560.250371 -- 14.571839
Analysis completed in 5 mins 1 seconds
Analysis used 252.64 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1538.52
Likelihood of best state for "cold" chain of run 2 was -1538.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
57.4 % ( 42 %) Dirichlet(Revmat{all})
71.1 % ( 55 %) Slider(Revmat{all})
26.9 % ( 28 %) Dirichlet(Pi{all})
28.9 % ( 25 %) Slider(Pi{all})
63.5 % ( 30 %) Multiplier(Alpha{1,2})
55.4 % ( 22 %) Multiplier(Alpha{3})
79.1 % ( 62 %) Slider(Pinvar{all})
19.0 % ( 26 %) ExtSPR(Tau{all},V{all})
18.7 % ( 25 %) ExtTBR(Tau{all},V{all})
19.0 % ( 17 %) NNI(Tau{all},V{all})
23.1 % ( 25 %) ParsSPR(Tau{all},V{all})
26.1 % ( 29 %) Multiplier(V{all})
28.6 % ( 21 %) Nodeslider(V{all})
25.7 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
56.7 % ( 41 %) Dirichlet(Revmat{all})
70.5 % ( 61 %) Slider(Revmat{all})
27.2 % ( 26 %) Dirichlet(Pi{all})
28.4 % ( 23 %) Slider(Pi{all})
63.2 % ( 27 %) Multiplier(Alpha{1,2})
55.7 % ( 23 %) Multiplier(Alpha{3})
79.3 % ( 57 %) Slider(Pinvar{all})
18.8 % ( 17 %) ExtSPR(Tau{all},V{all})
18.9 % ( 24 %) ExtTBR(Tau{all},V{all})
18.9 % ( 22 %) NNI(Tau{all},V{all})
22.7 % ( 28 %) ParsSPR(Tau{all},V{all})
26.3 % ( 29 %) Multiplier(V{all})
28.6 % ( 26 %) Nodeslider(V{all})
25.7 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.54
2 | 166990 0.84 0.70
3 | 166847 167284 0.85
4 | 165981 166515 166383
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166145 0.84 0.70
3 | 166798 167317 0.86
4 | 166534 166257 166949
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1544.84
| 1 2 2 |
| 2 |
| 2 2 2 2 |
|2 1 2 2 2 1 1 2 1 1 |
| 2 1 2 112 1 2 2 2 2111 |
| 2 2 2 12 1 2 22 1 1 1 22 |
| 2 2 1 * 1 2 2 1 111 11 1 1 |
|1*1 21 * 1 1 2 22221 22 * 2 1|
| 1 1 21 1 1 2 1 2 1 2|
| 1 1 1 1 2 2 * 1 2 |
| 12 1 1 1 1 2 |
| 2 1 1 |
| 2 1 |
| 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1548.29
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1543.74 -1554.08
2 -1543.68 -1552.98
--------------------------------------
TOTAL -1543.71 -1553.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.250157 0.001197 0.189441 0.320968 0.246959 1170.14 1258.74 1.000
r(A<->C){all} 0.159595 0.001241 0.091147 0.227572 0.157355 817.37 1015.39 1.001
r(A<->G){all} 0.228062 0.002138 0.141855 0.321276 0.225068 885.27 921.95 1.000
r(A<->T){all} 0.070525 0.001087 0.014000 0.136685 0.066911 764.77 850.86 1.000
r(C<->G){all} 0.073773 0.000692 0.025632 0.125251 0.071574 877.32 956.58 1.000
r(C<->T){all} 0.395232 0.003701 0.272633 0.509524 0.394744 648.26 839.08 1.000
r(G<->T){all} 0.072812 0.001223 0.016153 0.147186 0.068441 523.13 709.31 1.000
pi(A){all} 0.324951 0.000283 0.293840 0.358855 0.325007 1212.11 1294.98 1.000
pi(C){all} 0.290552 0.000269 0.259392 0.321698 0.290335 1108.11 1156.81 1.000
pi(G){all} 0.224574 0.000239 0.196956 0.256567 0.223696 988.56 1070.10 1.000
pi(T){all} 0.159923 0.000180 0.130708 0.183115 0.160043 1095.36 1149.44 1.000
alpha{1,2} 0.245680 0.050182 0.000308 0.665567 0.189415 780.88 1024.70 1.000
alpha{3} 1.077549 0.346482 0.183840 2.193507 0.951994 1212.10 1356.55 1.000
pinvar{all} 0.219476 0.019659 0.000236 0.467780 0.203359 967.91 975.38 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
8 -- ..***
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2055 0.684544 0.006124 0.680213 0.688874 2
8 728 0.242505 0.010364 0.235177 0.249833 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.040746 0.000120 0.021569 0.062949 0.039714 1.001 2
length{all}[2] 0.019233 0.000048 0.007202 0.032876 0.018364 1.000 2
length{all}[3] 0.028398 0.000075 0.011761 0.044350 0.027504 1.000 2
length{all}[4] 0.046031 0.000171 0.024133 0.072735 0.044494 1.000 2
length{all}[5] 0.053508 0.000192 0.027682 0.080177 0.052443 1.000 2
length{all}[6] 0.055695 0.000219 0.029708 0.086065 0.053949 1.000 2
length{all}[7] 0.007083 0.000024 0.000079 0.016499 0.006026 1.000 2
length{all}[8] 0.005883 0.000025 0.000007 0.015535 0.004769 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005496
Maximum standard deviation of split frequencies = 0.010364
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------68----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/--------------------------- C1 (1)
|
| /------------------------------ C4 (4)
|------------------------------------+
+ \----------------------------------- C5 (5)
|
| /------------- C2 (2)
\---+
\------------------- C3 (3)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
120 ambiguity characters in seq. 1
102 ambiguity characters in seq. 2
108 ambiguity characters in seq. 3
102 ambiguity characters in seq. 4
63 ambiguity characters in seq. 5
44 sites are removed. 119 120 121 122 123 131 132 139 140 141 142 143 144 145 173 174 188 189 190 191 192 193 197 198 207 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248
Sequences read..
Counting site patterns.. 0:00
118 patterns at 204 / 204 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
115168 bytes for conP
16048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 87
172752 bytes for conP, adjusted
0.101217 0.095804 0.091481 0.093422 0.002861 0.051244 0.061644 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1409.024239
Iterating by ming2
Initial: fx= 1409.024239
x= 0.10122 0.09580 0.09148 0.09342 0.00286 0.05124 0.06164 0.30000 1.30000
1 h-m-p 0.0000 0.0027 268.6177 +YCYCCC 1407.389300 5 0.0001 23 | 0/9
2 h-m-p 0.0001 0.0022 185.6761 ++YYCYCCC 1386.160023 6 0.0016 46 | 0/9
3 h-m-p 0.0001 0.0006 1215.5703 YCCCC 1373.105474 4 0.0003 65 | 0/9
4 h-m-p 0.0003 0.0017 299.3195 +YCYCCC 1359.453644 5 0.0009 86 | 0/9
5 h-m-p 0.0005 0.0026 83.1844 CCCCC 1357.630318 4 0.0007 106 | 0/9
6 h-m-p 0.0008 0.0094 70.8047 +YYYC 1353.628319 3 0.0030 122 | 0/9
7 h-m-p 0.0002 0.0011 727.2567 +YYYYCCC 1331.456362 6 0.0008 143 | 0/9
8 h-m-p 0.0005 0.0023 78.2451 YCCC 1331.183416 3 0.0002 160 | 0/9
9 h-m-p 0.0007 0.0085 25.9846 CYC 1331.036517 2 0.0006 175 | 0/9
10 h-m-p 0.0965 1.1215 0.1658 +CYCCCC 1324.574067 5 0.5512 197 | 0/9
11 h-m-p 0.1515 0.7573 0.3526 CCCCC 1321.128702 4 0.2131 226 | 0/9
12 h-m-p 1.2175 6.0874 0.0451 CCYC 1319.246411 3 1.1817 252 | 0/9
13 h-m-p 1.5530 7.7648 0.0221 CC 1318.656422 1 1.5539 275 | 0/9
14 h-m-p 1.6000 8.0000 0.0178 CCCC 1318.407424 3 1.6794 302 | 0/9
15 h-m-p 0.9814 8.0000 0.0304 YC 1318.266464 1 1.8141 324 | 0/9
16 h-m-p 1.2091 8.0000 0.0456 YC 1318.127011 1 2.0819 346 | 0/9
17 h-m-p 1.6000 8.0000 0.0321 CCC 1318.064463 2 2.0520 371 | 0/9
18 h-m-p 1.6000 8.0000 0.0263 CCC 1318.040582 2 1.2747 396 | 0/9
19 h-m-p 1.6000 8.0000 0.0048 YC 1318.039793 1 1.0384 418 | 0/9
20 h-m-p 1.6000 8.0000 0.0004 C 1318.039765 0 2.0849 439 | 0/9
21 h-m-p 1.6000 8.0000 0.0003 C 1318.039758 0 1.5694 460 | 0/9
22 h-m-p 1.6000 8.0000 0.0001 Y 1318.039758 0 1.0924 481 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 Y 1318.039758 0 1.6000 502 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 C 1318.039758 0 0.4000 523 | 0/9
25 h-m-p 1.2606 8.0000 0.0000 ---------C 1318.039758 0 0.0000 553
Out..
lnL = -1318.039758
554 lfun, 554 eigenQcodon, 3878 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 87
0.101217 0.095804 0.091481 0.093422 0.002861 0.051244 0.061644 1.462898 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.382411
np = 10
lnL0 = -1336.224314
Iterating by ming2
Initial: fx= 1336.224314
x= 0.10122 0.09580 0.09148 0.09342 0.00286 0.05124 0.06164 1.46290 0.57321 0.49224
1 h-m-p 0.0000 0.0029 248.6843 +CYCCC 1335.491737 4 0.0000 23 | 0/10
2 h-m-p 0.0001 0.0027 59.8031 +CYCCC 1333.882550 4 0.0009 44 | 0/10
3 h-m-p 0.0004 0.0041 144.9854 +CYYYC 1325.075048 4 0.0028 64 | 0/10
4 h-m-p 0.0000 0.0001 1693.6125 +YCYCCC 1321.864909 5 0.0001 86 | 0/10
5 h-m-p 0.0018 0.0089 12.7792 YC 1321.788378 1 0.0009 100 | 0/10
6 h-m-p 0.0002 0.0023 53.3165 +YCC 1321.586689 2 0.0006 117 | 0/10
7 h-m-p 0.0031 0.0601 10.7149 YCC 1321.481798 2 0.0022 133 | 0/10
8 h-m-p 0.0007 0.0733 33.5874 ++YCCCC 1317.480131 4 0.0270 155 | 0/10
9 h-m-p 0.0016 0.0080 92.6100 CCCCC 1316.573640 4 0.0022 176 | 0/10
10 h-m-p 0.0978 0.4888 0.5515 YCC 1316.155060 2 0.0586 192 | 0/10
11 h-m-p 0.0026 0.0417 12.5075 +CYCCCCC 1309.640119 6 0.0163 227 | 0/10
12 h-m-p 0.1342 0.7848 1.5191 +YYCCC 1305.851666 4 0.4923 247 | 0/10
13 h-m-p 0.4514 2.2569 0.7943 CCCCC 1303.635717 4 0.5395 268 | 0/10
14 h-m-p 1.6000 8.0000 0.0460 YYC 1303.289010 2 1.2965 293 | 0/10
15 h-m-p 1.6000 8.0000 0.0207 CC 1303.230243 1 1.4611 318 | 0/10
16 h-m-p 1.6000 8.0000 0.0075 YC 1303.224032 1 0.7199 342 | 0/10
17 h-m-p 0.2945 8.0000 0.0183 YC 1303.223168 1 0.6211 366 | 0/10
18 h-m-p 1.6000 8.0000 0.0026 C 1303.223073 0 0.6205 389 | 0/10
19 h-m-p 1.6000 8.0000 0.0002 Y 1303.223064 0 1.2487 412 | 0/10
20 h-m-p 1.1660 8.0000 0.0002 C 1303.223058 0 1.5485 435 | 0/10
21 h-m-p 1.6000 8.0000 0.0001 C 1303.223057 0 1.3027 458 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1303.223057 0 1.2491 481 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 C 1303.223057 0 1.5319 504 | 0/10
24 h-m-p 1.2833 8.0000 0.0000 Y 1303.223057 0 1.2833 527 | 0/10
25 h-m-p 1.6000 8.0000 0.0000 Y 1303.223057 0 0.4000 550 | 0/10
26 h-m-p 0.1667 8.0000 0.0000 -Y 1303.223057 0 0.0104 574
Out..
lnL = -1303.223057
575 lfun, 1725 eigenQcodon, 8050 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 87
initial w for M2:NSpselection reset.
0.101217 0.095804 0.091481 0.093422 0.002861 0.051244 0.061644 1.391664 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.098491
np = 12
lnL0 = -1341.223604
Iterating by ming2
Initial: fx= 1341.223604
x= 0.10122 0.09580 0.09148 0.09342 0.00286 0.05124 0.06164 1.39166 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0101 238.2282 +CC 1340.458540 1 0.0000 20 | 0/12
2 h-m-p 0.0002 0.0065 66.0280 +YYCCC 1338.725538 4 0.0010 42 | 0/12
3 h-m-p 0.0008 0.0065 75.4658 ++ 1321.009797 m 0.0065 57 | 1/12
4 h-m-p 0.0037 0.0198 64.4878 CCC 1318.953826 2 0.0043 76 | 1/12
5 h-m-p 0.0021 0.0105 100.3774 CCCCC 1316.501872 4 0.0033 99 | 1/12
6 h-m-p 0.0033 0.0164 18.3907 YC 1316.357424 1 0.0014 115 | 1/12
7 h-m-p 0.0021 0.0944 11.8119 ++YCCC 1314.685135 3 0.0223 137 | 1/12
8 h-m-p 0.0010 0.0048 195.7554 CYCCCC 1312.617335 5 0.0015 161 | 1/12
9 h-m-p 0.0016 0.0080 101.0480 CYCCCC 1310.571357 5 0.0029 185 | 1/12
10 h-m-p 0.0354 0.1772 3.0513 CCCCC 1309.044254 4 0.0462 208 | 1/12
11 h-m-p 0.1154 3.3599 1.2220 +YCCC 1305.313278 3 0.8380 229 | 0/12
12 h-m-p 0.0036 0.0179 174.4613 CYC 1304.977922 2 0.0010 247 | 0/12
13 h-m-p 0.1191 2.8712 1.4721 +CYCCCC 1302.716989 5 0.9129 272 | 0/12
14 h-m-p 1.1308 5.6538 0.4582 CCCC 1301.439214 3 1.2057 293 | 0/12
15 h-m-p 1.1151 5.5755 0.3324 YCC 1301.208007 2 0.7408 323 | 0/12
16 h-m-p 0.5012 8.0000 0.4914 YCCC 1301.029786 3 0.9145 355 | 0/12
17 h-m-p 0.8482 8.0000 0.5298 CCC 1300.896461 2 1.0970 386 | 0/12
18 h-m-p 1.1912 5.9559 0.4375 YC 1300.828228 1 0.7188 414 | 0/12
19 h-m-p 0.4140 8.0000 0.7596 +CCC 1300.661061 2 1.6725 446 | 0/12
20 h-m-p 1.4835 7.4176 0.7232 YCCC 1300.591648 3 0.8739 478 | 0/12
21 h-m-p 1.6000 8.0000 0.2013 YC 1300.572802 1 0.8683 506 | 0/12
22 h-m-p 0.9199 8.0000 0.1900 YC 1300.562171 1 1.9980 534 | 0/12
23 h-m-p 1.6000 8.0000 0.1537 CC 1300.556938 1 1.8161 563 | 0/12
24 h-m-p 1.6000 8.0000 0.0483 CC 1300.554704 1 1.4259 592 | 0/12
25 h-m-p 1.6000 8.0000 0.0295 CC 1300.554104 1 1.3844 621 | 0/12
26 h-m-p 1.6000 8.0000 0.0173 C 1300.554057 0 1.3105 648 | 0/12
27 h-m-p 1.6000 8.0000 0.0015 C 1300.554052 0 1.3034 675 | 0/12
28 h-m-p 0.9217 8.0000 0.0021 C 1300.554051 0 1.3531 702 | 0/12
29 h-m-p 1.6000 8.0000 0.0002 Y 1300.554051 0 0.9806 729 | 0/12
30 h-m-p 1.6000 8.0000 0.0000 Y 1300.554051 0 0.4000 756 | 0/12
31 h-m-p 0.5339 8.0000 0.0000 ------C 1300.554051 0 0.0000 789
Out..
lnL = -1300.554051
790 lfun, 3160 eigenQcodon, 16590 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1308.506631 S = -1234.822651 -66.913396
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 118 patterns 0:12
did 20 / 118 patterns 0:12
did 30 / 118 patterns 0:12
did 40 / 118 patterns 0:13
did 50 / 118 patterns 0:13
did 60 / 118 patterns 0:13
did 70 / 118 patterns 0:13
did 80 / 118 patterns 0:13
did 90 / 118 patterns 0:13
did 100 / 118 patterns 0:13
did 110 / 118 patterns 0:13
did 118 / 118 patterns 0:13
Time used: 0:13
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 87
0.101217 0.095804 0.091481 0.093422 0.002861 0.051244 0.061644 1.414747 0.331355 0.382499 0.096135 0.239994 0.401842
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.138188
np = 13
lnL0 = -1315.871849
Iterating by ming2
Initial: fx= 1315.871849
x= 0.10122 0.09580 0.09148 0.09342 0.00286 0.05124 0.06164 1.41475 0.33136 0.38250 0.09614 0.23999 0.40184
1 h-m-p 0.0000 0.0030 222.8360 +CCC 1315.181400 2 0.0000 23 | 0/13
2 h-m-p 0.0002 0.0028 55.9823 +CCCCC 1313.932620 4 0.0008 48 | 0/13
3 h-m-p 0.0002 0.0008 103.5954 ++ 1311.412240 m 0.0008 64 | 1/13
4 h-m-p 0.0008 0.0038 60.4400 +YCCC 1308.531888 3 0.0034 86 | 1/13
5 h-m-p 0.0000 0.0002 134.9774 ++ 1308.224231 m 0.0002 102 | 1/13
6 h-m-p 0.0000 0.0000 15.8927
h-m-p: 8.87653522e-20 4.43826761e-19 1.58927375e+01 1308.224231
.. | 1/13
7 h-m-p 0.0000 0.0008 63.9436 +++CYC 1306.605587 2 0.0007 137 | 1/13
8 h-m-p 0.0001 0.0004 494.8485 YYC 1305.711779 2 0.0001 155 | 1/13
9 h-m-p 0.0001 0.0007 24.0310 +CC 1305.590016 1 0.0005 174 | 1/13
10 h-m-p 0.0000 0.0001 25.4010 ++ 1305.550970 m 0.0001 190 | 2/13
11 h-m-p 0.0001 0.0250 47.0971 +++CYC 1304.666110 2 0.0035 212 | 2/13
12 h-m-p 0.0038 0.0192 29.6944 YCCC 1304.589220 3 0.0005 233 | 2/13
13 h-m-p 0.0042 0.0400 3.8992 YC 1304.584362 1 0.0007 250 | 2/13
14 h-m-p 0.0026 1.3021 2.2025 +++YC 1304.313968 1 0.1079 270 | 2/13
15 h-m-p 0.0038 0.0614 62.9906 CCC 1304.253274 2 0.0009 290 | 2/13
16 h-m-p 0.0527 1.1184 1.0572 +YCC 1304.097140 2 0.1520 310 | 1/13
17 h-m-p 0.0033 0.0222 48.2296 YCCC 1303.950303 3 0.0019 331 | 1/13
18 h-m-p 0.1033 2.3100 0.9092 +YYCC 1303.585938 3 0.3363 352 | 1/13
19 h-m-p 0.4539 4.5203 0.6737 CCC 1303.223328 2 0.3875 384 | 0/13
20 h-m-p 0.2727 8.0000 0.9573 --C 1303.220946 0 0.0046 414 | 0/13
21 h-m-p 0.0043 1.5635 1.0291 ++++CCC 1302.327907 2 1.1927 451 | 0/13
22 h-m-p 0.0216 0.1081 0.8015 ++ 1302.254078 m 0.1081 467 | 1/13
23 h-m-p 0.0239 3.8421 3.6299 +YCCCC 1301.972805 4 0.2082 504 | 1/13
24 h-m-p 1.6000 8.0000 0.3524 CCYC 1301.767158 3 1.5645 525 | 1/13
25 h-m-p 1.2518 8.0000 0.4405 CCCC 1301.603078 3 1.6382 559 | 1/13
26 h-m-p 1.4791 8.0000 0.4879 CC 1301.350949 1 1.4861 589 | 1/13
27 h-m-p 1.6000 8.0000 0.2119 +YC 1300.912686 1 4.1377 619 | 1/13
28 h-m-p 1.2334 8.0000 0.7109 YCCC 1300.680928 3 0.8021 652 | 1/13
29 h-m-p 0.8972 8.0000 0.6356 YC 1300.444307 1 1.8115 681 | 1/13
30 h-m-p 1.6000 8.0000 0.3621 C 1300.357084 0 1.6627 709 | 1/13
31 h-m-p 1.6000 8.0000 0.2702 YCC 1300.343772 2 1.1297 740 | 1/13
32 h-m-p 1.6000 8.0000 0.0537 YC 1300.341484 1 1.1513 769 | 1/13
33 h-m-p 1.6000 8.0000 0.0307 YC 1300.341090 1 1.1720 798 | 1/13
34 h-m-p 1.6000 8.0000 0.0037 C 1300.340905 0 2.1289 826 | 1/13
35 h-m-p 1.6000 8.0000 0.0013 ++ 1300.339887 m 8.0000 854 | 1/13
36 h-m-p 0.2828 8.0000 0.0355 +CC 1300.338169 1 1.4509 885 | 1/13
37 h-m-p 1.6000 8.0000 0.0202 CC 1300.337642 1 2.1544 915 | 1/13
38 h-m-p 1.6000 8.0000 0.0110 C 1300.337611 0 1.4690 943 | 1/13
39 h-m-p 1.6000 8.0000 0.0008 Y 1300.337611 0 1.0228 971 | 1/13
40 h-m-p 1.6000 8.0000 0.0001 Y 1300.337611 0 1.1917 999 | 1/13
41 h-m-p 1.6000 8.0000 0.0000 C 1300.337611 0 0.4000 1027 | 1/13
42 h-m-p 0.7236 8.0000 0.0000 ----C 1300.337611 0 0.0007 1059
Out..
lnL = -1300.337611
1060 lfun, 4240 eigenQcodon, 22260 P(t)
Time used: 0:21
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 87
0.101217 0.095804 0.091481 0.093422 0.002861 0.051244 0.061644 1.394776 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.859961
np = 10
lnL0 = -1313.696649
Iterating by ming2
Initial: fx= 1313.696649
x= 0.10122 0.09580 0.09148 0.09342 0.00286 0.05124 0.06164 1.39478 0.66567 1.54913
1 h-m-p 0.0000 0.0042 196.7564 +CYYC 1313.096654 3 0.0000 20 | 0/10
2 h-m-p 0.0002 0.0037 46.9730 +YCY 1312.518988 2 0.0006 37 | 0/10
3 h-m-p 0.0009 0.0255 30.9018 YCCC 1312.013068 3 0.0015 55 | 0/10
4 h-m-p 0.0005 0.0070 89.8875 +YYYYCCCCC 1309.638617 8 0.0023 81 | 0/10
5 h-m-p 0.0002 0.0011 389.3326 CYCCCC 1308.024978 5 0.0004 103 | 0/10
6 h-m-p 0.0026 0.0130 9.8125 C 1307.996843 0 0.0006 116 | 0/10
7 h-m-p 0.0040 0.0767 1.6074 CC 1307.993673 1 0.0013 131 | 0/10
8 h-m-p 0.0023 0.3373 0.9249 YC 1307.983387 1 0.0043 145 | 0/10
9 h-m-p 0.0038 0.4314 1.0343 ++CCCC 1307.014327 3 0.0747 176 | 0/10
10 h-m-p 0.0221 0.3422 3.4962 +YYYYYCYCYC 1305.996508 10 0.1448 202 | 0/10
11 h-m-p 0.0479 0.2397 4.0223 CYCYC 1305.493662 4 0.0930 222 | 0/10
12 h-m-p 0.0662 0.3310 2.4972 +YYYYYYYYCY 1303.788417 10 0.2980 247 | 0/10
13 h-m-p 0.0221 0.1104 0.9332 CCCC 1303.778585 3 0.0074 266 | 0/10
14 h-m-p 0.0208 8.0000 0.3328 ++YCCC 1303.532344 3 0.4997 296 | 0/10
15 h-m-p 0.4568 2.2842 0.0762 YYCYYC 1303.482643 5 0.9373 326 | 0/10
16 h-m-p 0.3379 1.6893 0.0666 YYYYCCCYC 1303.471566 8 0.4258 360 | 0/10
17 h-m-p 0.6694 8.0000 0.0424 YC 1303.457689 1 1.1145 384 | 0/10
18 h-m-p 1.6000 8.0000 0.0025 CY 1303.456497 1 1.9925 409 | 0/10
19 h-m-p 0.3064 3.8692 0.0160 YY 1303.456265 1 0.1918 433 | 0/10
20 h-m-p 0.5522 8.0000 0.0056 CYC 1303.455876 2 1.0092 459 | 0/10
21 h-m-p 1.4658 8.0000 0.0038 CYC 1303.455611 2 0.9560 485 | 0/10
22 h-m-p 0.3795 4.4954 0.0097 Y 1303.455556 0 0.3795 508 | 0/10
23 h-m-p 0.1993 2.1317 0.0184 Y 1303.455551 0 0.0498 531 | 0/10
24 h-m-p 0.0510 2.1090 0.0180 C 1303.455538 0 0.0715 554 | 0/10
25 h-m-p 0.0518 1.4687 0.0248 Y 1303.455530 0 0.0364 577 | 0/10
26 h-m-p 0.0290 1.1373 0.0311 C 1303.455524 0 0.0290 600 | 0/10
27 h-m-p 0.0233 0.8851 0.0387 Y 1303.455521 0 0.0162 623 | 0/10
28 h-m-p 0.0127 0.6830 0.0491 C 1303.455518 0 0.0127 646 | 0/10
29 h-m-p 0.0100 0.5253 0.0626 Y 1303.455517 0 0.0058 669 | 0/10
30 h-m-p 0.0045 0.3990 0.0813 C 1303.455516 0 0.0040 692 | 0/10
31 h-m-p 0.0029 0.2869 0.1117 Y 1303.455516 0 0.0020 715 | 0/10
32 h-m-p 0.0015 0.2046 0.1554 C 1303.455516 0 0.0012 738 | 0/10
33 h-m-p 0.0009 0.1408 0.2244 Y 1303.455515 0 0.0006 761 | 0/10
34 h-m-p 0.0004 0.0960 0.3273 C 1303.455515 0 0.0003 784 | 0/10
35 h-m-p 0.0002 0.0623 0.5029 Y 1303.455515 0 0.0001 807 | 0/10
36 h-m-p 0.0001 0.0431 0.7244 C 1303.455515 0 0.0001 830 | 0/10
37 h-m-p 0.0000 0.0203 1.5344 Y 1303.455515 0 0.0000 853 | 0/10
38 h-m-p 0.0541 8.0000 0.0005 ++YC 1303.455424 1 0.5909 869 | 0/10
39 h-m-p 1.6000 8.0000 0.0001 Y 1303.455411 0 1.1954 892 | 0/10
40 h-m-p 1.2185 8.0000 0.0001 C 1303.455409 0 1.0557 915 | 0/10
41 h-m-p 0.2441 8.0000 0.0005 C 1303.455409 0 0.2070 938 | 0/10
42 h-m-p 0.0902 8.0000 0.0011 C 1303.455408 0 0.0902 961 | 0/10
43 h-m-p 0.0473 8.0000 0.0020 C 1303.455408 0 0.0491 984 | 0/10
44 h-m-p 0.0285 8.0000 0.0035 C 1303.455408 0 0.0301 1007 | 0/10
45 h-m-p 0.0185 5.7997 0.0057 C 1303.455408 0 0.0184 1030 | 0/10
46 h-m-p 0.0116 3.5879 0.0090 C 1303.455407 0 0.0109 1053 | 0/10
47 h-m-p 0.0069 2.2394 0.0141 C 1303.455407 0 0.0062 1076 | 0/10
48 h-m-p 0.0038 1.3622 0.0230 C 1303.455407 0 0.0033 1099 | 0/10
49 h-m-p 0.0019 0.7771 0.0400 C 1303.455407 0 0.0016 1122 | 0/10
50 h-m-p 0.0008 0.3834 0.0806 Y 1303.455407 0 0.0006 1145 | 0/10
51 h-m-p 0.0003 0.1310 0.2353 Y 1303.455407 0 0.0001 1168 | 0/10
52 h-m-p 0.0000 0.0047 6.4882 -Y 1303.455407 0 0.0000 1192 | 0/10
53 h-m-p 0.0744 8.0000 0.0001 ++Y 1303.455403 0 2.3714 1207 | 0/10
54 h-m-p 1.6000 8.0000 0.0000 ++ 1303.455389 m 8.0000 1230 | 0/10
55 h-m-p 0.7284 8.0000 0.0002 Y 1303.455373 0 1.4562 1253 | 0/10
56 h-m-p 1.3761 8.0000 0.0002 Y 1303.455372 0 0.6162 1276 | 0/10
57 h-m-p 1.0201 8.0000 0.0001 Y 1303.455372 0 0.1472 1299 | 0/10
58 h-m-p 0.1112 8.0000 0.0002 Y 1303.455372 0 0.0153 1322 | 0/10
59 h-m-p 0.0160 8.0000 0.0003 C 1303.455372 0 0.0041 1345 | 0/10
60 h-m-p 0.0160 8.0000 0.0004 C 1303.455372 0 0.0040 1368 | 0/10
61 h-m-p 0.0160 8.0000 0.0004 Y 1303.455372 0 0.0023 1391 | 0/10
62 h-m-p 0.0160 8.0000 0.0005 Y 1303.455372 0 0.0020 1414 | 0/10
63 h-m-p 0.0160 8.0000 0.0006 --Y 1303.455372 0 0.0003 1439 | 0/10
64 h-m-p 0.0160 8.0000 0.0005 C 1303.455372 0 0.0051 1462 | 0/10
65 h-m-p 0.0160 8.0000 0.0008 -C 1303.455372 0 0.0010 1486 | 0/10
66 h-m-p 0.0160 8.0000 0.0010 -C 1303.455372 0 0.0010 1510 | 0/10
67 h-m-p 0.0160 8.0000 0.0010 -------------.. | 0/10
68 h-m-p 0.0002 0.0985 0.5904 --C 1303.455371 0 0.0000 1569 | 0/10
69 h-m-p 0.0002 0.0985 0.1911 Y 1303.455370 0 0.0001 1592 | 0/10
70 h-m-p 0.0001 0.0461 0.6812 C 1303.455369 0 0.0001 1615 | 0/10
71 h-m-p 0.0000 0.0144 2.0892 +C 1303.455368 0 0.0001 1639 | 0/10
72 h-m-p 0.0043 0.9855 0.0633 -C 1303.455368 0 0.0003 1653 | 0/10
73 h-m-p 0.0019 0.9656 0.0894 -------Y 1303.455368 0 0.0000 1683 | 0/10
74 h-m-p 0.0160 8.0000 0.0047 -Y 1303.455368 0 0.0007 1707 | 0/10
75 h-m-p 0.0160 8.0000 0.0096 ---C 1303.455368 0 0.0001 1733 | 0/10
76 h-m-p 0.0160 8.0000 0.0106 -------------.. | 0/10
77 h-m-p 0.0000 0.0105 0.7208 --Y 1303.455368 0 0.0000 1792 | 0/10
78 h-m-p 0.0004 0.1842 0.1634 C 1303.455368 0 0.0005 1815 | 0/10
79 h-m-p 0.0000 0.0038 7.8011 C 1303.455367 0 0.0000 1838 | 0/10
80 h-m-p 0.0016 0.2217 0.0617 -C 1303.455367 0 0.0001 1852 | 0/10
81 h-m-p 0.0031 1.5478 0.0229 ------Y 1303.455367 0 0.0000 1881 | 0/10
82 h-m-p 0.0160 8.0000 0.0032 --C 1303.455367 0 0.0003 1906 | 0/10
83 h-m-p 0.0160 8.0000 0.0039 --Y 1303.455367 0 0.0005 1931 | 0/10
84 h-m-p 0.0160 8.0000 0.0048 -------Y 1303.455367 0 0.0000 1961 | 0/10
85 h-m-p 0.0160 8.0000 0.0012 -----Y 1303.455367 0 0.0000 1989 | 0/10
86 h-m-p 0.0160 8.0000 0.0024 -------------.. | 0/10
87 h-m-p 0.0000 0.0110 0.6792 ---Y 1303.455367 0 0.0000 2049 | 0/10
88 h-m-p 0.0004 0.1786 0.1693 Y 1303.455367 0 0.0002 2072 | 0/10
89 h-m-p 0.0000 0.0071 4.1536 Y 1303.455367 0 0.0000 2095 | 0/10
90 h-m-p 0.0030 1.4974 0.0527 -C 1303.455367 0 0.0002 2109 | 0/10
91 h-m-p 0.0095 4.7529 0.0324 ---Y 1303.455367 0 0.0000 2135 | 0/10
92 h-m-p 0.0160 8.0000 0.0080 --C 1303.455367 0 0.0002 2160 | 0/10
93 h-m-p 0.0160 8.0000 0.0059 ------C 1303.455367 0 0.0000 2189 | 0/10
94 h-m-p 0.0160 8.0000 0.0019 ----------C 1303.455367 0 0.0000 2222 | 0/10
95 h-m-p 0.0013 0.6726 0.2758 -----------.. | 0/10
96 h-m-p 0.0000 0.0108 0.6913 ----C 1303.455367 0 0.0000 2281 | 0/10
97 h-m-p 0.0003 0.1720 0.1727 C 1303.455366 0 0.0001 2304 | 0/10
98 h-m-p 0.0000 0.0093 3.1343 ++C 1303.455364 0 0.0003 2329 | 0/10
99 h-m-p 0.0177 1.8638 0.0527 --C 1303.455364 0 0.0004 2344 | 0/10
100 h-m-p 0.0000 0.0095 10.4923 -----Y 1303.455364 0 0.0000 2372 | 0/10
101 h-m-p 0.0160 8.0000 0.0064 -C 1303.455364 0 0.0010 2386 | 0/10
102 h-m-p 0.0160 8.0000 0.0015 -C 1303.455364 0 0.0008 2410 | 0/10
103 h-m-p 0.0160 8.0000 0.0006 Y 1303.455364 0 0.0023 2433 | 0/10
104 h-m-p 0.0160 8.0000 0.0015 C 1303.455364 0 0.0219 2456 | 0/10
105 h-m-p 0.0160 8.0000 0.0340 C 1303.455363 0 0.0037 2479 | 0/10
106 h-m-p 0.0283 8.0000 0.0044 -Y 1303.455363 0 0.0009 2503 | 0/10
107 h-m-p 0.0160 8.0000 0.0008 +Y 1303.455363 0 0.1440 2527 | 0/10
108 h-m-p 1.6000 8.0000 0.0000 ------Y 1303.455363 0 0.0001 2556
Out..
lnL = -1303.455363
2557 lfun, 28127 eigenQcodon, 178990 P(t)
Time used: 1:25
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 87
initial w for M8:NSbetaw>1 reset.
0.101217 0.095804 0.091481 0.093422 0.002861 0.051244 0.061644 1.488249 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.034053
np = 12
lnL0 = -1309.736539
Iterating by ming2
Initial: fx= 1309.736539
x= 0.10122 0.09580 0.09148 0.09342 0.00286 0.05124 0.06164 1.48825 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0015 190.5921 +YCYCC 1308.796131 4 0.0001 24 | 0/12
2 h-m-p 0.0001 0.0012 105.8615 +CYCCC 1305.633573 4 0.0007 47 | 0/12
3 h-m-p 0.0003 0.0016 45.6279 YCYCCC 1304.858067 5 0.0008 70 | 0/12
4 h-m-p 0.0009 0.0092 39.6833 +YYYYC 1302.939435 4 0.0035 90 | 0/12
5 h-m-p 0.0006 0.0029 82.2455 YYYC 1302.461651 3 0.0006 108 | 0/12
6 h-m-p 0.0012 0.0061 11.0763 CCC 1302.443514 2 0.0004 127 | 0/12
7 h-m-p 0.0009 0.0362 4.5930 CC 1302.436093 1 0.0008 144 | 0/12
8 h-m-p 0.0016 0.5718 2.2521 ++CCC 1302.371501 2 0.0226 165 | 0/12
9 h-m-p 0.0008 0.0680 61.6907 +YCCC 1302.000488 3 0.0050 186 | 0/12
10 h-m-p 0.0020 0.0167 158.1410 YCCC 1301.743031 3 0.0013 206 | 0/12
11 h-m-p 0.1498 1.6461 1.3984 CCCC 1301.507905 3 0.2294 227 | 0/12
12 h-m-p 0.2768 3.4622 1.1587 +YCCC 1301.057084 3 0.6941 248 | 0/12
13 h-m-p 0.5077 2.5384 0.5003 CYCCC 1300.853083 4 0.8422 270 | 0/12
14 h-m-p 1.6000 8.0000 0.2030 YCC 1300.785774 2 1.0827 300 | 0/12
15 h-m-p 0.5143 7.6247 0.4273 +YYCC 1300.700584 3 1.5342 332 | 0/12
16 h-m-p 1.5886 8.0000 0.4127 YCC 1300.636357 2 0.9124 362 | 0/12
17 h-m-p 0.6191 4.4578 0.6082 YCYCCC 1300.515091 5 1.6803 397 | 0/12
18 h-m-p 0.4310 2.1552 0.5314 YCCCCC 1300.444727 5 0.6020 433 | 0/12
19 h-m-p 1.0578 5.2892 0.2610 YYC 1300.425340 2 0.7750 462 | 0/12
20 h-m-p 0.8980 7.4309 0.2252 CCC 1300.419621 2 0.3095 493 | 0/12
21 h-m-p 1.6000 8.0000 0.0203 YC 1300.419307 1 1.1396 521 | 0/12
22 h-m-p 1.6000 8.0000 0.0078 C 1300.419276 0 1.7796 548 | 0/12
23 h-m-p 1.2282 8.0000 0.0114 C 1300.419254 0 1.3178 575 | 0/12
24 h-m-p 1.6000 8.0000 0.0065 C 1300.419246 0 1.4057 602 | 0/12
25 h-m-p 1.6000 8.0000 0.0006 Y 1300.419246 0 0.9681 629 | 0/12
26 h-m-p 1.4892 8.0000 0.0004 Y 1300.419246 0 0.8457 656 | 0/12
27 h-m-p 1.6000 8.0000 0.0000 Y 1300.419246 0 0.9245 683 | 0/12
28 h-m-p 1.6000 8.0000 0.0000 C 1300.419246 0 1.6000 710 | 0/12
29 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/12
30 h-m-p 0.0160 8.0000 0.0003 ------------- | 0/12
31 h-m-p 0.0160 8.0000 0.0003 -------------
Out..
lnL = -1300.419246
828 lfun, 9936 eigenQcodon, 63756 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1307.470127 S = -1234.958170 -66.514482
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 118 patterns 1:49
did 20 / 118 patterns 1:49
did 30 / 118 patterns 1:49
did 40 / 118 patterns 1:49
did 50 / 118 patterns 1:49
did 60 / 118 patterns 1:50
did 70 / 118 patterns 1:50
did 80 / 118 patterns 1:50
did 90 / 118 patterns 1:50
did 100 / 118 patterns 1:50
did 110 / 118 patterns 1:50
did 118 / 118 patterns 1:51
Time used: 1:51
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=248
D_melanogaster_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
D_yakuba_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
D_erecta_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
D_ficusphila_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
D_rhopaloa_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
**************************************************
D_melanogaster_dlg1-PI DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
D_yakuba_dlg1-PI DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
D_erecta_dlg1-PI DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
D_ficusphila_dlg1-PI DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
D_rhopaloa_dlg1-PI DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
**************************************************
D_melanogaster_dlg1-PI DTENAKEPTVEQQQKQQQ--AQQRSSRSPQ--QQNPQQ------QQGSKS
D_yakuba_dlg1-PI DTENAKEPTAEQQQQQQQQQAQQRSSRSPQ--QQNPQQPQ----QQGSKS
D_erecta_dlg1-PI DTENAKEPTAEQQQQAQQ-----RSSRSPQ--QQNSQQPQPQQQQQGSKS
D_ficusphila_dlg1-PI DTENAKEPLAEQQQQQQQ-----RSSRSPQQLQQNPQQAQQQ---QGSKS
D_rhopaloa_dlg1-PI DTENAKEPSAEQQQQQQQQ-QQQRSSRSPQQLQQNPQQQQQQSQSQGSKS
******** .****: ** ******* ***.** *****
D_melanogaster_dlg1-PI RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQH--QS
D_yakuba_dlg1-PI RSGSQTSQIQIQSLTQTYPNAP--QRKRVLVSLHPHP------HQHPHQS
D_erecta_dlg1-PI RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQS--QH
D_ficusphila_dlg1-PI RSGSQTSQIQTQSLTQIPKHTH--QRKRVLVSLHQHQ----HQHEHQSQR
D_rhopaloa_dlg1-PI RSGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQY
********** :**** : ****:***** * *: *
D_melanogaster_dlg1-PI QIQHQH-HYQLRHNNGIQAKMLKRAFESTooooooooooooooooooo
D_yakuba_dlg1-PI QHQQQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
D_erecta_dlg1-PI QHQQQHQHYQLRLNNGNQAKMLKRAFESTooooooooooooooo----
D_ficusphila_dlg1-PI QHQHQH-HYQLRLNNGNQAKMLKRAFESTooooooooooooo------
D_rhopaloa_dlg1-PI QHQYQH-HYQLRLNSGNQAKKLKRAFEST-------------------
* * ** ***** *.* *** ********
>D_melanogaster_dlg1-PI ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA CTACCACGCGAGACTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAA TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT ACAACAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAAAAGG ATGGCCAGGCAGTCAAAATAGCTGATAATCAGCGCATGCGCATCGAATCG GACACGGAAAATGCCAAGGAGCCAACTGTCGAGCAGCAGCAAAAGCAGCA GCAA------GCGCAGCAGCGCAGTTCCCGCTCCCCGCAG------CAGC AGAATCCGCAGCAG------------------CAGCAGGGATCCAAATCG AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTTACACAGAC ATACCCAAACGCACAC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC ATCCACATCAA------------------CATCAACAT------CAAAGC CAAATTCAACACCAACAC---CATTACCAACTTCGCCATAACAACGGCAT TCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACC------------- -------------------------------------------- >D_yakuba_dlg1-PI ATGCCAGTGAAAAAGCAAGAAGCTCATCGCGCTCTCGAGCTGCTCGAGGA CTACCACGCGAGGCTTTCTGAGCCGCAGGATCGGGCGCTGCGTATTGCAA TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA GATATACAAGAATTCTATGAATTGACCTTATTGGATGACTCGAAGAGCAT ACAACAAAAGACAGCCGAGACCTTGCAGATTGCAACCAAATGGGAGAAGG ACGGACAGGCAGTCAAAATAGCCGATAATCAGCGCATGCGCATCGAATCG GATACGGAAAATGCCAAGGAGCCAACGGCCGAGCAGCAACAACAGCAGCA GCAGCAGCAGGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG------CAGC AGAATCCGCAGCAGCCGCAG------------CAGCAGGGATCCAAATCA AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTCACACAGAC ATACCCAAACGCACCC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC ATCCACATCCA------------------CATCAACATCCACATCAAAGC CAACACCAACAACAACAC---CATTACCAACTTCGCCTTAACAACGGCAA TCAAGCCAAAATGCTCAAGCGCGCTTTCGAGTCCACC------------- -------------------------------------------- >D_erecta_dlg1-PI ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA CTACCACGCGAGACTTTCTGAGCCGCAGGATCGGGCGTTGCGCATTGCAA TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT ACAACAAAAGACAGCCGAAACCTTGCAAATTGCAACCAAATGGGAGAAGG ACGGACAGGCAGTCAAAATAGCCGATAATCAGCGCATGCGCATCGAATCG GATACGGAAAATGCCAAGGAGCCAACGGCCGAGCAGCAGCAGCAGGCGCA GCAG---------------CGCAGTTCCCGCTCCCCGCAG------CAGC AGAATTCGCAGCAGCCGCAGCCGCAGCAGCAGCAGCAGGGATCCAAATCT AGGAGCGGGTCCCAGACTTCACAGATACAGATACAGTCACTCACACAGAC ATACCCAAACGCACAC------CAGCGCAAGCGAGTCCTCGTGAGCCTCC ATCCACATCAA------------------CATCAAAGC------CAACAT CAACACCAACAACAACACCAACATTACCAACTTCGCCTTAACAACGGCAA TCAAGCCAAAATGCTTAAGCGCGCTTTCGAGTCCACC------------- -------------------------------------------- >D_ficusphila_dlg1-PI ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA CTATCACGCCAGACTTTCTGAGCCACAGGATCGGGCGCTGCGTATTGCAA TCGAACGCGTTATACGCATATTTAAGTCTCGCTTGTTTCAAGCGCTTTTA GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT ACAGCAAAAGACAGCGGAAACCTTGCAAATTGCAACCAAATGGGAGAAGG ACGGACAGGCCGTTAAAATTGCCGATAATCAGCGCATGCGCATCGAGTCG GATACGGAAAATGCGAAGGAGCCGCTGGCCGAGCAGCAGCAGCAGCAGCA GCAG---------------CGCAGTTCCCGCTCACCGCAGCAGTTGCAGC AGAATCCGCAGCAGGCGCAACAGCAG---------CAGGGATCCAAGTCG CGGAGCGGGTCGCAGACCTCACAGATACAGACACAGTCACTCACACAGAT ACCCAAGCACACACAC------CAGCGCAAGCGAGTCCTCGTAAGCCTCC ATCAACATCAA------------CATCAACATGAACATCAAAGCCAACGC CAACACCAACACCAACAC---CATTACCAACTTCGCCTTAACAACGGCAA TCAAGCCAAAATGCTAAAGCGCGCTTTCGAGTCCACC------------- -------------------------------------------- >D_rhopaloa_dlg1-PI ATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGA CTATCATGCGAGGCTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAA TCGAACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTA GATATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCAT ACAGCAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAGAAGG ACGGACAGGCCGTTAAGATTGCCGATAATCAGCGCATGCGCATCGAGTCG GATACGGAAAATGCGAAGGAGCCGTCGGCCGAGCAGCAGCAGCAGCAGCA GCAGCAG---CAGCAGCAGCGCAGTTCCCGCTCCCCGCAGCAGCTGCAGC AGAATCCGCAGCAGCAGCAGCAGCAATCGCAGTCGCAGGGATCCAAGTCA AGGAGCGGGTCGCAGACTTCACAGATACAGATAGAGTCACTCACACAGAT ACACCAACACCAACACGCACAGCAACGCAAGCGAATCCTCGTAAGCCTCC ATCAACATCAAAATCAACATCAAAGCCAACATCAACACCAACACCAATAC CAACATCAATACCAACAC---CATTACCAACTTCGCCTTAACAGCGGCAA TCAAGCTAAAAAGCTAAAGCGTGCTTTCGAGTCAACC------------- --------------------------------------------
>D_melanogaster_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES DTENAKEPTVEQQQKQQQ--AQQRSSRSPQ--QQNPQQ------QQGSKS RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQH--QS QIQHQH-HYQLRHNNGIQAKMLKRAFEST >D_yakuba_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES DTENAKEPTAEQQQQQQQQQAQQRSSRSPQ--QQNPQQPQ----QQGSKS RSGSQTSQIQIQSLTQTYPNAP--QRKRVLVSLHPHP------HQHPHQS QHQQQH-HYQLRLNNGNQAKMLKRAFEST >D_erecta_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES DTENAKEPTAEQQQQAQQ-----RSSRSPQ--QQNSQQPQPQQQQQGSKS RSGSQTSQIQIQSLTQTYPNAH--QRKRVLVSLHPHQ------HQS--QH QHQQQHQHYQLRLNNGNQAKMLKRAFEST >D_ficusphila_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES DTENAKEPLAEQQQQQQQ-----RSSRSPQQLQQNPQQAQQQ---QGSKS RSGSQTSQIQTQSLTQIPKHTH--QRKRVLVSLHQHQ----HQHEHQSQR QHQHQH-HYQLRLNNGNQAKMLKRAFEST >D_rhopaloa_dlg1-PI MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES DTENAKEPSAEQQQQQQQQ-QQQRSSRSPQQLQQNPQQQQQQSQSQGSKS RSGSQTSQIQIESLTQIHQHQHAQQRKRILVSLHQHQNQHQSQHQHQHQY QHQYQH-HYQLRLNSGNQAKKLKRAFEST
#NEXUS
[ID: 4216616715]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_dlg1-PI
D_yakuba_dlg1-PI
D_erecta_dlg1-PI
D_ficusphila_dlg1-PI
D_rhopaloa_dlg1-PI
;
end;
begin trees;
translate
1 D_melanogaster_dlg1-PI,
2 D_yakuba_dlg1-PI,
3 D_erecta_dlg1-PI,
4 D_ficusphila_dlg1-PI,
5 D_rhopaloa_dlg1-PI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0397139,(4:0.04449446,5:0.05244309)1.000:0.05394886,(2:0.01836444,3:0.027504)0.685:0.006025844);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0397139,(4:0.04449446,5:0.05244309):0.05394886,(2:0.01836444,3:0.027504):0.006025844);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1543.74 -1554.08
2 -1543.68 -1552.98
--------------------------------------
TOTAL -1543.71 -1553.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/226/dlg1-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.250157 0.001197 0.189441 0.320968 0.246959 1170.14 1258.74 1.000
r(A<->C){all} 0.159595 0.001241 0.091147 0.227572 0.157355 817.37 1015.39 1.001
r(A<->G){all} 0.228062 0.002138 0.141855 0.321276 0.225068 885.27 921.95 1.000
r(A<->T){all} 0.070525 0.001087 0.014000 0.136685 0.066911 764.77 850.86 1.000
r(C<->G){all} 0.073773 0.000692 0.025632 0.125251 0.071574 877.32 956.58 1.000
r(C<->T){all} 0.395232 0.003701 0.272633 0.509524 0.394744 648.26 839.08 1.000
r(G<->T){all} 0.072812 0.001223 0.016153 0.147186 0.068441 523.13 709.31 1.000
pi(A){all} 0.324951 0.000283 0.293840 0.358855 0.325007 1212.11 1294.98 1.000
pi(C){all} 0.290552 0.000269 0.259392 0.321698 0.290335 1108.11 1156.81 1.000
pi(G){all} 0.224574 0.000239 0.196956 0.256567 0.223696 988.56 1070.10 1.000
pi(T){all} 0.159923 0.000180 0.130708 0.183115 0.160043 1095.36 1149.44 1.000
alpha{1,2} 0.245680 0.050182 0.000308 0.665567 0.189415 780.88 1024.70 1.000
alpha{3} 1.077549 0.346482 0.183840 2.193507 0.951994 1212.10 1356.55 1.000
pinvar{all} 0.219476 0.019659 0.000236 0.467780 0.203359 967.91 975.38 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/226/dlg1-PI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 204
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 2 2 2 | Ser TCT 1 2 3 2 1 | Tyr TAT 1 1 1 2 2 | Cys TGT 0 0 0 0 0
TTC 1 2 2 2 2 | TCC 5 5 5 3 3 | TAC 3 3 3 1 3 | TGC 0 0 0 0 0
Leu TTA 2 2 2 2 2 | TCA 2 3 2 3 4 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 4 4 5 4 4 | TCG 4 2 3 4 5 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 4 3 4 4 3 | Pro CCT 0 0 0 0 0 | His CAT 7 6 6 6 7 | Arg CGT 1 1 0 1 2
CTC 4 6 5 5 5 | CCC 0 1 0 1 0 | CAC 4 3 4 6 5 | CGC 10 11 11 11 9
CTA 0 0 0 1 1 | CCA 4 5 4 2 1 | Gln CAA 16 15 15 13 17 | CGA 1 1 1 1 1
CTG 3 3 2 3 3 | CCG 3 3 2 3 4 | CAG 19 21 21 23 21 | CGG 2 1 2 3 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 4 2 2 3 3 | Thr ACT 2 1 1 0 1 | Asn AAT 3 4 4 4 4 | Ser AGT 1 1 1 1 1
ATC 2 2 2 2 3 | ACC 3 4 3 4 3 | AAC 3 3 3 2 1 | AGC 4 4 4 3 4
ATA 7 7 7 6 7 | ACA 4 3 4 5 3 | Lys AAA 6 6 6 4 4 | Arg AGA 1 0 1 1 0
Met ATG 3 3 3 3 2 | ACG 1 2 2 1 1 | AAG 8 7 7 10 10 | AGG 1 2 1 0 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 2 2 | Ala GCT 4 3 3 3 4 | Asp GAT 5 5 5 5 5 | Gly GGT 0 0 0 0 0
GTC 3 2 2 1 0 | GCC 2 5 5 5 3 | GAC 3 3 3 3 3 | GGC 2 1 1 1 1
GTA 0 0 0 1 1 | GCA 4 4 4 2 2 | Glu GAA 7 6 7 7 5 | GGA 1 2 2 2 2
GTG 2 2 2 1 1 | GCG 4 3 4 4 5 | GAG 7 8 7 8 10 | GGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_dlg1-PI
position 1: T:0.13235 C:0.38235 A:0.25980 G:0.22549
position 2: T:0.21078 C:0.21078 A:0.45098 G:0.12745
position 3: T:0.18137 C:0.24020 A:0.26961 G:0.30882
Average T:0.17484 C:0.27778 A:0.32680 G:0.22059
#2: D_yakuba_dlg1-PI
position 1: T:0.13235 C:0.39216 A:0.25000 G:0.22549
position 2: T:0.20098 C:0.22549 A:0.44608 G:0.12745
position 3: T:0.15686 C:0.26961 A:0.26471 G:0.30882
Average T:0.16340 C:0.29575 A:0.32026 G:0.22059
#3: D_erecta_dlg1-PI
position 1: T:0.14216 C:0.37745 A:0.25000 G:0.23039
position 2: T:0.20098 C:0.22059 A:0.45098 G:0.12745
position 3: T:0.16176 C:0.25980 A:0.26961 G:0.30882
Average T:0.16830 C:0.28595 A:0.32353 G:0.22222
#4: D_ficusphila_dlg1-PI
position 1: T:0.12745 C:0.40686 A:0.24020 G:0.22549
position 2: T:0.20588 C:0.20588 A:0.46078 G:0.12745
position 3: T:0.17157 C:0.24510 A:0.24510 G:0.33824
Average T:0.16830 C:0.28595 A:0.31536 G:0.23039
#5: D_rhopaloa_dlg1-PI
position 1: T:0.14216 C:0.39706 A:0.24020 G:0.22059
position 2: T:0.20098 C:0.19608 A:0.47549 G:0.12745
position 3: T:0.18137 C:0.22059 A:0.24510 G:0.35294
Average T:0.17484 C:0.27124 A:0.32026 G:0.23366
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 11 | Ser S TCT 9 | Tyr Y TAT 7 | Cys C TGT 0
TTC 9 | TCC 21 | TAC 13 | TGC 0
Leu L TTA 10 | TCA 14 | *** * TAA 0 | *** * TGA 0
TTG 21 | TCG 18 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 32 | Arg R CGT 5
CTC 25 | CCC 2 | CAC 22 | CGC 52
CTA 2 | CCA 16 | Gln Q CAA 76 | CGA 5
CTG 14 | CCG 15 | CAG 105 | CGG 10
------------------------------------------------------------------------------
Ile I ATT 14 | Thr T ACT 5 | Asn N AAT 19 | Ser S AGT 5
ATC 11 | ACC 17 | AAC 12 | AGC 19
ATA 34 | ACA 19 | Lys K AAA 26 | Arg R AGA 3
Met M ATG 14 | ACG 7 | AAG 42 | AGG 6
------------------------------------------------------------------------------
Val V GTT 7 | Ala A GCT 17 | Asp D GAT 25 | Gly G GGT 0
GTC 8 | GCC 20 | GAC 15 | GGC 6
GTA 2 | GCA 16 | Glu E GAA 32 | GGA 9
GTG 8 | GCG 20 | GAG 40 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13529 C:0.39118 A:0.24804 G:0.22549
position 2: T:0.20392 C:0.21176 A:0.45686 G:0.12745
position 3: T:0.17059 C:0.24706 A:0.25882 G:0.32353
Average T:0.16993 C:0.28333 A:0.32124 G:0.22549
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_dlg1-PI
D_yakuba_dlg1-PI 0.1225 (0.0191 0.1560)
D_erecta_dlg1-PI 0.1910 (0.0299 0.1566) 0.1853 (0.0191 0.1031)
D_ficusphila_dlg1-PI 0.1405 (0.0413 0.2939) 0.1364 (0.0344 0.2518) 0.1840 (0.0409 0.2224)
D_rhopaloa_dlg1-PI 0.1632 (0.0452 0.2772) 0.1652 (0.0387 0.2340) 0.1831 (0.0430 0.2350) 0.1818 (0.0310 0.1705)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 87
lnL(ntime: 7 np: 9): -1318.039758 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.094969 0.107779 0.086040 0.102730 0.010566 0.044847 0.069995 1.462898 0.192270
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51693
(1: 0.094969, (4: 0.086040, 5: 0.102730): 0.107779, (2: 0.044847, 3: 0.069995): 0.010566);
(D_melanogaster_dlg1-PI: 0.094969, (D_ficusphila_dlg1-PI: 0.086040, D_rhopaloa_dlg1-PI: 0.102730): 0.107779, (D_yakuba_dlg1-PI: 0.044847, D_erecta_dlg1-PI: 0.069995): 0.010566);
Detailed output identifying parameters
kappa (ts/tv) = 1.46290
omega (dN/dS) = 0.19227
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.095 463.1 148.9 0.1923 0.0157 0.0814 7.2 12.1
6..7 0.108 463.1 148.9 0.1923 0.0178 0.0924 8.2 13.8
7..4 0.086 463.1 148.9 0.1923 0.0142 0.0738 6.6 11.0
7..5 0.103 463.1 148.9 0.1923 0.0169 0.0881 7.8 13.1
6..8 0.011 463.1 148.9 0.1923 0.0017 0.0091 0.8 1.3
8..2 0.045 463.1 148.9 0.1923 0.0074 0.0384 3.4 5.7
8..3 0.070 463.1 148.9 0.1923 0.0115 0.0600 5.3 8.9
tree length for dN: 0.0852
tree length for dS: 0.4431
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 87
lnL(ntime: 7 np: 10): -1303.223057 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.099986 0.113701 0.087528 0.105412 0.007473 0.046001 0.071896 1.391664 0.844437 0.028729
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.53200
(1: 0.099986, (4: 0.087528, 5: 0.105412): 0.113701, (2: 0.046001, 3: 0.071896): 0.007473);
(D_melanogaster_dlg1-PI: 0.099986, (D_ficusphila_dlg1-PI: 0.087528, D_rhopaloa_dlg1-PI: 0.105412): 0.113701, (D_yakuba_dlg1-PI: 0.046001, D_erecta_dlg1-PI: 0.071896): 0.007473);
Detailed output identifying parameters
kappa (ts/tv) = 1.39166
dN/dS (w) for site classes (K=2)
p: 0.84444 0.15556
w: 0.02873 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.100 465.4 146.6 0.1798 0.0159 0.0886 7.4 13.0
6..7 0.114 465.4 146.6 0.1798 0.0181 0.1007 8.4 14.8
7..4 0.088 465.4 146.6 0.1798 0.0139 0.0775 6.5 11.4
7..5 0.105 465.4 146.6 0.1798 0.0168 0.0934 7.8 13.7
6..8 0.007 465.4 146.6 0.1798 0.0012 0.0066 0.6 1.0
8..2 0.046 465.4 146.6 0.1798 0.0073 0.0407 3.4 6.0
8..3 0.072 465.4 146.6 0.1798 0.0115 0.0637 5.3 9.3
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 87
lnL(ntime: 7 np: 12): -1300.554051 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.104158 0.121147 0.093955 0.107511 0.008177 0.047758 0.075745 1.414747 0.860787 0.127602 0.042248 7.039518
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55845
(1: 0.104158, (4: 0.093955, 5: 0.107511): 0.121147, (2: 0.047758, 3: 0.075745): 0.008177);
(D_melanogaster_dlg1-PI: 0.104158, (D_ficusphila_dlg1-PI: 0.093955, D_rhopaloa_dlg1-PI: 0.107511): 0.121147, (D_yakuba_dlg1-PI: 0.047758, D_erecta_dlg1-PI: 0.075745): 0.008177);
Detailed output identifying parameters
kappa (ts/tv) = 1.41475
dN/dS (w) for site classes (K=3)
p: 0.86079 0.12760 0.01161
w: 0.04225 1.00000 7.03952
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.104 464.6 147.4 0.2457 0.0200 0.0812 9.3 12.0
6..7 0.121 464.6 147.4 0.2457 0.0232 0.0945 10.8 13.9
7..4 0.094 464.6 147.4 0.2457 0.0180 0.0733 8.4 10.8
7..5 0.108 464.6 147.4 0.2457 0.0206 0.0839 9.6 12.4
6..8 0.008 464.6 147.4 0.2457 0.0016 0.0064 0.7 0.9
8..2 0.048 464.6 147.4 0.2457 0.0092 0.0373 4.3 5.5
8..3 0.076 464.6 147.4 0.2457 0.0145 0.0591 6.7 8.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
176 S 0.980* 6.920
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.714 3.755 +- 2.590
157 A 0.747 3.915 +- 2.592
176 S 0.969* 4.954 +- 2.430
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.944 0.056 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.077 0.151 0.173 0.157 0.129 0.101 0.077 0.058 0.044 0.034
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.553
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.016 0.156 0.259
sum of density on p0-p1 = 1.000000
Time used: 0:13
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 87
lnL(ntime: 7 np: 13): -1300.337611 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.103553 0.120684 0.094288 0.108083 0.009250 0.047646 0.075370 1.394776 0.720596 0.263070 0.000001 0.541953 5.898369
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55887
(1: 0.103553, (4: 0.094288, 5: 0.108083): 0.120684, (2: 0.047646, 3: 0.075370): 0.009250);
(D_melanogaster_dlg1-PI: 0.103553, (D_ficusphila_dlg1-PI: 0.094288, D_rhopaloa_dlg1-PI: 0.108083): 0.120684, (D_yakuba_dlg1-PI: 0.047646, D_erecta_dlg1-PI: 0.075370): 0.009250);
Detailed output identifying parameters
kappa (ts/tv) = 1.39478
dN/dS (w) for site classes (K=3)
p: 0.72060 0.26307 0.01633
w: 0.00000 0.54195 5.89837
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.104 465.3 146.7 0.2389 0.0196 0.0819 9.1 12.0
6..7 0.121 465.3 146.7 0.2389 0.0228 0.0955 10.6 14.0
7..4 0.094 465.3 146.7 0.2389 0.0178 0.0746 8.3 10.9
7..5 0.108 465.3 146.7 0.2389 0.0204 0.0855 9.5 12.5
6..8 0.009 465.3 146.7 0.2389 0.0017 0.0073 0.8 1.1
8..2 0.048 465.3 146.7 0.2389 0.0090 0.0377 4.2 5.5
8..3 0.075 465.3 146.7 0.2389 0.0142 0.0596 6.6 8.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.663 4.091
157 A 0.729 4.448
176 S 0.997** 5.884
Time used: 0:21
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 87
lnL(ntime: 7 np: 10): -1303.455363 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.100317 0.114373 0.088143 0.105978 0.007981 0.046341 0.072341 1.488249 0.012199 0.041121
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.53547
(1: 0.100317, (4: 0.088143, 5: 0.105978): 0.114373, (2: 0.046341, 3: 0.072341): 0.007981);
(D_melanogaster_dlg1-PI: 0.100317, (D_ficusphila_dlg1-PI: 0.088143, D_rhopaloa_dlg1-PI: 0.105978): 0.114373, (D_yakuba_dlg1-PI: 0.046341, D_erecta_dlg1-PI: 0.072341): 0.007981);
Detailed output identifying parameters
kappa (ts/tv) = 1.48825
Parameters in M7 (beta):
p = 0.01220 q = 0.04112
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.08743 0.99997 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.100 462.2 149.8 0.2087 0.0173 0.0831 8.0 12.4
6..7 0.114 462.2 149.8 0.2087 0.0198 0.0948 9.1 14.2
7..4 0.088 462.2 149.8 0.2087 0.0152 0.0730 7.0 10.9
7..5 0.106 462.2 149.8 0.2087 0.0183 0.0878 8.5 13.1
6..8 0.008 462.2 149.8 0.2087 0.0014 0.0066 0.6 1.0
8..2 0.046 462.2 149.8 0.2087 0.0080 0.0384 3.7 5.7
8..3 0.072 462.2 149.8 0.2087 0.0125 0.0599 5.8 9.0
Time used: 1:25
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 87
check convergence..
lnL(ntime: 7 np: 12): -1300.419246 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.103822 0.120892 0.094153 0.107906 0.008792 0.047694 0.075509 1.397956 0.985460 0.112326 0.624788 6.233589
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55877
(1: 0.103822, (4: 0.094153, 5: 0.107906): 0.120892, (2: 0.047694, 3: 0.075509): 0.008792);
(D_melanogaster_dlg1-PI: 0.103822, (D_ficusphila_dlg1-PI: 0.094153, D_rhopaloa_dlg1-PI: 0.107906): 0.120892, (D_yakuba_dlg1-PI: 0.047694, D_erecta_dlg1-PI: 0.075509): 0.008792);
Detailed output identifying parameters
kappa (ts/tv) = 1.39796
Parameters in M8 (beta&w>1):
p0 = 0.98546 p = 0.11233 q = 0.62479
(p1 = 0.01454) w = 6.23359
dN/dS (w) for site classes (K=11)
p: 0.09855 0.09855 0.09855 0.09855 0.09855 0.09855 0.09855 0.09855 0.09855 0.09855 0.01454
w: 0.00000 0.00000 0.00001 0.00019 0.00180 0.01071 0.04680 0.16054 0.43472 0.86275 6.23359
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.104 465.2 146.8 0.2402 0.0197 0.0819 9.2 12.0
6..7 0.121 465.2 146.8 0.2402 0.0229 0.0954 10.7 14.0
7..4 0.094 465.2 146.8 0.2402 0.0178 0.0743 8.3 10.9
7..5 0.108 465.2 146.8 0.2402 0.0204 0.0851 9.5 12.5
6..8 0.009 465.2 146.8 0.2402 0.0017 0.0069 0.8 1.0
8..2 0.048 465.2 146.8 0.2402 0.0090 0.0376 4.2 5.5
8..3 0.076 465.2 146.8 0.2402 0.0143 0.0596 6.7 8.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.554 3.804
157 A 0.620 4.165
176 S 0.992** 6.188
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.904 3.799 +- 1.988
155 P 0.616 2.648 +- 2.124
157 A 0.922 3.867 +- 1.961
174 H 0.526 2.359 +- 2.178
176 S 0.994** 4.116 +- 1.842
178 I 0.531 2.412 +- 2.225
180 H 0.571 2.383 +- 1.956
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.994
p : 0.894 0.104 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.017 0.074 0.125 0.148 0.154 0.155 0.159 0.168
ws: 0.059 0.247 0.260 0.179 0.108 0.064 0.037 0.022 0.014 0.009
Time used: 1:51
Model 1: NearlyNeutral -1303.223057
Model 2: PositiveSelection -1300.554051
Model 0: one-ratio -1318.039758
Model 3: discrete -1300.337611
Model 7: beta -1303.455363
Model 8: beta&w>1 -1300.419246
Model 0 vs 1 29.633401999999933
Model 2 vs 1 5.338011999999708
Model 8 vs 7 6.072234000000208
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.554 3.804
157 A 0.620 4.165
176 S 0.992** 6.188
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_dlg1-PI)
Pr(w>1) post mean +- SE for w
109 T 0.904 3.799 +- 1.988
155 P 0.616 2.648 +- 2.124
157 A 0.922 3.867 +- 1.961
174 H 0.526 2.359 +- 2.178
176 S 0.994** 4.116 +- 1.842
178 I 0.531 2.412 +- 2.225
180 H 0.571 2.383 +- 1.956
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
