--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:32:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0064/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -883.98 -887.14
2 -883.95 -887.22
--------------------------------------
TOTAL -883.96 -887.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888945 0.087025 0.356496 1.464892 0.860317 1445.11 1455.77 1.000
r(A<->C){all} 0.164478 0.018648 0.000079 0.436268 0.128533 260.52 266.04 1.001
r(A<->G){all} 0.164810 0.021372 0.000001 0.464455 0.121613 143.05 198.47 1.000
r(A<->T){all} 0.179915 0.023207 0.000018 0.478323 0.138602 218.06 280.13 1.000
r(C<->G){all} 0.159010 0.019396 0.000003 0.445173 0.118329 274.61 331.25 1.003
r(C<->T){all} 0.160575 0.018806 0.000018 0.451679 0.122849 302.79 339.51 1.002
r(G<->T){all} 0.171212 0.020471 0.000030 0.455576 0.135109 219.50 220.93 1.004
pi(A){all} 0.245032 0.000288 0.211775 0.277298 0.244632 1152.71 1326.86 1.000
pi(C){all} 0.302260 0.000333 0.267852 0.339272 0.301641 1238.57 1277.35 1.003
pi(G){all} 0.257634 0.000300 0.225195 0.291175 0.257504 1054.39 1155.16 1.000
pi(T){all} 0.195075 0.000241 0.165000 0.225355 0.195202 1250.91 1352.48 1.001
alpha{1,2} 0.419986 0.225627 0.000116 1.367610 0.250957 1134.80 1200.03 1.002
alpha{3} 0.463984 0.235642 0.000313 1.449328 0.299544 1175.47 1338.23 1.001
pinvar{all} 0.997597 0.000008 0.992304 1.000000 0.998482 1280.09 1314.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -858.8802
Model 2: PositiveSelection -858.880257
Model 0: one-ratio -858.880283
Model 7: beta -858.8802
Model 8: beta&w>1 -858.8802
Model 0 vs 1 1.6600000003563764E-4
Model 2 vs 1 1.1400000016692502E-4
Model 8 vs 7 0.0
>C1
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C2
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C3
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C4
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C5
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C6
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=214
C1 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C2 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C3 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C4 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C5 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C6 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
**************************************************
C1 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C2 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C3 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C4 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C5 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C6 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
**************************************************
C1 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C2 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C3 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C4 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C5 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C6 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
**************************************************
C1 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C2 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C3 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C4 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C5 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C6 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
**************************************************
C1 LVHIWVSSIYNEIR
C2 LVHIWVSSIYNEIR
C3 LVHIWVSSIYNEIR
C4 LVHIWVSSIYNEIR
C5 LVHIWVSSIYNEIR
C6 LVHIWVSSIYNEIR
**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6420]--->[6420]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.750 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C2 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C3 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C4 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C5 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C6 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
**************************************************
C1 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C2 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C3 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C4 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C5 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C6 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
**************************************************
C1 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C2 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C3 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C4 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C5 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C6 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
**************************************************
C1 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C2 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C3 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C4 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C5 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C6 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
**************************************************
C1 LVHIWVSSIYNEIR
C2 LVHIWVSSIYNEIR
C3 LVHIWVSSIYNEIR
C4 LVHIWVSSIYNEIR
C5 LVHIWVSSIYNEIR
C6 LVHIWVSSIYNEIR
**************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C2 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C3 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C4 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C5 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C6 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
**************************************************
C1 CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C2 CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C3 CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C4 CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C5 CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C6 CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
**************************************************
C1 AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C2 AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C3 AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C4 AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C5 AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C6 AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
**************************************************
C1 GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C2 GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C3 GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C4 GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C5 GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C6 GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
**************************************************
C1 CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C2 CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C3 CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C4 CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C5 CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C6 CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
**************************************************
C1 ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C2 ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C3 ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C4 ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C5 ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C6 ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
**************************************************
C1 AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C2 AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C3 AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C4 AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C5 AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C6 AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
**************************************************
C1 AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C2 AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C3 AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C4 AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C5 AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C6 AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
**************************************************
C1 AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C2 AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C3 AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C4 AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C5 AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C6 AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
**************************************************
C1 ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C2 ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C3 ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C4 ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C5 ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C6 ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
**************************************************
C1 AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C2 AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C3 AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C4 AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C5 AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C6 AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
**************************************************
C1 CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C2 CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C3 CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C4 CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C5 CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C6 CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
**************************************************
C1 CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C2 CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C3 CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C4 CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C5 CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C6 CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
******************************************
>C1
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C2
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C3
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C4
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C5
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C6
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C1
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C2
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C3
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C4
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C5
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C6
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 642 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789878
Setting output file names to "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1058309914
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0279925210
Seed = 1367075013
Swapseed = 1579789878
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1436.826701 -- -24.965149
Chain 2 -- -1436.826783 -- -24.965149
Chain 3 -- -1436.826783 -- -24.965149
Chain 4 -- -1436.826783 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1436.826783 -- -24.965149
Chain 2 -- -1436.826563 -- -24.965149
Chain 3 -- -1436.826701 -- -24.965149
Chain 4 -- -1436.826783 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1436.827] (-1436.827) (-1436.827) (-1436.827) * [-1436.827] (-1436.827) (-1436.827) (-1436.827)
500 -- (-893.825) (-897.894) [-889.753] (-900.935) * (-902.582) (-897.908) [-891.057] (-896.730) -- 0:00:00
1000 -- (-893.462) (-903.704) [-896.892] (-894.544) * (-899.240) (-903.507) (-893.459) [-890.947] -- 0:00:00
1500 -- (-897.607) (-890.608) [-894.317] (-893.015) * [-892.208] (-896.762) (-899.912) (-896.236) -- 0:00:00
2000 -- [-892.877] (-892.530) (-891.331) (-886.456) * (-899.144) [-889.783] (-901.134) (-891.637) -- 0:00:00
2500 -- (-895.326) (-891.532) (-894.308) [-887.269] * (-891.857) [-887.141] (-891.877) (-896.473) -- 0:00:00
3000 -- [-889.291] (-897.600) (-889.592) (-893.368) * (-892.051) (-893.443) [-894.771] (-892.217) -- 0:00:00
3500 -- (-896.818) (-893.965) (-896.179) [-889.869] * (-894.579) (-896.028) (-890.325) [-887.801] -- 0:00:00
4000 -- (-893.747) [-891.794] (-894.556) (-894.750) * (-891.717) [-889.679] (-898.203) (-896.626) -- 0:00:00
4500 -- (-890.577) [-892.455] (-893.599) (-887.014) * (-902.289) [-897.188] (-894.061) (-891.535) -- 0:03:41
5000 -- (-892.372) (-894.612) (-892.174) [-893.715] * (-894.188) [-889.017] (-890.579) (-890.312) -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- (-897.261) [-890.078] (-892.924) (-890.946) * (-896.581) (-895.959) (-900.142) [-888.955] -- 0:03:00
6000 -- (-890.974) (-900.018) (-897.536) [-898.945] * (-892.861) (-892.477) [-891.839] (-902.055) -- 0:02:45
6500 -- (-894.849) (-905.677) [-890.294] (-898.572) * [-893.687] (-891.464) (-894.171) (-895.836) -- 0:02:32
7000 -- [-899.513] (-893.881) (-900.337) (-902.217) * (-894.467) [-891.676] (-891.519) (-899.600) -- 0:02:21
7500 -- (-890.210) [-893.979] (-896.403) (-898.175) * (-900.992) [-895.797] (-889.401) (-894.457) -- 0:02:12
8000 -- (-885.628) [-890.571] (-893.118) (-899.631) * (-896.670) [-894.475] (-891.330) (-901.508) -- 0:02:04
8500 -- (-896.439) (-896.331) (-896.165) [-898.262] * (-888.188) (-898.986) [-887.855] (-892.409) -- 0:01:56
9000 -- (-897.791) (-896.242) [-893.845] (-890.927) * [-885.264] (-896.087) (-891.938) (-896.578) -- 0:01:50
9500 -- [-893.237] (-893.463) (-889.926) (-892.903) * (-885.728) (-893.024) (-900.737) [-891.537] -- 0:01:44
10000 -- (-894.903) (-895.544) (-890.900) [-889.748] * (-884.604) (-903.914) [-894.598] (-899.095) -- 0:01:39
Average standard deviation of split frequencies: 0.054717
10500 -- (-901.468) [-891.316] (-891.740) (-895.312) * [-883.537] (-898.813) (-890.778) (-889.954) -- 0:01:34
11000 -- [-887.107] (-895.636) (-899.534) (-890.925) * (-883.356) (-891.797) (-902.365) [-891.147] -- 0:01:29
11500 -- (-893.008) (-893.819) (-896.809) [-888.907] * (-884.101) (-889.738) [-896.961] (-897.664) -- 0:01:25
12000 -- (-899.114) (-896.381) (-889.717) [-893.606] * (-882.621) [-890.710] (-897.542) (-891.601) -- 0:01:22
12500 -- [-891.497] (-900.684) (-896.523) (-899.411) * (-882.621) (-893.160) (-893.147) [-892.086] -- 0:01:19
13000 -- [-891.775] (-897.246) (-892.481) (-895.684) * (-883.721) (-902.410) (-892.264) [-893.874] -- 0:01:15
13500 -- (-897.999) (-904.105) [-891.434] (-887.065) * (-884.200) (-895.099) (-891.886) [-887.489] -- 0:01:13
14000 -- (-912.350) (-890.928) (-888.211) [-889.387] * (-884.471) (-900.368) (-889.623) [-883.313] -- 0:01:10
14500 -- (-893.295) (-890.145) [-889.988] (-889.908) * (-883.497) [-891.067] (-897.433) (-883.201) -- 0:01:07
15000 -- (-895.694) (-894.146) (-900.650) [-897.837] * (-885.487) (-887.344) [-896.589] (-883.406) -- 0:01:05
Average standard deviation of split frequencies: 0.073657
15500 -- (-883.216) (-896.524) [-890.078] (-893.299) * (-884.326) [-890.253] (-894.872) (-883.698) -- 0:01:03
16000 -- (-882.684) [-887.655] (-889.743) (-892.629) * (-882.594) (-897.893) (-893.414) [-883.170] -- 0:01:01
16500 -- (-884.665) (-894.436) [-891.235] (-892.449) * (-883.503) [-890.191] (-894.790) (-883.500) -- 0:00:59
17000 -- (-887.221) (-891.460) (-896.186) [-894.277] * (-883.196) (-898.857) [-890.344] (-885.312) -- 0:00:57
17500 -- (-884.455) (-901.004) (-893.034) [-897.760] * (-883.035) [-901.179] (-891.404) (-884.766) -- 0:00:56
18000 -- (-885.095) (-896.264) (-895.347) [-896.293] * (-883.961) [-894.236] (-893.912) (-882.733) -- 0:00:54
18500 -- (-883.763) (-897.556) [-890.778] (-891.392) * (-883.021) (-901.029) [-891.853] (-883.148) -- 0:00:53
19000 -- (-887.830) (-894.790) [-890.932] (-895.310) * (-883.707) [-890.961] (-892.049) (-883.360) -- 0:01:43
19500 -- [-883.135] (-896.418) (-894.697) (-899.833) * (-883.027) [-899.977] (-905.860) (-883.532) -- 0:01:40
20000 -- [-882.860] (-890.253) (-899.948) (-905.216) * (-886.021) (-892.472) [-890.954] (-884.049) -- 0:01:38
Average standard deviation of split frequencies: 0.061913
20500 -- (-884.161) [-891.664] (-888.933) (-902.934) * (-884.937) [-883.179] (-891.814) (-883.229) -- 0:01:35
21000 -- [-883.979] (-889.530) (-894.288) (-883.189) * (-884.135) [-883.301] (-891.906) (-883.911) -- 0:01:33
21500 -- (-884.118) (-890.833) [-900.880] (-883.426) * [-884.424] (-883.324) (-891.769) (-883.210) -- 0:01:31
22000 -- [-885.985] (-893.367) (-897.682) (-887.365) * [-888.784] (-884.420) (-896.916) (-885.052) -- 0:01:28
22500 -- [-885.389] (-891.034) (-892.645) (-885.220) * (-883.886) (-883.312) (-901.033) [-885.288] -- 0:01:26
23000 -- (-885.467) (-909.786) [-892.201] (-884.072) * (-885.813) [-884.936] (-893.896) (-884.093) -- 0:01:24
23500 -- (-885.976) (-895.211) [-887.895] (-887.245) * (-884.052) (-884.430) [-896.899] (-885.061) -- 0:01:23
24000 -- (-884.795) (-892.047) (-896.152) [-887.873] * [-884.227] (-885.938) (-894.910) (-884.088) -- 0:01:21
24500 -- (-887.395) (-889.733) (-893.593) [-887.440] * (-886.587) [-884.333] (-894.967) (-885.452) -- 0:01:19
25000 -- (-893.124) (-896.459) [-889.713] (-887.393) * (-887.468) [-884.435] (-904.403) (-883.580) -- 0:01:18
Average standard deviation of split frequencies: 0.050939
25500 -- (-891.416) [-894.935] (-894.895) (-886.713) * (-886.268) [-884.354] (-897.010) (-885.012) -- 0:01:16
26000 -- [-884.553] (-890.373) (-892.289) (-885.623) * [-884.243] (-885.602) (-890.119) (-885.067) -- 0:01:14
26500 -- (-885.113) (-888.530) (-891.051) [-884.252] * (-884.317) (-888.855) [-892.611] (-884.913) -- 0:01:13
27000 -- [-888.434] (-900.189) (-895.008) (-885.053) * (-884.331) (-893.441) [-889.082] (-886.448) -- 0:01:12
27500 -- (-883.710) (-894.928) [-890.417] (-884.255) * (-884.202) (-884.881) [-888.803] (-885.416) -- 0:01:10
28000 -- (-883.957) (-900.094) [-893.725] (-885.770) * (-884.853) (-883.754) (-902.964) [-884.964] -- 0:01:09
28500 -- (-883.557) [-888.870] (-901.903) (-886.023) * [-885.534] (-885.026) (-895.708) (-888.169) -- 0:01:08
29000 -- (-887.611) [-897.401] (-894.398) (-885.561) * [-883.074] (-884.371) (-889.356) (-885.042) -- 0:01:06
29500 -- (-883.888) (-895.961) (-896.285) [-882.674] * (-884.058) (-885.581) (-898.542) [-883.339] -- 0:01:05
30000 -- (-885.057) (-892.784) [-895.079] (-885.043) * (-884.053) (-883.539) (-889.629) [-883.581] -- 0:01:04
Average standard deviation of split frequencies: 0.037216
30500 -- [-886.150] (-895.100) (-895.438) (-885.233) * (-884.214) (-883.316) [-898.211] (-887.976) -- 0:01:03
31000 -- [-885.327] (-889.146) (-896.364) (-883.244) * [-885.977] (-885.603) (-893.612) (-887.207) -- 0:01:02
31500 -- (-884.949) (-899.327) [-900.405] (-883.718) * (-885.378) (-886.480) [-890.581] (-889.239) -- 0:01:01
32000 -- (-885.048) [-893.216] (-897.520) (-887.697) * (-884.438) (-885.628) (-892.603) [-884.148] -- 0:01:00
32500 -- [-885.270] (-893.489) (-888.945) (-887.204) * [-886.096] (-882.452) (-894.645) (-884.547) -- 0:00:59
33000 -- (-886.867) (-894.741) [-898.256] (-884.535) * [-884.604] (-883.235) (-892.553) (-884.819) -- 0:00:58
33500 -- [-885.351] (-889.753) (-896.957) (-885.456) * (-893.335) (-885.194) (-895.467) [-882.933] -- 0:00:57
34000 -- (-885.051) (-888.307) [-890.862] (-889.166) * (-884.439) (-885.154) (-894.653) [-883.159] -- 0:00:56
34500 -- (-888.182) (-894.375) (-895.015) [-883.417] * (-885.355) [-885.128] (-892.569) (-884.197) -- 0:00:55
35000 -- (-888.253) (-893.467) (-891.533) [-884.024] * (-885.847) (-883.493) (-895.508) [-885.681] -- 0:01:22
Average standard deviation of split frequencies: 0.034191
35500 -- (-887.809) [-899.177] (-894.466) (-884.782) * (-883.553) [-884.593] (-896.336) (-883.920) -- 0:01:21
36000 -- (-885.712) [-892.016] (-894.466) (-886.920) * (-888.073) [-883.480] (-892.670) (-885.240) -- 0:01:20
36500 -- [-884.369] (-890.685) (-893.446) (-885.161) * (-886.262) (-884.769) [-892.879] (-888.212) -- 0:01:19
37000 -- [-882.385] (-896.831) (-890.238) (-884.710) * (-885.213) (-887.546) (-899.606) [-886.292] -- 0:01:18
37500 -- (-884.474) (-895.768) [-888.593] (-883.498) * (-889.516) (-884.890) [-894.992] (-886.938) -- 0:01:17
38000 -- (-889.058) (-899.842) (-895.134) [-883.793] * [-886.384] (-887.275) (-896.832) (-887.494) -- 0:01:15
38500 -- [-886.827] (-906.536) (-893.422) (-884.362) * (-887.164) [-886.437] (-893.787) (-888.549) -- 0:01:14
39000 -- (-883.607) [-892.004] (-894.741) (-887.287) * [-886.178] (-886.734) (-897.114) (-885.104) -- 0:01:13
39500 -- (-883.699) [-894.163] (-892.876) (-886.265) * (-883.763) (-885.157) [-893.798] (-883.678) -- 0:01:12
40000 -- [-890.389] (-898.920) (-893.054) (-886.258) * (-883.998) (-883.687) [-898.018] (-885.850) -- 0:01:12
Average standard deviation of split frequencies: 0.037674
40500 -- (-885.593) (-890.802) [-887.998] (-887.308) * [-886.261] (-884.632) (-890.094) (-884.853) -- 0:01:11
41000 -- (-883.686) (-896.987) (-902.033) [-883.623] * (-885.436) (-888.583) (-892.980) [-884.108] -- 0:01:10
41500 -- (-889.219) (-893.737) (-905.078) [-883.009] * (-884.697) (-884.729) [-894.330] (-883.400) -- 0:01:09
42000 -- (-887.954) (-892.845) [-889.958] (-885.771) * (-884.464) [-883.068] (-890.157) (-883.058) -- 0:01:08
42500 -- (-885.014) (-896.034) (-897.404) [-882.861] * (-886.230) (-882.431) (-885.031) [-883.472] -- 0:01:07
43000 -- (-884.639) (-896.951) (-893.881) [-883.242] * (-888.773) [-882.896] (-885.092) (-886.257) -- 0:01:06
43500 -- (-884.985) [-898.104] (-898.856) (-884.707) * (-885.012) (-889.447) [-884.453] (-883.781) -- 0:01:05
44000 -- (-885.724) [-893.810] (-899.103) (-883.313) * [-883.396] (-888.442) (-884.441) (-884.474) -- 0:01:05
44500 -- [-886.829] (-889.678) (-897.440) (-883.343) * (-885.012) [-883.850] (-886.176) (-883.705) -- 0:01:04
45000 -- [-884.100] (-895.727) (-887.061) (-883.505) * (-883.956) [-884.622] (-885.796) (-882.858) -- 0:01:03
Average standard deviation of split frequencies: 0.032362
45500 -- (-884.239) (-896.924) [-887.698] (-884.219) * (-884.466) [-887.901] (-890.922) (-884.056) -- 0:01:02
46000 -- (-884.809) [-889.637] (-884.233) (-886.086) * (-884.416) (-883.886) (-885.344) [-886.326] -- 0:01:02
46500 -- [-885.117] (-896.097) (-888.161) (-884.888) * (-883.824) (-883.761) [-883.660] (-884.724) -- 0:01:01
47000 -- (-886.473) [-898.047] (-883.683) (-882.925) * (-884.687) [-883.754] (-883.517) (-884.932) -- 0:01:00
47500 -- (-889.097) [-891.286] (-884.584) (-887.290) * (-884.151) (-883.729) (-882.880) [-884.446] -- 0:01:00
48000 -- (-885.360) (-900.114) (-885.290) [-883.641] * (-885.972) (-885.431) (-884.766) [-884.351] -- 0:00:59
48500 -- [-883.038] (-898.946) (-885.153) (-884.992) * (-886.539) (-885.166) [-885.333] (-885.153) -- 0:00:58
49000 -- (-883.574) (-893.347) (-884.783) [-883.984] * (-884.337) [-883.266] (-885.597) (-885.730) -- 0:00:58
49500 -- (-886.377) [-893.129] (-882.521) (-883.637) * (-885.238) (-883.787) (-884.886) [-884.807] -- 0:00:57
50000 -- (-885.850) (-900.181) (-884.094) [-884.010] * (-895.708) (-885.399) (-886.202) [-885.396] -- 0:00:57
Average standard deviation of split frequencies: 0.026583
50500 -- (-882.928) (-889.259) (-883.864) [-884.190] * (-884.870) (-883.520) (-885.323) [-882.882] -- 0:01:15
51000 -- (-883.465) (-895.535) [-887.506] (-886.766) * (-883.230) [-884.384] (-885.828) (-882.730) -- 0:01:14
51500 -- (-884.219) (-895.712) (-886.058) [-890.681] * (-883.826) (-885.669) (-886.168) [-884.111] -- 0:01:13
52000 -- (-883.422) [-891.152] (-885.642) (-885.750) * (-884.715) (-885.907) (-887.707) [-882.781] -- 0:01:12
52500 -- (-882.586) [-892.863] (-890.406) (-884.596) * (-884.674) [-884.169] (-883.855) (-883.134) -- 0:01:12
53000 -- (-883.559) (-894.626) [-886.818] (-885.701) * (-884.275) (-888.235) [-884.899] (-882.762) -- 0:01:11
53500 -- (-882.786) (-894.495) (-886.993) [-883.753] * [-883.895] (-885.342) (-883.835) (-882.695) -- 0:01:10
54000 -- [-885.799] (-892.164) (-883.717) (-885.980) * (-885.681) [-885.801] (-886.270) (-883.280) -- 0:01:10
54500 -- (-882.968) [-892.107] (-884.839) (-885.791) * (-884.350) [-885.262] (-885.060) (-884.450) -- 0:01:09
55000 -- (-883.498) (-891.558) [-883.782] (-884.865) * (-884.988) (-883.884) [-885.534] (-889.408) -- 0:01:08
Average standard deviation of split frequencies: 0.031457
55500 -- (-884.039) (-898.042) [-884.771] (-886.233) * (-885.661) (-885.967) [-885.839] (-890.282) -- 0:01:08
56000 -- (-883.310) (-890.289) [-883.344] (-888.602) * (-884.301) (-884.685) (-884.521) [-886.987] -- 0:01:07
56500 -- (-884.123) (-900.284) [-885.507] (-889.417) * (-884.604) [-884.302] (-885.072) (-886.746) -- 0:01:06
57000 -- (-885.779) (-899.975) [-886.812] (-886.004) * (-884.141) [-885.661] (-885.172) (-886.494) -- 0:01:06
57500 -- [-886.951] (-894.814) (-885.235) (-883.996) * [-884.352] (-883.537) (-888.243) (-885.402) -- 0:01:05
58000 -- (-883.639) (-888.577) (-883.655) [-883.505] * (-884.177) (-883.773) [-884.331] (-888.729) -- 0:01:04
58500 -- [-883.596] (-891.283) (-885.375) (-884.562) * [-882.746] (-884.618) (-886.578) (-888.270) -- 0:01:04
59000 -- (-883.991) (-885.417) (-886.062) [-887.725] * (-885.229) (-886.250) (-884.941) [-884.485] -- 0:01:03
59500 -- [-884.701] (-885.292) (-885.304) (-883.486) * [-882.734] (-884.979) (-884.660) (-889.032) -- 0:01:03
60000 -- (-882.877) [-885.974] (-884.006) (-888.409) * (-882.788) (-884.539) (-885.074) [-886.810] -- 0:01:02
Average standard deviation of split frequencies: 0.032717
60500 -- (-883.275) (-884.326) (-885.971) [-883.914] * [-883.922] (-887.844) (-889.285) (-885.476) -- 0:01:02
61000 -- (-885.516) (-886.415) (-885.473) [-884.343] * (-882.585) (-887.224) (-889.214) [-888.680] -- 0:01:01
61500 -- (-884.075) (-886.427) [-884.445] (-885.253) * (-882.721) (-884.603) [-884.628] (-888.396) -- 0:01:01
62000 -- (-884.174) (-888.303) [-883.152] (-883.580) * (-884.942) [-884.074] (-884.746) (-885.060) -- 0:01:00
62500 -- (-882.800) [-883.737] (-883.527) (-883.499) * (-886.223) [-883.631] (-883.813) (-884.818) -- 0:01:00
63000 -- (-883.328) (-884.842) [-882.459] (-884.102) * [-886.195] (-887.414) (-883.402) (-886.787) -- 0:00:59
63500 -- (-887.384) (-884.533) [-882.662] (-885.503) * [-883.323] (-883.936) (-885.985) (-893.349) -- 0:00:58
64000 -- (-888.943) (-884.876) [-882.957] (-884.049) * (-883.562) [-884.900] (-884.618) (-884.916) -- 0:00:58
64500 -- [-885.594] (-884.193) (-884.013) (-884.065) * (-884.108) (-885.451) (-883.798) [-885.242] -- 0:00:58
65000 -- (-883.231) [-884.131] (-884.147) (-886.651) * (-883.962) (-887.191) (-883.677) [-882.874] -- 0:00:57
Average standard deviation of split frequencies: 0.026784
65500 -- [-883.040] (-884.335) (-883.364) (-884.137) * (-885.800) [-888.898] (-884.746) (-886.249) -- 0:01:11
66000 -- [-884.690] (-883.820) (-884.546) (-886.565) * [-886.740] (-883.114) (-884.285) (-882.959) -- 0:01:10
66500 -- (-884.511) (-883.905) [-883.127] (-885.146) * (-883.441) [-884.393] (-885.816) (-882.772) -- 0:01:10
67000 -- (-885.566) [-887.326] (-887.682) (-882.803) * [-884.492] (-882.886) (-884.249) (-882.685) -- 0:01:09
67500 -- (-884.130) (-886.333) (-888.123) [-886.051] * (-889.883) (-884.244) [-882.822] (-883.482) -- 0:01:09
68000 -- [-885.334] (-884.162) (-883.858) (-887.014) * (-886.710) (-884.182) [-886.800] (-886.084) -- 0:01:08
68500 -- [-883.665] (-882.777) (-888.901) (-884.598) * (-889.315) (-884.295) (-889.137) [-883.952] -- 0:01:07
69000 -- (-882.603) (-885.115) [-886.558] (-886.327) * (-886.673) [-883.539] (-884.608) (-884.237) -- 0:01:07
69500 -- (-883.909) (-885.895) [-885.041] (-884.588) * (-885.626) [-884.266] (-884.807) (-887.045) -- 0:01:06
70000 -- (-883.273) (-883.610) [-883.751] (-888.281) * (-883.886) (-887.027) [-883.790] (-886.948) -- 0:01:06
Average standard deviation of split frequencies: 0.022681
70500 -- (-883.360) [-885.674] (-884.863) (-888.026) * (-884.055) (-886.103) (-886.789) [-886.038] -- 0:01:05
71000 -- (-883.939) [-887.463] (-884.316) (-890.318) * (-883.794) [-884.459] (-883.848) (-886.820) -- 0:01:05
71500 -- (-888.199) (-883.270) [-884.713] (-886.693) * (-884.155) (-886.281) (-883.216) [-885.881] -- 0:01:04
72000 -- (-887.628) [-883.159] (-886.417) (-886.590) * (-885.194) [-883.318] (-887.075) (-884.721) -- 0:01:04
72500 -- [-883.537] (-882.994) (-885.772) (-885.800) * (-884.541) (-883.176) (-883.790) [-884.380] -- 0:01:03
73000 -- (-883.132) (-883.071) (-884.464) [-882.444] * [-885.385] (-885.059) (-883.326) (-885.233) -- 0:01:03
73500 -- [-885.833] (-888.695) (-887.074) (-882.968) * (-883.833) (-885.081) (-883.493) [-884.123] -- 0:01:03
74000 -- (-886.566) (-888.504) (-884.572) [-882.688] * (-887.350) (-884.004) (-886.491) [-884.005] -- 0:01:02
74500 -- [-885.400] (-887.884) (-883.031) (-883.652) * (-884.919) (-889.044) (-889.900) [-885.630] -- 0:01:02
75000 -- [-883.908] (-883.913) (-887.591) (-883.822) * (-882.435) (-887.270) (-886.700) [-883.956] -- 0:01:01
Average standard deviation of split frequencies: 0.021709
75500 -- (-886.574) (-883.675) [-888.690] (-884.899) * [-884.033] (-890.528) (-883.748) (-883.231) -- 0:01:01
76000 -- (-887.377) (-883.744) [-883.643] (-883.220) * (-883.706) (-887.879) [-884.469] (-885.984) -- 0:01:00
76500 -- (-886.262) [-883.529] (-884.583) (-883.653) * (-883.073) (-884.290) [-883.963] (-886.233) -- 0:01:00
77000 -- (-885.794) [-885.218] (-882.783) (-883.779) * [-882.393] (-884.319) (-885.855) (-884.357) -- 0:00:59
77500 -- (-883.732) (-882.742) [-883.818] (-883.721) * (-882.663) (-885.365) [-885.723] (-888.312) -- 0:00:59
78000 -- (-884.798) (-886.533) (-885.491) [-884.246] * (-882.755) [-883.112] (-883.147) (-885.951) -- 0:00:59
78500 -- (-885.001) (-882.387) [-884.724] (-887.585) * (-883.422) (-884.274) [-885.508] (-887.294) -- 0:00:58
79000 -- (-889.512) [-883.475] (-883.637) (-884.400) * (-887.364) (-885.889) [-883.873] (-889.153) -- 0:00:58
79500 -- (-889.348) (-883.778) (-883.427) [-882.864] * (-885.179) (-885.230) [-884.308] (-889.135) -- 0:00:57
80000 -- (-884.716) [-883.330] (-882.339) (-885.024) * (-884.573) (-883.966) (-883.161) [-885.120] -- 0:00:57
Average standard deviation of split frequencies: 0.024836
80500 -- (-883.515) (-885.543) (-882.928) [-883.777] * (-884.245) (-885.459) (-885.603) [-883.961] -- 0:00:57
81000 -- (-886.831) (-883.664) (-886.281) [-884.514] * [-886.776] (-886.420) (-884.065) (-883.566) -- 0:01:08
81500 -- (-888.230) [-883.233] (-884.738) (-885.070) * [-884.782] (-884.957) (-886.874) (-887.620) -- 0:01:07
82000 -- (-885.582) [-882.595] (-883.257) (-886.310) * [-885.298] (-887.326) (-883.483) (-883.928) -- 0:01:07
82500 -- [-882.863] (-882.732) (-882.906) (-883.547) * (-884.028) [-885.283] (-884.398) (-884.035) -- 0:01:06
83000 -- [-884.266] (-886.253) (-884.995) (-885.737) * (-884.200) (-884.807) [-886.931] (-884.419) -- 0:01:06
83500 -- (-888.643) (-886.856) (-884.688) [-884.206] * (-886.866) (-891.436) (-888.053) [-885.058] -- 0:01:05
84000 -- (-885.141) (-886.118) [-883.939] (-886.234) * [-884.028] (-883.226) (-883.810) (-882.270) -- 0:01:05
84500 -- [-883.513] (-883.100) (-885.497) (-884.412) * [-883.399] (-883.671) (-885.004) (-884.534) -- 0:01:05
85000 -- (-884.769) (-884.588) [-883.491] (-884.639) * [-884.876] (-885.037) (-885.158) (-884.161) -- 0:01:04
Average standard deviation of split frequencies: 0.028973
85500 -- (-885.200) [-884.680] (-885.134) (-883.326) * [-885.008] (-884.291) (-883.235) (-885.623) -- 0:01:04
86000 -- (-885.303) [-883.809] (-884.581) (-884.575) * (-884.325) [-884.535] (-883.233) (-884.252) -- 0:01:03
86500 -- (-887.269) (-883.472) (-885.864) [-884.446] * (-885.023) [-883.690] (-886.850) (-884.651) -- 0:01:03
87000 -- (-885.366) (-884.454) (-883.777) [-885.203] * (-883.956) [-883.251] (-885.450) (-884.034) -- 0:01:02
87500 -- [-884.699] (-883.589) (-885.919) (-885.068) * (-888.807) (-884.056) (-884.584) [-886.247] -- 0:01:02
88000 -- (-884.911) (-884.864) [-884.630] (-885.581) * (-884.852) [-883.950] (-884.850) (-884.137) -- 0:01:02
88500 -- (-887.514) (-883.310) [-884.781] (-885.226) * (-885.002) [-884.527] (-885.703) (-884.133) -- 0:01:01
89000 -- (-885.286) (-887.312) (-884.048) [-886.311] * [-884.404] (-885.239) (-889.353) (-884.756) -- 0:01:01
89500 -- (-884.192) (-884.422) (-886.288) [-884.141] * (-883.346) [-883.320] (-888.205) (-883.636) -- 0:01:01
90000 -- (-883.014) [-888.138] (-890.042) (-884.275) * (-882.752) [-883.109] (-885.319) (-883.285) -- 0:01:00
Average standard deviation of split frequencies: 0.025501
90500 -- (-885.586) (-885.245) (-883.441) [-883.887] * (-883.729) (-885.407) [-886.006] (-884.092) -- 0:01:00
91000 -- (-887.736) (-885.428) (-883.367) [-887.038] * (-882.725) (-884.581) [-886.065] (-883.096) -- 0:00:59
91500 -- (-884.800) (-884.768) (-883.158) [-885.395] * (-883.516) (-885.022) (-883.357) [-883.272] -- 0:00:59
92000 -- (-885.464) [-882.927] (-884.089) (-883.606) * (-884.043) [-883.754] (-886.806) (-884.808) -- 0:00:59
92500 -- (-892.664) (-883.301) (-883.851) [-883.548] * (-887.092) [-883.749] (-886.478) (-883.537) -- 0:00:58
93000 -- (-887.033) (-886.441) (-883.201) [-883.775] * [-884.419] (-883.422) (-884.948) (-886.535) -- 0:00:58
93500 -- (-887.201) (-886.274) (-884.013) [-882.999] * (-888.003) (-884.174) (-884.678) [-882.970] -- 0:00:58
94000 -- (-885.960) (-885.193) (-885.300) [-883.364] * (-888.373) (-883.687) [-885.740] (-885.584) -- 0:00:57
94500 -- (-887.281) (-884.124) [-883.597] (-884.072) * (-885.709) [-886.012] (-884.104) (-884.404) -- 0:00:57
95000 -- [-884.328] (-886.335) (-889.173) (-883.601) * (-883.422) (-885.391) [-883.431] (-883.763) -- 0:00:57
Average standard deviation of split frequencies: 0.025668
95500 -- [-884.165] (-886.700) (-888.265) (-883.864) * (-885.450) (-886.431) (-886.689) [-883.479] -- 0:00:56
96000 -- (-883.424) (-886.424) [-883.416] (-883.730) * (-885.645) [-883.932] (-885.566) (-883.816) -- 0:00:56
96500 -- (-885.970) (-885.753) (-884.583) [-883.576] * (-883.363) (-885.584) (-883.667) [-885.748] -- 0:00:56
97000 -- (-887.431) [-885.416] (-884.574) (-885.806) * (-884.394) (-884.626) [-883.840] (-885.269) -- 0:01:05
97500 -- (-882.775) (-883.587) [-883.325] (-883.758) * [-884.162] (-884.827) (-884.502) (-889.933) -- 0:01:04
98000 -- (-882.631) [-883.660] (-883.721) (-883.908) * (-884.354) (-886.087) (-883.486) [-885.771] -- 0:01:04
98500 -- [-882.930] (-882.859) (-884.616) (-883.038) * (-886.753) (-884.378) [-885.276] (-885.226) -- 0:01:04
99000 -- (-884.946) (-887.865) (-882.344) [-883.171] * (-884.582) (-886.023) (-883.033) [-883.212] -- 0:01:03
99500 -- [-887.566] (-884.325) (-884.122) (-884.943) * [-883.267] (-883.179) (-883.587) (-885.668) -- 0:01:03
100000 -- (-884.893) (-884.666) [-885.807] (-882.894) * (-884.949) [-885.254] (-885.568) (-887.827) -- 0:01:02
Average standard deviation of split frequencies: 0.025386
100500 -- (-884.591) [-883.102] (-885.008) (-883.475) * (-884.727) (-886.088) (-883.224) [-884.547] -- 0:01:02
101000 -- (-887.213) [-884.677] (-889.677) (-888.766) * (-886.603) (-884.608) [-883.491] (-884.626) -- 0:01:02
101500 -- (-884.267) (-882.936) (-890.834) [-884.239] * (-890.641) [-885.975] (-886.376) (-883.815) -- 0:01:01
102000 -- (-886.972) (-886.199) (-888.753) [-882.970] * (-895.013) (-883.247) [-884.457] (-886.120) -- 0:01:01
102500 -- (-885.745) (-883.112) (-883.995) [-885.288] * [-893.084] (-885.386) (-884.793) (-883.822) -- 0:01:01
103000 -- (-886.218) [-884.128] (-883.354) (-884.983) * (-890.520) (-884.610) (-884.217) [-882.423] -- 0:01:00
103500 -- (-884.451) [-882.841] (-885.301) (-882.557) * [-887.030] (-885.467) (-883.973) (-885.554) -- 0:01:00
104000 -- (-885.270) (-883.608) (-882.701) [-884.853] * (-884.051) (-888.027) (-883.885) [-884.299] -- 0:01:00
104500 -- (-883.830) (-884.335) (-883.768) [-884.117] * (-886.182) [-883.385] (-884.068) (-885.816) -- 0:00:59
105000 -- (-883.422) (-885.864) [-883.273] (-882.981) * (-885.619) (-883.935) (-882.802) [-883.821] -- 0:00:59
Average standard deviation of split frequencies: 0.024055
105500 -- (-883.960) (-886.887) [-882.991] (-885.976) * (-887.869) [-883.370] (-884.991) (-882.428) -- 0:00:59
106000 -- (-884.649) (-884.425) [-882.781] (-882.734) * (-886.413) (-885.498) (-885.481) [-886.366] -- 0:00:59
106500 -- (-886.423) [-886.091] (-882.550) (-882.874) * (-885.438) [-885.811] (-884.011) (-883.151) -- 0:00:58
107000 -- (-887.607) (-885.344) [-883.846] (-884.593) * (-883.565) (-888.622) (-885.561) [-884.511] -- 0:00:58
107500 -- [-884.535] (-889.617) (-883.519) (-885.161) * (-884.213) (-884.293) (-882.612) [-885.395] -- 0:00:58
108000 -- (-888.909) [-892.008] (-884.171) (-883.643) * [-885.189] (-884.224) (-883.739) (-883.375) -- 0:00:57
108500 -- (-886.366) [-887.075] (-886.334) (-883.285) * (-887.131) (-887.094) (-884.712) [-883.861] -- 0:00:57
109000 -- (-888.303) (-884.891) [-882.421] (-884.256) * (-891.728) (-884.306) [-884.927] (-883.151) -- 0:00:57
109500 -- (-884.372) (-884.671) (-884.925) [-884.398] * (-886.762) (-882.853) (-882.635) [-883.513] -- 0:00:56
110000 -- [-883.217] (-884.202) (-883.133) (-884.300) * (-886.220) (-886.567) [-886.783] (-888.351) -- 0:00:56
Average standard deviation of split frequencies: 0.023732
110500 -- (-886.239) [-883.646] (-883.608) (-884.972) * (-887.371) [-883.341] (-885.288) (-886.130) -- 0:00:56
111000 -- (-883.129) (-885.400) (-882.570) [-882.878] * (-886.872) [-883.412] (-885.139) (-885.479) -- 0:00:56
111500 -- (-884.895) [-883.794] (-884.254) (-882.679) * (-884.518) [-884.082] (-885.867) (-884.106) -- 0:00:55
112000 -- [-883.462] (-884.428) (-884.686) (-882.680) * (-885.304) (-885.268) [-885.368] (-885.809) -- 0:00:55
112500 -- (-884.480) (-884.143) (-883.387) [-884.926] * (-885.211) (-883.414) (-886.311) [-884.429] -- 0:00:55
113000 -- [-884.731] (-887.648) (-884.757) (-883.161) * [-883.110] (-884.500) (-884.662) (-882.654) -- 0:00:54
113500 -- [-884.132] (-884.319) (-883.640) (-885.389) * (-884.051) (-886.358) (-886.244) [-883.541] -- 0:01:02
114000 -- (-883.061) (-882.967) (-886.176) [-883.594] * (-884.335) [-885.292] (-885.396) (-889.728) -- 0:01:02
114500 -- (-884.261) (-885.179) [-885.604] (-883.004) * [-885.684] (-884.717) (-887.533) (-888.034) -- 0:01:01
115000 -- (-883.402) (-886.204) [-884.213] (-883.214) * [-886.821] (-884.266) (-883.635) (-887.220) -- 0:01:01
Average standard deviation of split frequencies: 0.023415
115500 -- (-883.175) (-884.594) [-886.548] (-885.018) * (-884.991) (-884.011) (-888.692) [-887.471] -- 0:01:01
116000 -- (-884.374) [-885.668] (-883.578) (-889.462) * (-886.671) (-883.608) (-883.223) [-884.911] -- 0:01:00
116500 -- (-884.241) (-885.851) (-886.547) [-885.908] * [-883.319] (-883.317) (-884.207) (-889.071) -- 0:01:00
117000 -- (-884.325) (-884.653) (-886.088) [-883.728] * [-884.196] (-884.910) (-883.419) (-885.143) -- 0:01:00
117500 -- [-886.854] (-884.297) (-883.138) (-884.953) * (-884.941) (-882.343) [-883.593] (-889.369) -- 0:01:00
118000 -- (-885.640) [-883.386] (-885.750) (-891.041) * [-884.393] (-883.883) (-884.537) (-887.945) -- 0:00:59
118500 -- (-883.813) (-885.447) (-886.228) [-886.342] * [-883.670] (-885.483) (-884.736) (-884.490) -- 0:00:59
119000 -- (-884.112) [-884.589] (-885.091) (-884.372) * [-883.665] (-886.329) (-886.992) (-883.756) -- 0:00:59
119500 -- (-887.541) [-886.958] (-886.729) (-886.079) * (-883.366) (-883.945) [-885.606] (-883.272) -- 0:00:58
120000 -- (-887.153) (-885.094) (-883.318) [-882.688] * (-887.602) (-882.796) (-885.438) [-883.379] -- 0:00:58
Average standard deviation of split frequencies: 0.022324
120500 -- (-882.310) (-883.814) [-883.103] (-884.248) * (-884.065) (-885.624) (-886.050) [-883.844] -- 0:00:58
121000 -- (-893.557) (-886.114) (-885.959) [-882.807] * (-884.130) (-884.466) [-885.344] (-885.907) -- 0:00:58
121500 -- [-886.396] (-883.571) (-886.954) (-882.963) * (-886.196) [-883.218] (-884.446) (-886.135) -- 0:00:57
122000 -- (-884.154) [-885.224] (-886.263) (-882.965) * [-884.343] (-884.315) (-883.581) (-883.902) -- 0:00:57
122500 -- (-884.235) (-883.580) (-885.197) [-883.776] * (-883.864) [-883.766] (-883.136) (-889.807) -- 0:00:57
123000 -- (-886.730) (-885.576) [-884.987] (-884.264) * (-882.866) (-884.702) (-883.101) [-885.605] -- 0:00:57
123500 -- (-885.896) (-883.835) [-883.666] (-886.314) * (-885.423) (-891.065) (-882.959) [-885.702] -- 0:00:56
124000 -- (-888.689) (-885.577) [-883.907] (-883.305) * (-885.067) (-884.886) (-885.369) [-882.427] -- 0:00:56
124500 -- [-883.335] (-883.048) (-883.160) (-882.311) * [-886.115] (-885.774) (-886.452) (-882.721) -- 0:00:56
125000 -- [-884.392] (-885.306) (-886.380) (-890.925) * (-883.543) (-886.139) [-883.914] (-885.382) -- 0:00:56
Average standard deviation of split frequencies: 0.021427
125500 -- (-884.605) (-884.117) (-887.618) [-884.189] * (-884.645) (-882.942) [-883.148] (-883.137) -- 0:00:55
126000 -- (-886.935) [-889.097] (-885.425) (-884.170) * (-884.025) (-883.179) (-885.519) [-886.529] -- 0:00:55
126500 -- (-883.603) (-884.518) [-887.484] (-887.691) * (-883.420) (-882.894) [-882.636] (-890.060) -- 0:00:55
127000 -- [-887.557] (-885.991) (-884.884) (-883.654) * (-885.396) (-882.891) (-886.546) [-887.347] -- 0:00:54
127500 -- [-883.109] (-884.954) (-883.413) (-883.429) * (-884.334) [-884.974] (-884.177) (-886.908) -- 0:00:54
128000 -- (-883.973) (-887.481) [-883.540] (-884.957) * (-886.057) (-884.833) [-885.610] (-887.341) -- 0:00:54
128500 -- (-884.669) (-884.162) (-883.341) [-887.297] * [-884.492] (-886.062) (-883.186) (-883.179) -- 0:00:54
129000 -- (-888.217) (-887.696) (-887.450) [-886.142] * [-884.554] (-884.373) (-887.913) (-886.110) -- 0:00:54
129500 -- (-886.998) [-885.456] (-884.012) (-889.087) * [-884.995] (-886.954) (-893.019) (-888.070) -- 0:00:53
130000 -- [-888.112] (-885.561) (-883.703) (-889.725) * [-887.241] (-884.356) (-884.880) (-884.374) -- 0:00:53
Average standard deviation of split frequencies: 0.021646
130500 -- (-883.080) (-883.794) [-890.597] (-889.580) * [-887.959] (-885.755) (-883.035) (-883.884) -- 0:00:59
131000 -- (-884.566) (-884.893) [-889.950] (-883.835) * (-884.276) [-886.108] (-884.546) (-884.468) -- 0:00:59
131500 -- [-885.936] (-887.149) (-884.577) (-885.844) * (-887.828) (-889.476) (-883.434) [-883.484] -- 0:00:59
132000 -- (-884.557) (-884.005) [-884.213] (-882.624) * (-886.296) [-887.173] (-889.112) (-883.007) -- 0:00:59
132500 -- (-884.028) [-884.502] (-883.759) (-885.792) * (-882.609) [-885.571] (-889.442) (-884.947) -- 0:00:58
133000 -- (-884.632) (-884.223) (-885.019) [-883.493] * (-882.375) (-884.879) [-889.197] (-884.305) -- 0:00:58
133500 -- (-886.446) (-889.581) [-884.503] (-884.266) * [-882.975] (-886.806) (-888.281) (-883.937) -- 0:00:58
134000 -- (-884.433) (-892.786) [-885.619] (-887.270) * (-882.738) [-890.085] (-885.285) (-883.586) -- 0:00:58
134500 -- (-883.715) (-885.713) (-888.499) [-885.160] * [-884.878] (-887.800) (-885.394) (-884.237) -- 0:00:57
135000 -- [-885.751] (-888.815) (-883.930) (-884.180) * [-886.860] (-887.971) (-886.527) (-887.725) -- 0:00:57
Average standard deviation of split frequencies: 0.019064
135500 -- [-890.062] (-883.968) (-885.401) (-884.430) * (-887.954) (-887.571) (-884.470) [-883.652] -- 0:00:57
136000 -- [-883.842] (-885.629) (-883.384) (-885.990) * [-885.164] (-886.497) (-889.287) (-883.672) -- 0:00:57
136500 -- [-884.455] (-882.993) (-883.775) (-885.130) * (-885.967) [-884.665] (-884.140) (-883.774) -- 0:00:56
137000 -- (-883.408) [-882.288] (-884.596) (-884.948) * [-883.421] (-885.232) (-882.923) (-886.256) -- 0:00:56
137500 -- [-882.759] (-883.338) (-889.367) (-884.136) * (-884.184) (-886.582) (-884.864) [-886.543] -- 0:00:56
138000 -- (-882.380) [-883.705] (-893.031) (-884.756) * (-884.004) (-885.188) [-886.733] (-885.888) -- 0:00:56
138500 -- (-883.207) [-883.910] (-886.415) (-887.784) * (-882.604) [-887.300] (-886.183) (-885.803) -- 0:00:55
139000 -- (-883.495) (-883.825) [-886.430] (-884.562) * (-883.889) (-884.261) [-886.247] (-886.268) -- 0:00:55
139500 -- (-883.348) (-888.815) [-883.479] (-883.784) * [-883.261] (-884.295) (-889.643) (-886.050) -- 0:00:55
140000 -- [-886.299] (-885.926) (-884.561) (-883.502) * [-883.746] (-884.602) (-883.097) (-887.180) -- 0:00:55
Average standard deviation of split frequencies: 0.019225
140500 -- [-883.671] (-885.816) (-884.405) (-884.388) * (-883.527) [-884.906] (-883.612) (-885.132) -- 0:00:55
141000 -- (-883.201) [-883.404] (-884.626) (-882.763) * (-883.626) (-885.563) [-883.183] (-884.732) -- 0:00:54
141500 -- [-884.611] (-882.562) (-884.045) (-883.566) * (-884.941) (-884.062) (-882.900) [-884.168] -- 0:00:54
142000 -- (-884.036) [-884.471] (-886.407) (-886.254) * (-884.793) (-882.796) (-883.532) [-884.571] -- 0:00:54
142500 -- (-885.117) [-884.648] (-886.874) (-887.046) * (-886.441) (-884.074) (-883.705) [-882.869] -- 0:00:54
143000 -- (-883.841) [-887.133] (-886.327) (-888.918) * (-884.424) (-884.258) [-884.134] (-884.786) -- 0:00:53
143500 -- (-883.672) (-884.199) [-888.333] (-886.546) * (-882.821) (-882.555) [-884.744] (-885.303) -- 0:00:53
144000 -- [-883.911] (-886.529) (-890.220) (-886.422) * [-884.053] (-882.519) (-884.230) (-886.429) -- 0:00:53
144500 -- [-883.484] (-886.048) (-886.478) (-885.680) * (-884.567) (-886.757) (-887.272) [-883.328] -- 0:00:53
145000 -- (-883.609) [-884.934] (-885.467) (-884.439) * (-885.763) [-884.686] (-886.319) (-883.113) -- 0:00:53
Average standard deviation of split frequencies: 0.018052
145500 -- (-885.789) (-884.543) [-885.654] (-885.027) * [-884.097] (-883.436) (-886.115) (-885.239) -- 0:00:52
146000 -- [-885.028] (-885.182) (-884.028) (-882.953) * (-887.779) (-883.892) [-886.505] (-884.415) -- 0:00:52
146500 -- (-883.661) (-885.799) (-884.066) [-886.497] * (-882.520) [-888.791] (-888.138) (-886.174) -- 0:00:52
147000 -- (-886.504) (-885.059) (-887.329) [-883.554] * [-885.661] (-887.570) (-889.373) (-884.685) -- 0:00:58
147500 -- (-883.691) (-882.616) [-884.340] (-886.661) * [-884.735] (-885.899) (-891.371) (-885.145) -- 0:00:57
148000 -- (-885.822) [-884.704] (-888.879) (-886.966) * (-892.342) [-885.920] (-889.905) (-886.740) -- 0:00:57
148500 -- (-884.026) (-883.993) [-884.096] (-885.609) * (-886.136) [-884.505] (-885.577) (-885.039) -- 0:00:57
149000 -- (-883.583) (-885.566) [-883.188] (-888.436) * (-883.543) (-885.406) (-886.121) [-886.286] -- 0:00:57
149500 -- (-883.388) (-887.629) (-883.208) [-889.215] * (-883.845) [-885.524] (-883.422) (-891.378) -- 0:00:56
150000 -- (-884.131) [-884.505] (-883.618) (-883.503) * (-883.843) [-884.374] (-883.693) (-884.458) -- 0:00:56
Average standard deviation of split frequencies: 0.018028
150500 -- [-883.558] (-882.943) (-883.579) (-884.670) * [-884.827] (-884.109) (-883.173) (-884.366) -- 0:00:56
151000 -- (-883.411) (-889.802) (-884.236) [-883.474] * (-891.637) [-884.339] (-882.870) (-884.370) -- 0:00:56
151500 -- [-882.865] (-887.180) (-882.853) (-883.701) * [-889.166] (-884.287) (-885.324) (-885.578) -- 0:00:56
152000 -- (-883.149) [-884.948] (-883.153) (-886.072) * (-886.253) [-885.890] (-884.863) (-885.190) -- 0:00:55
152500 -- [-883.439] (-882.805) (-884.074) (-883.762) * (-884.339) (-884.203) (-884.608) [-886.200] -- 0:00:55
153000 -- [-884.438] (-884.121) (-884.786) (-883.557) * (-885.825) [-882.774] (-885.214) (-883.521) -- 0:00:55
153500 -- (-885.227) (-886.683) [-884.588] (-884.518) * (-884.064) (-884.215) (-884.902) [-883.028] -- 0:00:55
154000 -- [-886.467] (-888.628) (-883.021) (-884.926) * [-884.861] (-885.120) (-883.638) (-883.635) -- 0:00:54
154500 -- (-886.363) (-886.610) [-885.667] (-890.716) * [-886.115] (-883.148) (-888.805) (-888.345) -- 0:00:54
155000 -- (-886.168) [-884.381] (-887.443) (-889.932) * (-884.980) [-882.323] (-893.371) (-884.777) -- 0:00:54
Average standard deviation of split frequencies: 0.016318
155500 -- (-888.570) (-883.891) (-882.755) [-886.709] * (-889.528) (-883.243) (-885.977) [-884.842] -- 0:00:54
156000 -- (-886.494) [-889.149] (-883.158) (-890.199) * [-885.750] (-882.733) (-884.459) (-883.663) -- 0:00:54
156500 -- (-883.406) [-884.323] (-883.517) (-884.419) * (-884.063) (-888.450) (-884.748) [-883.272] -- 0:00:53
157000 -- (-887.965) [-885.336] (-884.945) (-883.246) * (-883.931) (-888.540) [-883.387] (-884.814) -- 0:00:53
157500 -- (-884.665) [-882.780] (-884.928) (-884.769) * (-882.765) [-887.145] (-884.764) (-884.837) -- 0:00:53
158000 -- (-884.029) (-885.829) (-883.435) [-885.589] * (-882.647) (-885.408) [-884.031] (-883.175) -- 0:00:53
158500 -- (-885.655) (-889.913) [-883.739] (-886.282) * (-883.897) (-883.117) [-884.881] (-890.089) -- 0:00:53
159000 -- (-886.406) (-894.867) [-883.003] (-882.606) * [-886.699] (-882.626) (-886.484) (-889.396) -- 0:00:52
159500 -- (-886.857) (-888.172) [-884.448] (-882.835) * [-886.265] (-882.273) (-883.005) (-888.596) -- 0:00:52
160000 -- (-887.271) (-886.050) [-883.763] (-882.837) * (-887.211) [-885.838] (-888.190) (-888.989) -- 0:00:52
Average standard deviation of split frequencies: 0.017767
160500 -- (-886.226) (-884.132) (-886.600) [-883.357] * (-883.319) [-883.569] (-884.563) (-885.684) -- 0:00:52
161000 -- (-883.892) (-883.539) (-884.306) [-883.712] * (-883.709) [-883.631] (-883.054) (-888.219) -- 0:00:52
161500 -- (-882.697) (-886.200) (-889.393) [-884.655] * (-884.003) [-884.595] (-883.300) (-886.118) -- 0:00:51
162000 -- (-884.446) (-888.484) (-887.949) [-883.970] * (-884.529) (-884.204) [-883.319] (-886.194) -- 0:00:51
162500 -- (-885.699) (-884.151) (-886.581) [-884.980] * [-884.944] (-883.870) (-885.051) (-885.922) -- 0:00:51
163000 -- (-885.763) [-884.198] (-883.801) (-884.970) * (-884.947) (-883.533) [-883.642] (-888.544) -- 0:00:51
163500 -- (-885.580) [-884.137] (-885.672) (-886.032) * [-884.666] (-883.468) (-884.609) (-888.701) -- 0:00:56
164000 -- (-886.216) (-882.630) [-884.987] (-885.409) * [-883.994] (-884.738) (-885.387) (-886.473) -- 0:00:56
164500 -- (-891.038) (-887.321) (-884.526) [-885.978] * [-884.808] (-882.961) (-884.245) (-882.546) -- 0:00:55
165000 -- [-886.823] (-884.851) (-883.078) (-884.618) * [-884.083] (-885.591) (-887.749) (-884.033) -- 0:00:55
Average standard deviation of split frequencies: 0.017181
165500 -- (-883.092) [-886.954] (-888.112) (-884.081) * (-884.805) (-888.167) (-887.888) [-886.529] -- 0:00:55
166000 -- [-885.034] (-884.114) (-889.711) (-886.747) * [-883.845] (-886.557) (-887.254) (-884.791) -- 0:00:55
166500 -- (-887.631) (-884.962) (-886.400) [-884.464] * (-884.508) [-883.227] (-890.344) (-882.733) -- 0:00:55
167000 -- (-887.516) [-884.475] (-888.244) (-885.750) * [-885.455] (-884.514) (-885.031) (-885.024) -- 0:00:54
167500 -- (-885.247) (-884.623) (-887.302) [-886.838] * (-883.131) [-887.145] (-885.734) (-885.818) -- 0:00:54
168000 -- [-884.640] (-882.753) (-883.976) (-884.561) * (-886.456) [-883.714] (-886.880) (-889.894) -- 0:00:54
168500 -- (-885.507) [-883.407] (-887.065) (-882.622) * (-884.195) (-887.073) [-885.454] (-888.528) -- 0:00:54
169000 -- (-889.683) (-883.646) [-883.198] (-884.118) * [-886.854] (-885.830) (-884.503) (-883.501) -- 0:00:54
169500 -- (-884.047) [-883.441] (-885.251) (-884.490) * (-883.247) [-884.804] (-883.973) (-883.644) -- 0:00:53
170000 -- (-884.742) [-884.111] (-887.176) (-884.268) * (-885.259) [-882.821] (-885.369) (-887.960) -- 0:00:53
Average standard deviation of split frequencies: 0.018899
170500 -- (-886.463) (-883.510) [-883.689] (-884.864) * (-885.641) (-884.004) (-884.014) [-883.271] -- 0:00:53
171000 -- (-886.196) (-884.102) (-883.943) [-883.195] * (-888.863) [-882.684] (-885.204) (-885.389) -- 0:00:53
171500 -- [-883.443] (-882.707) (-883.009) (-886.349) * (-888.057) [-885.405] (-883.460) (-884.841) -- 0:00:53
172000 -- (-884.779) [-882.713] (-886.836) (-882.707) * (-884.583) (-886.938) (-883.936) [-883.406] -- 0:00:52
172500 -- (-883.490) (-884.500) (-884.210) [-883.861] * [-883.933] (-887.498) (-884.168) (-885.697) -- 0:00:52
173000 -- [-884.802] (-884.113) (-887.460) (-885.185) * (-884.447) (-885.471) [-886.135] (-887.509) -- 0:00:52
173500 -- [-883.978] (-884.240) (-883.022) (-885.558) * [-883.014] (-883.850) (-882.923) (-888.969) -- 0:00:52
174000 -- (-887.608) (-884.605) [-887.891] (-888.061) * (-884.620) [-883.865] (-884.427) (-886.047) -- 0:00:52
174500 -- [-884.851] (-886.250) (-889.683) (-883.982) * [-883.862] (-885.750) (-884.719) (-884.559) -- 0:00:52
175000 -- [-883.984] (-884.746) (-886.363) (-884.439) * (-883.603) (-887.722) [-883.650] (-885.555) -- 0:00:51
Average standard deviation of split frequencies: 0.018185
175500 -- (-882.914) (-885.695) [-885.314] (-885.778) * (-884.790) [-884.935] (-887.636) (-886.661) -- 0:00:51
176000 -- (-885.008) (-885.660) (-884.599) [-885.850] * (-886.111) [-884.202] (-885.942) (-885.726) -- 0:00:51
176500 -- [-886.820] (-885.772) (-885.863) (-887.386) * [-885.188] (-883.366) (-882.794) (-888.271) -- 0:00:51
177000 -- (-883.713) (-882.704) [-887.691] (-885.831) * (-883.141) (-882.615) [-883.155] (-883.282) -- 0:00:51
177500 -- (-890.241) [-885.250] (-884.398) (-885.808) * (-884.873) (-883.638) [-883.162] (-885.370) -- 0:00:50
178000 -- [-887.747] (-884.183) (-884.720) (-882.872) * (-885.700) [-883.494] (-883.157) (-889.928) -- 0:00:50
178500 -- (-884.756) (-882.808) [-883.537] (-883.767) * [-886.463] (-884.159) (-884.326) (-886.494) -- 0:00:50
179000 -- [-882.754] (-883.822) (-885.991) (-884.500) * (-883.133) (-885.628) [-883.086] (-883.376) -- 0:00:50
179500 -- (-884.169) [-884.958] (-886.942) (-883.371) * (-884.220) (-884.883) (-884.812) [-883.760] -- 0:00:50
180000 -- (-884.638) (-884.254) [-884.226] (-892.134) * (-882.644) (-882.708) (-884.011) [-883.982] -- 0:00:54
Average standard deviation of split frequencies: 0.015930
180500 -- (-886.350) (-886.123) [-883.063] (-889.184) * (-885.853) (-889.786) (-884.915) [-883.840] -- 0:00:54
181000 -- [-883.249] (-885.611) (-883.926) (-885.175) * [-886.169] (-886.180) (-886.784) (-883.228) -- 0:00:54
181500 -- [-887.062] (-884.490) (-884.951) (-888.501) * [-884.238] (-885.304) (-884.408) (-892.016) -- 0:00:54
182000 -- (-884.560) [-883.724] (-886.023) (-883.912) * [-883.121] (-885.014) (-883.375) (-887.091) -- 0:00:53
182500 -- (-886.470) (-885.222) (-882.691) [-883.941] * [-887.782] (-882.862) (-884.201) (-883.649) -- 0:00:53
183000 -- (-884.255) [-885.774] (-883.493) (-883.401) * (-886.790) (-882.897) [-884.028] (-885.047) -- 0:00:53
183500 -- [-882.969] (-885.791) (-883.653) (-883.148) * (-884.719) (-882.850) [-884.381] (-889.221) -- 0:00:53
184000 -- (-883.583) (-884.482) (-885.601) [-884.997] * (-883.258) (-884.629) [-885.751] (-884.724) -- 0:00:53
184500 -- (-884.419) [-883.331] (-885.373) (-885.195) * (-884.835) [-883.956] (-884.114) (-885.837) -- 0:00:53
185000 -- (-883.919) (-884.829) (-884.055) [-883.432] * [-883.277] (-884.643) (-885.180) (-885.495) -- 0:00:52
Average standard deviation of split frequencies: 0.015207
185500 -- (-883.276) (-886.644) (-888.599) [-883.293] * (-887.033) (-885.035) [-883.739] (-883.517) -- 0:00:52
186000 -- (-882.927) (-885.321) [-887.762] (-885.205) * (-886.216) (-884.957) (-882.443) [-886.080] -- 0:00:52
186500 -- (-883.773) [-883.347] (-886.309) (-884.321) * (-885.634) [-884.124] (-884.369) (-887.333) -- 0:00:52
187000 -- (-883.429) (-883.460) [-885.526] (-884.905) * [-884.315] (-884.359) (-884.073) (-884.574) -- 0:00:52
187500 -- (-884.984) (-883.674) [-886.172] (-883.561) * (-886.034) (-885.694) (-883.909) [-885.133] -- 0:00:52
188000 -- [-884.086] (-886.025) (-883.733) (-882.581) * (-888.696) (-885.334) [-884.317] (-884.318) -- 0:00:51
188500 -- (-884.465) [-884.111] (-883.022) (-884.972) * (-885.494) [-885.564] (-884.004) (-886.144) -- 0:00:51
189000 -- (-885.706) (-884.687) (-885.296) [-884.846] * (-884.779) (-886.039) [-882.732] (-884.579) -- 0:00:51
189500 -- (-884.657) (-885.840) (-883.294) [-884.943] * [-882.997] (-886.698) (-882.959) (-882.601) -- 0:00:51
190000 -- (-887.848) [-883.358] (-884.385) (-884.976) * (-885.267) (-883.145) [-884.488] (-884.334) -- 0:00:51
Average standard deviation of split frequencies: 0.016483
190500 -- (-886.871) (-884.034) (-885.350) [-883.539] * [-883.569] (-883.780) (-884.304) (-884.221) -- 0:00:50
191000 -- [-887.351] (-884.411) (-886.630) (-883.942) * (-884.675) (-883.874) [-884.244] (-884.313) -- 0:00:50
191500 -- (-887.961) [-884.702] (-885.931) (-886.156) * (-883.619) (-883.963) [-885.073] (-886.260) -- 0:00:50
192000 -- (-886.157) [-887.577] (-884.395) (-887.044) * (-883.546) [-886.624] (-883.399) (-886.556) -- 0:00:50
192500 -- [-884.408] (-889.704) (-885.710) (-883.123) * [-884.226] (-885.290) (-883.505) (-884.197) -- 0:00:50
193000 -- (-883.786) (-883.811) [-883.486] (-884.415) * (-886.353) (-886.510) [-883.941] (-882.427) -- 0:00:50
193500 -- (-886.067) (-884.038) (-884.892) [-882.885] * [-884.971] (-886.049) (-885.892) (-882.913) -- 0:00:50
194000 -- (-882.746) (-883.571) (-886.299) [-883.021] * (-884.510) (-886.360) [-883.266] (-890.493) -- 0:00:49
194500 -- (-885.413) (-886.369) [-885.536] (-883.157) * (-884.341) (-886.017) [-883.505] (-884.278) -- 0:00:49
195000 -- (-885.770) (-886.263) (-885.977) [-886.434] * (-883.174) (-887.070) (-883.278) [-883.040] -- 0:00:49
Average standard deviation of split frequencies: 0.014811
195500 -- (-883.424) (-884.856) (-884.679) [-883.593] * (-884.244) (-885.981) [-883.177] (-886.793) -- 0:00:49
196000 -- (-883.296) (-882.865) [-886.522] (-884.049) * (-882.638) (-885.407) [-885.738] (-884.397) -- 0:00:49
196500 -- (-883.107) (-884.144) [-886.220] (-886.103) * (-884.759) [-885.070] (-888.191) (-884.348) -- 0:00:49
197000 -- (-888.840) [-885.154] (-887.668) (-884.987) * (-884.143) (-884.316) (-884.197) [-884.031] -- 0:00:52
197500 -- (-887.349) (-885.837) [-888.071] (-887.605) * [-882.521] (-886.249) (-885.707) (-884.738) -- 0:00:52
198000 -- (-885.949) (-884.984) (-885.288) [-882.881] * [-882.799] (-885.676) (-887.343) (-883.671) -- 0:00:52
198500 -- (-883.748) [-883.487] (-883.662) (-884.279) * (-882.820) (-884.937) (-888.686) [-883.709] -- 0:00:52
199000 -- (-883.322) [-883.689] (-886.226) (-884.822) * [-884.403] (-887.315) (-887.886) (-885.641) -- 0:00:52
199500 -- [-884.262] (-883.617) (-885.563) (-883.707) * (-885.561) (-885.040) (-884.694) [-885.675] -- 0:00:52
200000 -- [-884.279] (-885.509) (-883.711) (-883.929) * (-887.180) [-884.397] (-884.698) (-882.520) -- 0:00:51
Average standard deviation of split frequencies: 0.014219
200500 -- (-883.677) [-884.745] (-887.266) (-883.636) * (-885.983) (-884.240) (-886.288) [-883.750] -- 0:00:51
201000 -- [-882.392] (-887.863) (-886.192) (-887.952) * [-886.247] (-883.498) (-886.084) (-883.593) -- 0:00:51
201500 -- (-882.569) (-889.856) (-886.615) [-883.307] * (-883.356) (-883.299) (-885.694) [-883.369] -- 0:00:51
202000 -- (-884.612) [-887.669] (-885.133) (-883.780) * (-885.671) (-882.896) [-886.313] (-886.492) -- 0:00:51
202500 -- (-885.046) [-883.837] (-883.019) (-883.439) * (-884.558) [-882.646] (-885.759) (-884.360) -- 0:00:51
203000 -- (-884.229) (-886.454) [-883.975] (-883.677) * (-882.813) (-883.358) (-883.893) [-885.407] -- 0:00:51
203500 -- (-884.112) (-885.839) (-888.323) [-884.624] * [-883.095] (-883.233) (-883.514) (-885.420) -- 0:00:50
204000 -- (-883.195) (-885.674) (-882.686) [-884.987] * [-884.415] (-883.929) (-883.984) (-883.953) -- 0:00:50
204500 -- [-883.248] (-886.521) (-883.803) (-885.857) * (-883.780) (-883.290) [-884.019] (-883.746) -- 0:00:50
205000 -- [-885.843] (-883.719) (-886.810) (-890.070) * (-883.720) (-884.803) [-883.647] (-883.924) -- 0:00:50
Average standard deviation of split frequencies: 0.014989
205500 -- (-884.324) [-883.785] (-888.144) (-889.087) * (-890.597) (-884.268) [-884.914] (-888.160) -- 0:00:50
206000 -- (-885.974) (-884.334) (-885.123) [-883.694] * (-888.423) (-883.215) (-884.840) [-887.445] -- 0:00:50
206500 -- (-885.413) [-883.140] (-885.367) (-889.649) * [-886.033] (-884.624) (-883.816) (-890.015) -- 0:00:49
207000 -- (-885.119) (-882.887) [-883.582] (-888.146) * [-885.916] (-890.485) (-883.590) (-886.277) -- 0:00:49
207500 -- (-884.740) (-884.649) (-888.031) [-883.736] * [-884.781] (-892.244) (-885.904) (-883.764) -- 0:00:49
208000 -- (-888.124) (-884.649) [-883.223] (-883.416) * (-885.918) (-889.049) (-887.514) [-886.750] -- 0:00:49
208500 -- (-888.890) (-885.204) [-882.312] (-883.559) * (-883.034) (-888.238) (-886.649) [-884.140] -- 0:00:49
209000 -- [-885.611] (-885.193) (-884.039) (-884.915) * [-884.235] (-886.713) (-887.848) (-882.643) -- 0:00:49
209500 -- (-886.825) (-885.753) [-883.665] (-887.149) * (-882.690) (-884.327) (-884.254) [-884.000] -- 0:00:49
210000 -- [-882.697] (-884.584) (-888.457) (-886.257) * (-883.532) (-882.567) [-883.833] (-883.442) -- 0:00:48
Average standard deviation of split frequencies: 0.014918
210500 -- (-884.265) (-884.602) [-882.993] (-886.317) * [-882.727] (-883.549) (-884.485) (-884.011) -- 0:00:48
211000 -- (-884.184) (-883.074) (-885.676) [-885.422] * [-884.849] (-883.897) (-884.228) (-885.715) -- 0:00:48
211500 -- (-883.800) (-883.020) [-884.643] (-883.647) * [-883.686] (-882.840) (-884.049) (-884.700) -- 0:00:48
212000 -- (-883.040) [-887.859] (-882.738) (-883.303) * (-883.433) [-882.997] (-884.327) (-885.123) -- 0:00:48
212500 -- [-884.155] (-886.513) (-889.980) (-884.659) * (-884.615) (-882.858) [-885.356] (-883.593) -- 0:00:48
213000 -- (-884.036) (-885.112) (-885.842) [-883.935] * (-885.371) (-882.891) [-884.812] (-886.367) -- 0:00:48
213500 -- (-883.857) (-885.713) (-884.252) [-883.803] * (-885.931) (-883.541) (-886.769) [-883.752] -- 0:00:47
214000 -- (-883.295) (-885.997) (-885.009) [-882.610] * (-882.892) (-883.629) [-884.657] (-884.116) -- 0:00:51
214500 -- (-884.474) (-885.537) [-883.691] (-883.868) * (-883.639) (-885.770) [-885.764] (-882.459) -- 0:00:51
215000 -- (-883.544) [-884.362] (-884.730) (-883.124) * (-883.008) (-884.309) [-885.440] (-884.516) -- 0:00:51
Average standard deviation of split frequencies: 0.015277
215500 -- (-882.402) (-886.285) (-884.952) [-883.049] * (-889.353) [-882.348] (-884.131) (-883.741) -- 0:00:50
216000 -- (-882.324) (-885.273) (-883.520) [-883.355] * (-887.250) (-883.010) (-884.154) [-885.535] -- 0:00:50
216500 -- (-883.272) (-886.246) [-884.099] (-883.341) * (-891.298) (-884.505) (-884.639) [-883.889] -- 0:00:50
217000 -- (-883.280) [-883.365] (-883.923) (-883.693) * (-891.917) (-884.217) [-883.749] (-885.820) -- 0:00:50
217500 -- (-883.727) (-884.855) (-883.872) [-885.810] * (-888.229) [-883.938] (-883.701) (-885.812) -- 0:00:50
218000 -- (-882.490) [-883.818] (-883.494) (-886.671) * (-885.570) (-884.180) (-883.970) [-887.041] -- 0:00:50
218500 -- (-882.828) (-884.033) (-887.550) [-884.340] * (-884.398) [-886.371] (-884.556) (-885.127) -- 0:00:50
219000 -- (-884.305) (-885.325) [-885.215] (-883.832) * (-891.927) [-884.673] (-884.697) (-883.775) -- 0:00:49
219500 -- (-884.246) (-885.388) [-882.495] (-885.417) * (-887.720) [-884.789] (-883.864) (-886.105) -- 0:00:49
220000 -- (-884.233) (-882.802) (-882.646) [-882.538] * (-887.019) (-887.748) [-884.291] (-884.194) -- 0:00:49
Average standard deviation of split frequencies: 0.014954
220500 -- [-887.311] (-882.302) (-882.749) (-883.721) * (-888.400) [-884.796] (-883.242) (-891.063) -- 0:00:49
221000 -- (-885.848) (-887.029) [-883.904] (-884.836) * (-884.201) (-884.879) (-885.638) [-883.618] -- 0:00:49
221500 -- (-885.699) (-884.999) (-886.057) [-886.599] * (-887.672) (-882.438) (-883.451) [-883.554] -- 0:00:49
222000 -- (-885.254) (-885.409) (-888.022) [-885.354] * (-884.487) [-882.515] (-885.934) (-883.110) -- 0:00:49
222500 -- [-883.777] (-885.703) (-886.403) (-886.922) * (-884.891) [-882.713] (-886.963) (-884.579) -- 0:00:48
223000 -- (-886.193) (-885.050) (-883.599) [-886.064] * (-885.817) (-882.731) (-888.069) [-883.916] -- 0:00:48
223500 -- (-883.863) (-885.107) (-884.232) [-884.699] * (-885.103) (-884.162) (-885.258) [-884.933] -- 0:00:48
224000 -- [-886.691] (-883.070) (-885.811) (-891.961) * [-885.894] (-886.931) (-885.901) (-883.982) -- 0:00:48
224500 -- (-889.641) [-882.841] (-884.460) (-884.712) * (-885.628) (-890.536) [-886.984] (-889.157) -- 0:00:48
225000 -- (-886.012) (-888.556) [-884.303] (-884.400) * [-882.795] (-882.964) (-885.203) (-886.888) -- 0:00:48
Average standard deviation of split frequencies: 0.014288
225500 -- (-885.691) [-885.473] (-885.393) (-885.564) * (-882.511) (-885.266) [-888.341] (-884.694) -- 0:00:48
226000 -- (-882.851) (-887.979) [-884.847] (-887.944) * (-882.420) (-882.957) (-884.272) [-885.171] -- 0:00:47
226500 -- (-886.267) (-883.773) [-884.650] (-885.218) * (-882.408) (-884.660) [-884.575] (-884.213) -- 0:00:47
227000 -- (-887.326) (-884.624) [-884.608] (-886.137) * (-885.846) [-884.187] (-884.379) (-885.782) -- 0:00:47
227500 -- (-883.283) [-885.936] (-885.171) (-883.529) * (-884.238) [-883.796] (-884.448) (-884.977) -- 0:00:47
228000 -- (-887.649) (-883.925) (-884.163) [-884.938] * [-883.524] (-882.630) (-884.421) (-885.026) -- 0:00:47
228500 -- (-887.958) [-883.641] (-885.793) (-884.294) * (-883.902) (-885.081) [-885.718] (-883.836) -- 0:00:47
229000 -- (-889.133) [-884.001] (-886.046) (-884.053) * (-884.235) [-885.138] (-884.039) (-888.457) -- 0:00:47
229500 -- (-889.272) [-884.691] (-885.394) (-883.377) * [-887.384] (-887.771) (-883.204) (-884.627) -- 0:00:47
230000 -- (-884.747) [-885.565] (-885.173) (-883.141) * (-885.537) [-886.306] (-882.729) (-883.854) -- 0:00:46
Average standard deviation of split frequencies: 0.013015
230500 -- [-888.966] (-884.007) (-884.484) (-883.361) * (-883.822) (-885.643) [-882.451] (-884.022) -- 0:00:46
231000 -- (-883.802) [-884.836] (-884.102) (-884.887) * (-883.558) (-884.297) [-885.577] (-882.823) -- 0:00:49
231500 -- (-888.170) (-887.034) [-884.172] (-884.469) * (-883.907) (-884.717) (-884.055) [-885.672] -- 0:00:49
232000 -- (-886.666) (-884.394) [-884.048] (-884.109) * (-883.617) [-882.946] (-884.615) (-883.586) -- 0:00:49
232500 -- [-883.472] (-883.555) (-885.628) (-883.458) * (-883.347) (-886.252) [-884.753] (-884.435) -- 0:00:49
233000 -- [-883.498] (-883.447) (-883.687) (-885.261) * (-883.674) [-890.943] (-883.416) (-884.786) -- 0:00:49
233500 -- (-883.137) (-884.021) (-884.882) [-884.314] * (-885.918) (-884.784) (-885.339) [-884.023] -- 0:00:49
234000 -- (-885.763) (-886.297) (-883.695) [-885.853] * (-886.802) (-892.368) (-882.783) [-884.961] -- 0:00:49
234500 -- [-883.763] (-886.137) (-884.130) (-888.766) * (-883.065) (-891.691) (-883.409) [-884.434] -- 0:00:48
235000 -- [-885.790] (-884.539) (-884.823) (-887.913) * (-882.844) [-884.989] (-884.448) (-882.799) -- 0:00:48
Average standard deviation of split frequencies: 0.011985
235500 -- (-886.113) [-886.448] (-885.886) (-883.173) * (-882.975) (-885.742) [-887.103] (-883.105) -- 0:00:48
236000 -- (-887.415) (-885.627) [-883.226] (-885.898) * (-884.065) (-885.342) (-885.141) [-883.482] -- 0:00:48
236500 -- (-887.089) [-886.534] (-883.057) (-883.895) * (-884.148) (-885.532) [-883.567] (-890.099) -- 0:00:48
237000 -- (-882.734) (-886.954) (-884.413) [-884.316] * (-884.240) [-882.583] (-884.440) (-889.892) -- 0:00:48
237500 -- (-891.159) (-885.273) (-883.481) [-884.654] * [-883.304] (-882.685) (-883.082) (-884.920) -- 0:00:48
238000 -- (-885.439) (-886.083) [-883.268] (-884.434) * (-884.179) (-883.088) (-885.044) [-884.976] -- 0:00:48
238500 -- (-885.168) (-885.523) (-886.208) [-884.242] * (-885.787) [-885.803] (-882.396) (-887.784) -- 0:00:47
239000 -- (-884.639) (-883.953) [-884.778] (-887.034) * (-885.170) (-887.564) [-882.697] (-884.561) -- 0:00:47
239500 -- [-882.973] (-888.906) (-887.276) (-886.071) * [-883.416] (-887.773) (-884.369) (-883.948) -- 0:00:47
240000 -- (-884.978) (-888.272) [-885.603] (-884.087) * (-882.988) (-889.317) [-884.207] (-883.838) -- 0:00:47
Average standard deviation of split frequencies: 0.010991
240500 -- [-885.531] (-885.045) (-882.953) (-884.242) * (-884.059) [-883.673] (-890.297) (-884.078) -- 0:00:47
241000 -- (-887.306) [-883.788] (-886.069) (-888.940) * (-883.521) [-885.484] (-890.650) (-885.502) -- 0:00:47
241500 -- (-883.400) [-884.790] (-885.614) (-884.100) * (-883.072) [-888.121] (-884.015) (-886.456) -- 0:00:47
242000 -- (-883.168) (-883.481) (-888.146) [-885.122] * (-883.616) (-883.874) [-887.676] (-883.798) -- 0:00:46
242500 -- [-883.549] (-884.847) (-885.395) (-883.592) * (-883.497) [-883.575] (-883.482) (-884.374) -- 0:00:46
243000 -- (-884.389) (-885.179) (-884.199) [-883.147] * (-885.068) (-882.931) [-884.931] (-885.163) -- 0:00:46
243500 -- (-885.320) (-883.978) [-885.333] (-882.779) * (-883.923) (-882.878) [-884.459] (-887.982) -- 0:00:46
244000 -- (-884.796) [-884.460] (-886.190) (-883.684) * (-884.057) (-883.495) (-886.839) [-883.986] -- 0:00:46
244500 -- (-883.296) (-884.113) [-885.547] (-886.159) * [-884.750] (-884.947) (-885.281) (-883.520) -- 0:00:46
245000 -- (-886.492) (-885.137) [-886.838] (-885.122) * (-885.452) (-885.087) (-883.841) [-884.342] -- 0:00:46
Average standard deviation of split frequencies: 0.010433
245500 -- (-884.525) [-886.168] (-884.656) (-883.381) * (-883.343) (-885.724) [-886.118] (-885.676) -- 0:00:46
246000 -- [-883.492] (-882.864) (-886.526) (-882.495) * (-886.681) (-885.245) (-884.054) [-884.938] -- 0:00:45
246500 -- (-883.519) (-884.295) (-888.178) [-884.436] * (-885.988) (-882.733) [-882.768] (-885.855) -- 0:00:45
247000 -- (-883.484) (-885.619) (-884.101) [-883.486] * (-884.254) (-883.273) (-883.417) [-886.175] -- 0:00:45
247500 -- (-883.399) [-886.989] (-884.133) (-886.210) * (-885.635) (-885.019) (-883.514) [-886.068] -- 0:00:48
248000 -- (-884.427) (-883.762) (-882.913) [-886.781] * (-885.047) [-883.356] (-885.823) (-885.533) -- 0:00:48
248500 -- (-883.892) (-885.530) (-882.790) [-886.367] * [-883.597] (-884.243) (-885.055) (-886.029) -- 0:00:48
249000 -- (-887.362) (-886.077) [-882.824] (-883.586) * (-885.980) (-886.481) (-882.882) [-885.211] -- 0:00:48
249500 -- (-884.681) [-884.832] (-885.176) (-882.402) * (-884.520) (-886.732) [-883.338] (-885.092) -- 0:00:48
250000 -- (-885.612) (-887.081) (-883.248) [-883.720] * (-883.482) (-883.997) [-883.931] (-886.820) -- 0:00:48
Average standard deviation of split frequencies: 0.010448
250500 -- [-885.898] (-885.761) (-884.723) (-883.784) * (-887.439) (-886.741) [-884.765] (-885.946) -- 0:00:47
251000 -- [-885.257] (-884.735) (-883.993) (-884.135) * (-890.441) (-885.909) (-883.212) [-885.332] -- 0:00:47
251500 -- (-882.753) [-882.998] (-887.132) (-882.946) * (-884.381) (-885.776) (-888.072) [-887.234] -- 0:00:47
252000 -- [-885.404] (-884.319) (-886.230) (-883.181) * (-885.788) (-883.077) (-887.476) [-886.719] -- 0:00:47
252500 -- (-883.340) (-883.636) (-886.088) [-883.371] * (-883.999) [-882.748] (-887.129) (-883.720) -- 0:00:47
253000 -- (-885.473) (-883.244) (-883.392) [-884.009] * (-882.901) (-885.372) [-885.569] (-883.389) -- 0:00:47
253500 -- (-885.369) (-884.381) (-884.731) [-884.039] * [-884.428] (-884.085) (-893.911) (-883.258) -- 0:00:47
254000 -- (-884.286) (-883.937) [-884.138] (-884.018) * (-884.764) (-885.288) [-882.879] (-883.592) -- 0:00:46
254500 -- (-884.249) [-883.515] (-883.449) (-884.585) * (-883.074) (-884.782) [-884.573] (-887.644) -- 0:00:46
255000 -- (-885.802) (-883.394) [-883.584] (-883.652) * [-883.284] (-883.954) (-883.918) (-882.547) -- 0:00:46
Average standard deviation of split frequencies: 0.012018
255500 -- (-883.763) [-882.680] (-883.592) (-889.775) * [-883.167] (-883.985) (-882.297) (-883.787) -- 0:00:46
256000 -- [-884.050] (-883.295) (-883.447) (-883.491) * (-884.214) (-885.010) (-882.302) [-883.069] -- 0:00:46
256500 -- (-884.118) [-884.464] (-885.409) (-883.431) * (-884.990) (-884.645) [-882.490] (-887.175) -- 0:00:46
257000 -- (-885.516) [-883.597] (-886.061) (-886.866) * (-885.475) (-884.986) (-883.218) [-887.866] -- 0:00:46
257500 -- [-886.407] (-884.561) (-883.063) (-885.469) * [-883.897] (-888.248) (-882.554) (-887.192) -- 0:00:46
258000 -- [-883.218] (-884.691) (-882.957) (-885.044) * (-883.727) [-884.422] (-882.875) (-885.136) -- 0:00:46
258500 -- [-886.507] (-892.816) (-886.037) (-888.818) * (-884.645) (-884.979) [-882.719] (-886.625) -- 0:00:45
259000 -- (-885.548) (-885.067) (-887.266) [-884.984] * [-883.861] (-883.551) (-889.526) (-885.063) -- 0:00:45
259500 -- [-885.440] (-885.405) (-886.348) (-885.073) * (-885.000) (-883.713) (-888.444) [-885.050] -- 0:00:45
260000 -- (-883.602) [-885.805] (-884.606) (-886.015) * (-882.869) (-882.752) [-886.781] (-884.112) -- 0:00:45
Average standard deviation of split frequencies: 0.011808
260500 -- [-884.295] (-883.375) (-889.305) (-883.854) * (-884.403) (-884.411) [-883.318] (-884.046) -- 0:00:45
261000 -- (-886.024) [-884.583] (-885.477) (-883.633) * (-885.193) (-884.346) (-884.853) [-886.246] -- 0:00:45
261500 -- (-886.997) (-885.313) (-886.182) [-887.351] * [-883.364] (-885.201) (-886.115) (-883.091) -- 0:00:45
262000 -- (-887.356) (-884.174) [-886.217] (-882.852) * (-886.541) [-882.880] (-884.336) (-885.792) -- 0:00:45
262500 -- (-884.992) [-886.194] (-886.720) (-888.738) * (-884.332) (-882.777) (-883.559) [-883.812] -- 0:00:44
263000 -- (-885.865) (-884.429) (-883.690) [-882.841] * (-884.722) (-884.293) [-883.801] (-883.751) -- 0:00:44
263500 -- (-883.419) [-884.615] (-884.982) (-882.934) * (-885.602) (-884.468) [-887.270] (-886.211) -- 0:00:44
264000 -- (-883.014) (-888.411) [-883.458] (-883.563) * (-885.756) (-884.655) (-884.592) [-884.654] -- 0:00:44
264500 -- [-883.100] (-885.884) (-887.096) (-883.435) * (-887.319) (-887.356) [-882.722] (-885.136) -- 0:00:47
265000 -- (-886.959) (-885.235) (-885.745) [-884.094] * [-885.606] (-886.881) (-884.287) (-884.626) -- 0:00:47
Average standard deviation of split frequencies: 0.012685
265500 -- (-886.861) (-886.212) [-886.736] (-884.143) * (-884.281) (-886.413) (-883.430) [-883.446] -- 0:00:47
266000 -- [-884.320] (-883.959) (-884.849) (-885.019) * [-886.720] (-885.427) (-885.893) (-883.316) -- 0:00:46
266500 -- (-883.825) [-883.303] (-883.824) (-885.075) * (-885.777) (-885.177) (-886.653) [-883.771] -- 0:00:46
267000 -- (-884.140) [-885.896] (-885.471) (-884.369) * (-888.092) [-886.034] (-884.992) (-884.283) -- 0:00:46
267500 -- (-886.356) (-888.668) [-883.809] (-883.355) * (-888.236) [-884.778] (-884.409) (-886.843) -- 0:00:46
268000 -- (-892.668) [-883.486] (-882.969) (-882.704) * (-884.697) [-885.643] (-887.099) (-886.402) -- 0:00:46
268500 -- (-883.804) [-884.649] (-883.748) (-884.182) * (-887.518) [-882.862] (-886.797) (-885.827) -- 0:00:46
269000 -- (-883.736) (-883.486) (-885.401) [-885.386] * (-883.307) (-887.678) [-886.235] (-883.412) -- 0:00:46
269500 -- (-884.824) [-886.412] (-887.637) (-887.964) * (-885.452) (-888.868) (-883.031) [-883.823] -- 0:00:46
270000 -- (-884.000) (-883.560) [-886.696] (-884.266) * [-886.459] (-884.374) (-883.953) (-887.068) -- 0:00:45
Average standard deviation of split frequencies: 0.013159
270500 -- (-886.764) (-886.921) (-882.756) [-884.015] * (-885.500) (-884.101) [-885.554] (-885.459) -- 0:00:45
271000 -- [-885.126] (-889.726) (-884.839) (-883.722) * (-886.442) [-886.579] (-888.778) (-883.518) -- 0:00:45
271500 -- (-884.473) [-885.327] (-884.085) (-885.852) * (-883.482) (-886.640) (-885.423) [-883.318] -- 0:00:45
272000 -- (-885.562) (-883.478) (-883.588) [-882.755] * (-883.957) (-887.963) (-884.116) [-883.017] -- 0:00:45
272500 -- (-883.600) [-883.241] (-883.238) (-883.786) * (-885.346) (-886.937) [-882.461] (-884.144) -- 0:00:45
273000 -- (-885.229) (-883.513) (-882.845) [-882.654] * (-885.498) [-887.655] (-882.459) (-883.740) -- 0:00:45
273500 -- (-883.054) (-883.611) (-882.590) [-883.126] * (-885.851) [-882.716] (-883.998) (-885.636) -- 0:00:45
274000 -- (-884.280) [-883.819] (-883.741) (-883.143) * (-883.990) [-882.874] (-889.315) (-895.546) -- 0:00:45
274500 -- (-885.175) (-884.443) [-883.288] (-883.030) * (-887.872) (-885.802) [-885.126] (-885.871) -- 0:00:44
275000 -- (-885.582) (-885.123) (-883.259) [-886.373] * (-883.774) (-888.700) (-885.325) [-884.416] -- 0:00:44
Average standard deviation of split frequencies: 0.012525
275500 -- (-888.325) (-884.999) [-883.873] (-883.312) * (-883.406) (-885.924) [-885.203] (-884.137) -- 0:00:44
276000 -- (-887.479) (-882.841) (-885.665) [-882.751] * (-883.197) (-885.448) [-883.315] (-885.057) -- 0:00:44
276500 -- (-884.817) (-883.197) (-884.285) [-884.190] * (-887.154) [-882.560] (-883.989) (-883.015) -- 0:00:44
277000 -- (-885.051) (-885.631) [-883.038] (-886.050) * (-889.163) (-883.586) [-886.196] (-885.310) -- 0:00:44
277500 -- (-885.690) (-883.341) [-883.220] (-886.061) * (-891.182) (-884.930) (-884.753) [-883.064] -- 0:00:44
278000 -- [-885.978] (-883.158) (-883.266) (-883.102) * [-885.933] (-883.592) (-883.721) (-882.892) -- 0:00:44
278500 -- [-885.280] (-884.850) (-883.771) (-888.084) * (-885.190) (-883.985) (-884.157) [-885.064] -- 0:00:44
279000 -- [-883.655] (-890.967) (-884.483) (-884.027) * (-886.574) (-885.698) [-883.005] (-884.222) -- 0:00:43
279500 -- [-883.638] (-884.810) (-884.352) (-883.527) * (-885.701) (-885.946) [-885.170] (-884.860) -- 0:00:43
280000 -- (-885.330) [-884.451] (-882.651) (-883.833) * (-884.912) (-884.663) (-882.993) [-882.694] -- 0:00:43
Average standard deviation of split frequencies: 0.011362
280500 -- (-884.505) (-883.477) (-883.353) [-884.266] * (-884.088) [-886.289] (-885.857) (-882.700) -- 0:00:46
281000 -- (-887.306) [-883.664] (-885.005) (-883.861) * (-884.593) (-886.115) [-886.460] (-883.679) -- 0:00:46
281500 -- [-883.753] (-883.036) (-884.743) (-883.894) * [-887.641] (-885.847) (-884.965) (-884.629) -- 0:00:45
282000 -- [-885.009] (-883.392) (-885.715) (-889.545) * (-884.146) [-883.938] (-886.581) (-885.369) -- 0:00:45
282500 -- [-884.550] (-884.801) (-884.035) (-885.829) * (-883.425) (-883.772) (-884.851) [-883.766] -- 0:00:45
283000 -- (-886.724) (-883.508) (-883.986) [-884.555] * (-888.155) (-883.834) [-886.245] (-884.178) -- 0:00:45
283500 -- (-887.772) (-887.110) (-885.578) [-883.856] * (-893.549) (-884.746) (-884.657) [-883.232] -- 0:00:45
284000 -- (-884.523) [-884.738] (-884.771) (-883.842) * (-890.364) [-884.862] (-882.976) (-884.484) -- 0:00:45
284500 -- [-888.509] (-884.153) (-885.178) (-883.622) * [-883.962] (-888.803) (-884.640) (-883.305) -- 0:00:45
285000 -- (-884.139) (-883.828) (-888.846) [-882.783] * (-884.794) (-889.342) [-883.455] (-882.884) -- 0:00:45
Average standard deviation of split frequencies: 0.010347
285500 -- (-882.965) (-883.871) [-884.423] (-885.311) * [-885.118] (-884.223) (-883.619) (-883.018) -- 0:00:45
286000 -- (-884.067) (-884.683) (-887.504) [-886.808] * (-883.354) [-886.709] (-885.884) (-882.970) -- 0:00:44
286500 -- (-882.796) [-884.065] (-885.492) (-883.686) * (-884.244) [-884.586] (-890.582) (-885.160) -- 0:00:44
287000 -- (-884.906) [-883.979] (-884.724) (-884.543) * [-886.971] (-884.220) (-885.222) (-883.424) -- 0:00:44
287500 -- (-884.957) [-883.623] (-883.853) (-885.092) * [-889.456] (-888.492) (-882.851) (-882.756) -- 0:00:44
288000 -- [-885.361] (-887.017) (-890.176) (-882.959) * [-884.678] (-887.308) (-883.215) (-883.992) -- 0:00:44
288500 -- (-883.158) (-886.568) (-883.111) [-884.057] * (-883.923) (-888.540) [-883.235] (-886.995) -- 0:00:44
289000 -- [-888.167] (-884.760) (-883.521) (-882.813) * (-885.447) [-885.703] (-884.252) (-885.089) -- 0:00:44
289500 -- (-885.481) (-882.941) [-885.888] (-882.808) * (-882.791) (-887.075) [-884.895] (-886.424) -- 0:00:44
290000 -- (-882.905) (-885.701) (-887.760) [-884.120] * [-884.236] (-885.462) (-884.539) (-887.381) -- 0:00:44
Average standard deviation of split frequencies: 0.009911
290500 -- (-884.871) (-882.822) (-884.912) [-885.350] * (-883.670) [-886.078] (-887.633) (-888.778) -- 0:00:43
291000 -- (-888.389) (-884.394) (-884.884) [-882.845] * (-885.336) (-885.331) (-884.496) [-884.735] -- 0:00:43
291500 -- (-883.632) [-885.530] (-886.592) (-889.387) * [-884.062] (-886.043) (-882.409) (-884.770) -- 0:00:43
292000 -- (-886.326) (-883.726) (-884.213) [-884.670] * (-885.264) (-887.344) (-886.837) [-885.424] -- 0:00:43
292500 -- (-883.973) (-883.534) [-883.079] (-885.131) * (-885.266) (-882.929) [-885.090] (-884.219) -- 0:00:43
293000 -- (-884.545) (-883.582) (-883.607) [-882.752] * (-886.107) (-882.784) (-882.688) [-883.500] -- 0:00:43
293500 -- (-888.590) (-884.334) [-883.363] (-888.597) * [-883.871] (-882.858) (-884.585) (-885.788) -- 0:00:43
294000 -- (-887.238) (-885.428) (-883.505) [-888.529] * (-884.301) [-885.775] (-884.354) (-885.910) -- 0:00:43
294500 -- (-884.184) [-885.145] (-888.422) (-889.653) * [-884.040] (-887.159) (-883.907) (-887.026) -- 0:00:43
295000 -- (-888.475) [-887.062] (-883.985) (-893.350) * (-886.948) (-882.998) (-882.942) [-884.853] -- 0:00:43
Average standard deviation of split frequencies: 0.010813
295500 -- (-884.179) (-887.361) [-886.572] (-888.293) * (-883.814) [-882.998] (-882.753) (-884.818) -- 0:00:42
296000 -- (-886.723) [-884.723] (-885.476) (-885.196) * (-882.511) (-883.573) [-884.300] (-883.289) -- 0:00:42
296500 -- (-886.281) [-885.493] (-884.440) (-883.766) * (-883.949) (-883.552) [-882.676] (-885.959) -- 0:00:42
297000 -- (-888.917) (-885.195) (-887.833) [-883.949] * (-883.318) (-883.843) [-882.416] (-887.561) -- 0:00:42
297500 -- [-892.161] (-885.525) (-888.314) (-888.537) * (-883.342) (-883.505) (-887.300) [-884.669] -- 0:00:44
298000 -- (-885.820) (-885.083) [-888.019] (-887.165) * [-884.373] (-889.899) (-883.294) (-883.878) -- 0:00:44
298500 -- [-883.666] (-888.264) (-885.246) (-884.821) * (-884.890) (-885.015) (-882.665) [-885.736] -- 0:00:44
299000 -- [-884.408] (-885.683) (-884.960) (-884.287) * (-883.094) (-892.790) (-883.909) [-887.662] -- 0:00:44
299500 -- (-883.308) (-885.095) [-883.661] (-882.909) * (-884.786) (-885.499) (-884.353) [-886.727] -- 0:00:44
300000 -- (-883.426) [-886.088] (-884.826) (-883.225) * (-885.519) [-885.793] (-886.557) (-884.622) -- 0:00:44
Average standard deviation of split frequencies: 0.011058
300500 -- (-884.529) [-887.055] (-885.723) (-884.984) * (-888.157) (-890.793) [-887.800] (-885.724) -- 0:00:44
301000 -- (-883.963) (-883.837) [-887.837] (-884.536) * (-885.830) (-888.486) [-884.464] (-882.921) -- 0:00:44
301500 -- (-884.678) (-884.973) [-887.224] (-883.917) * (-883.359) (-886.875) (-882.574) [-883.636] -- 0:00:44
302000 -- (-884.316) [-885.846] (-888.368) (-883.757) * (-882.901) [-885.454] (-883.739) (-883.703) -- 0:00:43
302500 -- (-886.531) (-883.647) [-884.909] (-882.842) * [-886.997] (-887.968) (-883.300) (-884.270) -- 0:00:43
303000 -- (-887.369) (-883.398) (-886.660) [-882.477] * (-884.550) [-883.927] (-882.870) (-882.868) -- 0:00:43
303500 -- (-890.839) (-884.267) (-884.875) [-884.912] * (-885.641) (-884.717) (-883.103) [-884.322] -- 0:00:43
304000 -- (-883.825) (-883.185) (-883.486) [-885.895] * (-884.267) (-887.227) (-884.285) [-882.719] -- 0:00:43
304500 -- (-885.245) [-884.707] (-883.664) (-889.262) * (-884.968) (-890.827) [-885.714] (-884.335) -- 0:00:43
305000 -- (-883.363) (-884.961) (-887.833) [-884.431] * (-885.311) [-883.500] (-885.366) (-883.336) -- 0:00:43
Average standard deviation of split frequencies: 0.011351
305500 -- [-884.809] (-884.251) (-888.120) (-882.558) * (-887.529) (-885.263) [-887.792] (-885.003) -- 0:00:43
306000 -- (-886.358) (-882.887) [-885.524] (-882.562) * (-884.093) (-884.338) (-886.663) [-884.231] -- 0:00:43
306500 -- (-887.796) (-883.629) (-883.536) [-882.629] * (-886.211) (-883.452) (-882.962) [-884.092] -- 0:00:42
307000 -- (-887.519) (-884.565) (-884.121) [-885.027] * (-884.089) [-883.500] (-884.744) (-884.120) -- 0:00:42
307500 -- (-884.557) (-882.279) (-882.987) [-883.854] * (-882.883) [-882.951] (-884.340) (-883.175) -- 0:00:42
308000 -- (-883.820) [-884.141] (-886.899) (-884.926) * (-883.336) [-884.819] (-884.883) (-884.466) -- 0:00:42
308500 -- (-882.439) (-882.737) [-885.121] (-884.858) * (-883.202) [-885.692] (-886.758) (-884.859) -- 0:00:42
309000 -- [-887.131] (-884.063) (-882.895) (-884.291) * [-885.532] (-887.171) (-886.777) (-886.869) -- 0:00:42
309500 -- [-883.436] (-888.536) (-883.224) (-883.966) * (-886.294) (-886.482) (-886.738) [-884.966] -- 0:00:42
310000 -- (-883.739) (-887.865) [-887.312] (-889.174) * (-883.973) (-883.363) (-884.493) [-882.867] -- 0:00:42
Average standard deviation of split frequencies: 0.010941
310500 -- (-883.301) [-886.351] (-887.262) (-887.865) * (-884.324) [-884.272] (-887.225) (-884.300) -- 0:00:42
311000 -- (-886.066) (-887.831) (-885.345) [-884.403] * (-886.990) [-884.848] (-883.089) (-885.163) -- 0:00:42
311500 -- (-885.902) (-886.726) [-886.349] (-885.467) * (-883.491) (-883.081) (-886.748) [-883.010] -- 0:00:41
312000 -- (-886.869) (-884.687) (-883.905) [-884.346] * (-883.603) (-882.975) [-884.999] (-882.700) -- 0:00:41
312500 -- (-885.895) [-885.838] (-883.527) (-883.432) * (-884.436) (-884.614) (-883.515) [-882.615] -- 0:00:41
313000 -- (-884.157) [-884.324] (-882.953) (-884.577) * (-884.397) [-882.788] (-884.406) (-884.074) -- 0:00:41
313500 -- (-883.810) (-889.091) (-884.065) [-884.373] * (-885.263) [-885.348] (-884.957) (-886.646) -- 0:00:41
314000 -- (-883.202) (-883.216) [-882.475] (-884.692) * (-886.001) [-885.939] (-884.316) (-892.749) -- 0:00:43
314500 -- (-883.388) (-885.539) (-883.674) [-885.143] * (-882.837) (-883.448) [-885.010] (-887.456) -- 0:00:43
315000 -- (-883.539) [-884.194] (-885.140) (-884.566) * [-883.031] (-885.229) (-884.089) (-885.534) -- 0:00:43
Average standard deviation of split frequencies: 0.008371
315500 -- [-883.970] (-882.679) (-885.968) (-884.965) * [-883.013] (-882.436) (-883.662) (-887.295) -- 0:00:43
316000 -- (-884.415) (-883.741) (-887.050) [-886.870] * [-883.010] (-882.507) (-883.355) (-884.043) -- 0:00:43
316500 -- (-884.631) (-886.941) (-887.003) [-884.878] * (-887.362) (-887.201) (-884.429) [-883.929] -- 0:00:43
317000 -- (-885.558) (-888.862) (-883.292) [-886.597] * (-883.671) (-883.595) [-884.496] (-883.751) -- 0:00:43
317500 -- (-883.648) (-888.046) (-888.066) [-886.148] * (-884.704) (-883.322) [-883.738] (-884.780) -- 0:00:42
318000 -- (-884.533) (-886.592) (-888.091) [-885.092] * [-885.215] (-884.768) (-884.032) (-882.394) -- 0:00:42
318500 -- (-888.762) (-888.721) [-884.941] (-884.841) * (-883.955) [-885.306] (-884.275) (-884.959) -- 0:00:42
319000 -- (-883.661) (-885.035) (-883.697) [-884.581] * (-890.556) [-887.258] (-892.603) (-885.684) -- 0:00:42
319500 -- [-888.859] (-882.700) (-886.106) (-885.491) * (-885.137) (-885.748) (-885.848) [-884.381] -- 0:00:42
320000 -- (-889.158) [-883.274] (-889.606) (-887.823) * (-885.719) (-884.426) (-884.071) [-884.455] -- 0:00:42
Average standard deviation of split frequencies: 0.008648
320500 -- (-887.126) (-883.951) (-882.591) [-888.138] * (-885.096) (-884.626) (-890.004) [-883.283] -- 0:00:42
321000 -- (-883.263) (-883.130) [-882.583] (-892.399) * (-883.409) (-886.155) (-882.835) [-883.687] -- 0:00:42
321500 -- (-885.883) [-882.856] (-883.638) (-884.985) * (-885.272) [-890.639] (-885.052) (-886.410) -- 0:00:42
322000 -- (-883.748) (-882.923) [-882.429] (-887.718) * (-887.484) (-884.077) (-885.280) [-887.175] -- 0:00:42
322500 -- (-884.620) (-887.549) (-882.703) [-883.143] * (-885.878) (-886.479) [-889.672] (-884.724) -- 0:00:42
323000 -- (-887.765) (-885.600) (-883.231) [-884.311] * (-885.348) (-885.920) (-885.893) [-887.258] -- 0:00:41
323500 -- (-886.893) (-885.782) (-887.595) [-883.761] * (-883.775) (-884.124) (-886.547) [-887.084] -- 0:00:41
324000 -- [-883.500] (-883.433) (-882.791) (-887.830) * (-885.480) (-884.261) [-885.007] (-886.707) -- 0:00:41
324500 -- (-884.876) (-883.195) (-883.384) [-883.677] * (-882.740) (-888.208) (-887.157) [-883.821] -- 0:00:41
325000 -- [-882.809] (-883.866) (-886.795) (-886.300) * (-884.298) (-883.521) (-883.299) [-883.777] -- 0:00:41
Average standard deviation of split frequencies: 0.008355
325500 -- (-885.154) [-883.996] (-886.047) (-884.245) * (-886.453) (-883.958) [-883.050] (-886.213) -- 0:00:41
326000 -- [-885.929] (-883.497) (-885.552) (-884.484) * (-885.170) [-884.270] (-883.066) (-884.332) -- 0:00:41
326500 -- [-885.130] (-883.146) (-884.971) (-886.864) * (-885.764) [-882.722] (-885.613) (-884.102) -- 0:00:41
327000 -- (-882.894) (-884.521) [-883.171] (-884.058) * (-882.561) [-883.444] (-883.950) (-887.181) -- 0:00:41
327500 -- [-887.067] (-886.041) (-883.210) (-885.056) * (-885.177) (-888.133) [-885.070] (-884.558) -- 0:00:41
328000 -- (-884.063) (-886.205) (-884.116) [-885.616] * (-886.393) (-889.123) [-884.707] (-885.552) -- 0:00:40
328500 -- (-884.057) (-882.832) [-884.917] (-883.736) * (-885.779) (-889.841) [-883.112] (-885.307) -- 0:00:40
329000 -- (-883.309) (-883.882) [-885.513] (-886.730) * (-885.465) (-889.863) [-884.389] (-885.041) -- 0:00:40
329500 -- (-883.673) [-882.895] (-891.012) (-888.308) * (-883.653) (-886.138) (-882.761) [-883.765] -- 0:00:40
330000 -- [-883.206] (-887.382) (-882.845) (-883.203) * (-883.913) (-885.073) [-884.039] (-883.523) -- 0:00:40
Average standard deviation of split frequencies: 0.007380
330500 -- (-891.116) (-887.761) [-882.801] (-883.967) * [-884.194] (-887.368) (-882.858) (-885.762) -- 0:00:40
331000 -- (-884.190) (-886.461) [-883.209] (-886.376) * [-882.558] (-886.344) (-887.413) (-885.004) -- 0:00:42
331500 -- [-884.575] (-888.538) (-884.943) (-886.693) * (-883.642) (-885.129) [-883.060] (-886.685) -- 0:00:42
332000 -- (-888.922) (-889.161) (-884.494) [-884.200] * (-883.361) (-886.878) [-882.868] (-883.082) -- 0:00:42
332500 -- (-884.145) (-886.220) [-884.494] (-889.532) * [-883.676] (-890.490) (-884.851) (-883.255) -- 0:00:42
333000 -- (-883.614) [-885.585] (-884.756) (-885.826) * [-884.109] (-884.963) (-884.252) (-884.960) -- 0:00:42
333500 -- (-884.209) [-886.658] (-884.277) (-886.804) * (-885.463) (-886.103) [-883.993] (-883.675) -- 0:00:41
334000 -- (-884.348) (-885.163) [-885.263] (-885.441) * (-887.122) [-889.933] (-883.486) (-883.482) -- 0:00:41
334500 -- (-886.987) (-883.418) (-887.446) [-884.806] * (-888.437) (-883.959) [-883.394] (-885.306) -- 0:00:41
335000 -- (-885.357) (-883.204) [-884.696] (-886.720) * (-883.849) (-887.423) [-883.223] (-891.297) -- 0:00:41
Average standard deviation of split frequencies: 0.007263
335500 -- (-884.548) [-883.706] (-884.044) (-886.057) * (-883.736) (-884.560) [-883.862] (-888.396) -- 0:00:41
336000 -- (-884.850) [-884.238] (-883.567) (-886.249) * (-884.104) (-886.167) (-884.377) [-886.872] -- 0:00:41
336500 -- (-883.200) (-883.958) (-884.637) [-885.760] * (-882.688) (-886.565) [-885.336] (-885.577) -- 0:00:41
337000 -- [-882.736] (-882.613) (-885.041) (-887.439) * (-884.646) [-883.720] (-883.269) (-883.841) -- 0:00:41
337500 -- (-883.136) [-884.455] (-886.470) (-884.522) * [-883.279] (-887.956) (-882.476) (-883.039) -- 0:00:41
338000 -- [-883.795] (-885.437) (-884.272) (-888.232) * (-884.596) [-885.062] (-884.324) (-883.446) -- 0:00:41
338500 -- (-882.654) [-886.034] (-886.931) (-884.446) * (-883.907) (-884.299) [-882.687] (-885.448) -- 0:00:41
339000 -- (-882.844) (-883.671) [-886.513] (-886.565) * (-886.901) [-882.648] (-884.870) (-883.920) -- 0:00:40
339500 -- (-882.836) (-887.336) [-883.895] (-884.959) * (-884.964) (-888.134) (-885.199) [-883.701] -- 0:00:40
340000 -- [-882.628] (-886.203) (-883.839) (-883.706) * (-886.369) (-885.014) (-883.918) [-885.550] -- 0:00:40
Average standard deviation of split frequencies: 0.006837
340500 -- (-883.109) [-882.587] (-883.556) (-883.735) * [-884.983] (-882.358) (-887.703) (-884.584) -- 0:00:40
341000 -- (-883.077) (-882.878) [-883.202] (-882.524) * [-886.578] (-885.877) (-887.590) (-884.460) -- 0:00:40
341500 -- (-883.148) (-883.299) [-883.985] (-884.869) * (-886.947) (-882.941) (-887.624) [-882.860] -- 0:00:40
342000 -- [-885.255] (-883.638) (-886.073) (-885.015) * (-885.796) (-884.125) [-887.168] (-885.484) -- 0:00:40
342500 -- (-885.689) (-882.829) [-884.158] (-883.879) * (-883.199) (-885.022) (-884.905) [-883.531] -- 0:00:40
343000 -- (-882.788) (-884.390) [-883.644] (-882.669) * (-884.886) (-884.303) (-885.897) [-882.794] -- 0:00:40
343500 -- (-883.051) [-883.749] (-884.514) (-883.444) * (-884.345) [-883.819] (-885.561) (-882.743) -- 0:00:40
344000 -- (-884.946) (-886.946) (-883.870) [-884.768] * (-884.934) [-883.332] (-882.715) (-884.504) -- 0:00:40
344500 -- (-886.310) [-885.204] (-886.321) (-882.937) * (-885.507) (-885.843) [-882.747] (-883.676) -- 0:00:39
345000 -- (-884.204) (-884.729) [-884.409] (-882.661) * (-888.916) [-883.559] (-885.555) (-884.754) -- 0:00:41
Average standard deviation of split frequencies: 0.006492
345500 -- (-886.994) (-884.941) [-884.753] (-883.002) * (-884.784) (-885.653) (-884.276) [-882.658] -- 0:00:41
346000 -- (-887.627) [-886.725] (-888.862) (-884.033) * [-883.217] (-884.173) (-887.352) (-883.028) -- 0:00:41
346500 -- (-887.287) (-883.405) (-884.294) [-883.949] * (-883.295) [-883.174] (-883.617) (-883.552) -- 0:00:41
347000 -- (-886.773) (-883.481) (-883.643) [-885.419] * [-886.055] (-885.426) (-885.047) (-883.706) -- 0:00:41
347500 -- (-886.085) [-886.757] (-883.100) (-883.860) * (-885.990) (-885.421) [-882.951] (-882.834) -- 0:00:41
348000 -- (-883.355) (-886.322) [-885.679] (-884.585) * (-886.201) [-887.518] (-889.300) (-887.822) -- 0:00:41
348500 -- (-884.318) [-886.034] (-886.778) (-885.338) * (-890.628) [-885.767] (-888.517) (-885.727) -- 0:00:41
349000 -- [-887.600] (-887.102) (-885.340) (-885.066) * (-888.352) (-882.807) [-886.367] (-883.625) -- 0:00:41
349500 -- (-884.752) (-883.436) (-885.976) [-883.506] * (-892.257) (-883.022) (-885.399) [-883.998] -- 0:00:40
350000 -- (-885.443) (-885.115) (-884.321) [-884.241] * (-886.204) (-883.154) [-886.628] (-883.341) -- 0:00:40
Average standard deviation of split frequencies: 0.006049
350500 -- (-884.521) (-883.927) (-883.566) [-884.209] * (-885.932) (-884.374) [-883.429] (-883.333) -- 0:00:40
351000 -- (-885.555) [-883.974] (-883.807) (-889.044) * [-884.948] (-885.115) (-884.436) (-883.129) -- 0:00:40
351500 -- (-883.824) (-885.825) (-883.744) [-885.498] * (-885.353) [-886.779] (-885.989) (-889.270) -- 0:00:40
352000 -- (-885.781) [-883.800] (-883.117) (-883.311) * (-887.135) (-886.454) [-885.349] (-882.694) -- 0:00:40
352500 -- (-888.165) (-884.683) [-883.406] (-884.100) * [-885.644] (-882.988) (-885.634) (-883.842) -- 0:00:40
353000 -- (-884.250) [-886.732] (-884.966) (-885.110) * (-886.905) (-886.904) (-883.410) [-884.650] -- 0:00:40
353500 -- [-886.516] (-883.150) (-885.379) (-886.440) * [-886.527] (-888.272) (-883.272) (-888.264) -- 0:00:40
354000 -- (-888.559) [-883.674] (-884.739) (-888.135) * [-883.423] (-885.459) (-885.382) (-883.630) -- 0:00:40
354500 -- (-883.826) [-884.013] (-884.447) (-884.270) * [-884.313] (-885.633) (-884.695) (-884.143) -- 0:00:40
355000 -- (-883.855) [-883.620] (-883.025) (-884.316) * (-883.553) [-884.602] (-889.826) (-884.019) -- 0:00:39
Average standard deviation of split frequencies: 0.006786
355500 -- (-884.327) (-884.410) (-882.781) [-884.582] * (-883.479) (-885.158) (-885.866) [-884.470] -- 0:00:39
356000 -- [-883.995] (-886.130) (-882.726) (-886.365) * (-883.943) [-883.552] (-888.826) (-888.372) -- 0:00:39
356500 -- (-884.358) (-883.949) [-883.728] (-884.718) * (-887.705) (-884.988) (-884.528) [-883.604] -- 0:00:39
357000 -- (-884.430) (-886.679) (-883.059) [-884.518] * (-886.662) [-884.200] (-883.978) (-883.569) -- 0:00:39
357500 -- [-883.667] (-884.951) (-886.766) (-884.406) * (-883.975) [-882.602] (-883.979) (-884.357) -- 0:00:39
358000 -- (-883.196) (-887.389) [-884.394] (-883.696) * (-887.633) (-884.112) (-886.142) [-884.886] -- 0:00:39
358500 -- (-884.197) (-883.073) (-883.705) [-883.157] * (-888.029) (-884.449) (-890.500) [-888.451] -- 0:00:39
359000 -- (-885.870) [-883.073] (-882.651) (-884.679) * (-885.824) [-884.032] (-885.151) (-885.549) -- 0:00:39
359500 -- [-886.666] (-884.113) (-885.076) (-883.071) * (-885.098) (-884.928) (-883.372) [-884.637] -- 0:00:39
360000 -- (-884.198) (-884.030) [-883.180] (-883.555) * [-883.492] (-887.370) (-883.527) (-884.544) -- 0:00:39
Average standard deviation of split frequencies: 0.007679
360500 -- (-886.182) (-886.744) (-887.061) [-884.456] * [-883.440] (-883.590) (-884.411) (-882.900) -- 0:00:40
361000 -- (-889.326) (-884.930) (-884.342) [-886.211] * (-885.336) (-888.796) (-883.957) [-883.361] -- 0:00:40
361500 -- (-886.893) (-885.342) [-888.762] (-884.574) * (-887.035) [-882.650] (-890.198) (-885.637) -- 0:00:40
362000 -- (-884.295) [-884.652] (-884.584) (-888.068) * (-885.395) (-888.571) [-885.525] (-883.710) -- 0:00:40
362500 -- (-887.706) [-884.128] (-887.860) (-883.605) * [-886.409] (-886.403) (-889.951) (-883.677) -- 0:00:40
363000 -- (-889.673) [-885.478] (-886.702) (-884.458) * (-887.251) (-888.766) (-888.164) [-885.184] -- 0:00:40
363500 -- (-887.357) [-886.150] (-886.066) (-885.923) * (-886.933) [-884.887] (-886.518) (-886.122) -- 0:00:40
364000 -- [-885.375] (-883.575) (-885.537) (-888.752) * [-885.687] (-891.470) (-886.846) (-884.836) -- 0:00:40
364500 -- (-886.361) [-883.621] (-892.587) (-882.330) * (-885.238) [-887.174] (-885.990) (-887.649) -- 0:00:40
365000 -- (-884.994) (-884.762) [-885.655] (-885.304) * (-889.694) (-884.700) (-885.125) [-884.740] -- 0:00:40
Average standard deviation of split frequencies: 0.007808
365500 -- [-884.288] (-885.380) (-885.447) (-886.503) * (-889.382) (-884.789) [-884.555] (-885.195) -- 0:00:39
366000 -- [-883.229] (-885.415) (-884.262) (-893.387) * (-886.689) (-883.744) (-883.673) [-886.757] -- 0:00:39
366500 -- (-886.758) (-886.458) [-882.653] (-883.874) * (-888.973) (-884.744) [-884.133] (-884.201) -- 0:00:39
367000 -- (-883.408) (-884.561) [-883.556] (-887.994) * (-885.145) [-886.137] (-884.362) (-886.675) -- 0:00:39
367500 -- [-890.626] (-883.897) (-885.003) (-884.304) * (-884.926) (-887.851) [-888.347] (-889.160) -- 0:00:39
368000 -- (-884.259) (-884.168) (-886.562) [-884.349] * [-882.559] (-885.321) (-886.724) (-886.909) -- 0:00:39
368500 -- (-886.202) (-885.361) [-883.000] (-883.930) * (-883.345) (-883.636) [-887.548] (-886.082) -- 0:00:39
369000 -- (-884.583) (-883.814) [-883.003] (-884.919) * (-883.097) [-882.905] (-885.367) (-891.752) -- 0:00:39
369500 -- (-885.844) (-882.557) (-883.105) [-883.993] * (-882.644) (-885.389) (-884.718) [-885.295] -- 0:00:39
370000 -- (-882.801) (-883.565) (-882.924) [-884.523] * (-882.602) (-886.839) [-883.978] (-885.326) -- 0:00:39
Average standard deviation of split frequencies: 0.007869
370500 -- (-882.394) (-889.339) (-887.731) [-889.249] * (-883.391) (-884.813) [-884.347] (-884.167) -- 0:00:39
371000 -- [-884.691] (-883.669) (-884.938) (-886.550) * (-885.450) [-885.835] (-887.157) (-887.075) -- 0:00:38
371500 -- (-885.018) [-885.236] (-889.510) (-887.329) * (-884.092) (-884.628) (-888.181) [-886.345] -- 0:00:38
372000 -- [-882.879] (-884.988) (-895.107) (-887.474) * (-885.956) (-885.474) [-883.356] (-886.892) -- 0:00:38
372500 -- (-882.834) [-885.821] (-883.388) (-889.535) * [-885.138] (-883.433) (-882.388) (-883.685) -- 0:00:38
373000 -- [-882.834] (-885.023) (-884.157) (-887.176) * (-883.939) (-884.832) [-884.335] (-883.505) -- 0:00:38
373500 -- (-885.872) (-884.930) [-883.561] (-887.175) * [-884.160] (-882.433) (-884.331) (-882.709) -- 0:00:38
374000 -- [-884.073] (-891.783) (-886.045) (-886.156) * [-889.288] (-882.927) (-883.041) (-882.935) -- 0:00:38
374500 -- (-882.636) (-885.532) (-883.378) [-884.424] * (-886.308) (-883.437) (-884.353) [-884.171] -- 0:00:38
375000 -- [-884.948] (-883.848) (-886.878) (-885.335) * (-885.641) (-884.449) (-884.220) [-886.924] -- 0:00:38
Average standard deviation of split frequencies: 0.008260
375500 -- (-886.619) [-883.662] (-884.775) (-884.991) * [-884.045] (-884.591) (-884.437) (-882.750) -- 0:00:38
376000 -- [-883.527] (-883.659) (-885.254) (-883.799) * (-884.727) (-883.053) (-887.371) [-886.475] -- 0:00:39
376500 -- (-884.330) (-883.692) (-883.645) [-883.231] * [-884.441] (-885.458) (-887.864) (-885.474) -- 0:00:39
377000 -- [-885.781] (-883.433) (-883.171) (-885.736) * [-884.467] (-884.522) (-890.102) (-882.945) -- 0:00:39
377500 -- (-883.335) (-883.674) (-884.399) [-884.303] * [-884.547] (-884.005) (-884.873) (-883.533) -- 0:00:39
378000 -- [-883.961] (-883.562) (-884.462) (-884.956) * (-884.445) (-883.895) [-884.755] (-885.567) -- 0:00:39
378500 -- [-884.046] (-884.339) (-884.291) (-886.008) * (-886.084) (-883.327) [-886.880] (-887.430) -- 0:00:39
379000 -- (-883.715) (-883.893) [-888.442] (-885.168) * (-887.994) (-885.200) [-885.963] (-883.368) -- 0:00:39
379500 -- [-883.918] (-886.988) (-884.937) (-884.586) * [-884.479] (-882.486) (-884.900) (-883.815) -- 0:00:39
380000 -- (-886.988) [-884.164] (-888.565) (-886.603) * (-883.213) (-885.244) [-887.585] (-883.941) -- 0:00:39
Average standard deviation of split frequencies: 0.008304
380500 -- [-884.916] (-885.055) (-883.883) (-882.489) * [-884.657] (-884.164) (-883.937) (-885.622) -- 0:00:39
381000 -- [-883.358] (-883.862) (-882.850) (-883.690) * (-883.423) (-884.192) [-883.070] (-889.722) -- 0:00:38
381500 -- (-884.152) (-882.431) (-884.863) [-888.522] * (-884.551) (-884.403) [-887.241] (-887.583) -- 0:00:38
382000 -- [-882.335] (-887.347) (-885.348) (-886.318) * (-882.861) (-884.087) (-886.328) [-884.670] -- 0:00:38
382500 -- [-886.502] (-883.014) (-885.922) (-884.742) * (-885.501) (-884.531) (-885.231) [-884.449] -- 0:00:38
383000 -- (-885.362) (-883.559) (-883.250) [-883.614] * (-887.964) (-884.026) (-887.147) [-883.462] -- 0:00:38
383500 -- (-887.959) (-884.508) (-883.029) [-883.928] * [-882.895] (-884.162) (-884.875) (-885.692) -- 0:00:38
384000 -- [-882.770] (-884.158) (-883.112) (-887.504) * [-887.750] (-887.049) (-884.904) (-885.732) -- 0:00:38
384500 -- (-884.603) (-886.200) [-882.824] (-885.618) * (-888.274) [-883.275] (-884.349) (-883.116) -- 0:00:38
385000 -- [-885.765] (-883.476) (-885.195) (-885.325) * (-889.696) [-887.339] (-883.154) (-884.052) -- 0:00:38
Average standard deviation of split frequencies: 0.008333
385500 -- (-884.592) (-884.537) [-884.197] (-884.265) * [-888.029] (-883.365) (-882.773) (-884.853) -- 0:00:38
386000 -- (-883.081) (-884.822) [-885.909] (-887.314) * (-886.116) (-884.916) (-885.488) [-885.831] -- 0:00:38
386500 -- (-886.053) [-883.545] (-883.193) (-886.264) * (-884.719) (-883.662) [-885.432] (-884.825) -- 0:00:38
387000 -- [-883.416] (-884.556) (-884.211) (-883.996) * (-883.451) [-884.519] (-886.482) (-884.226) -- 0:00:38
387500 -- (-889.352) [-887.421] (-884.295) (-884.833) * (-885.253) (-885.265) [-883.546] (-882.419) -- 0:00:37
388000 -- [-884.838] (-884.594) (-894.682) (-884.080) * [-883.757] (-884.748) (-887.305) (-882.794) -- 0:00:37
388500 -- (-890.282) [-885.397] (-889.479) (-883.919) * [-883.831] (-885.038) (-886.015) (-882.921) -- 0:00:37
389000 -- (-884.133) (-885.543) [-890.551] (-887.230) * (-888.987) [-884.377] (-882.872) (-885.974) -- 0:00:37
389500 -- (-887.014) (-884.394) (-884.827) [-884.268] * (-882.441) [-884.414] (-883.415) (-887.354) -- 0:00:37
390000 -- [-884.593] (-882.449) (-884.949) (-883.717) * (-887.785) (-884.895) [-885.784] (-884.155) -- 0:00:37
Average standard deviation of split frequencies: 0.008660
390500 -- (-888.753) (-883.920) [-884.769] (-889.001) * (-885.093) (-884.321) [-884.697] (-884.013) -- 0:00:37
391000 -- (-885.458) (-887.853) [-883.432] (-886.049) * (-884.304) (-885.774) (-887.049) [-883.520] -- 0:00:37
391500 -- (-884.358) (-884.810) (-882.617) [-883.565] * (-883.913) (-884.556) [-883.080] (-885.863) -- 0:00:38
392000 -- (-888.982) (-883.802) [-883.357] (-886.645) * (-882.938) (-886.428) [-883.948] (-890.064) -- 0:00:38
392500 -- (-884.028) (-884.585) [-885.300] (-890.579) * (-883.036) (-892.900) [-884.382] (-884.248) -- 0:00:38
393000 -- [-884.402] (-886.316) (-885.452) (-883.106) * (-883.119) (-888.456) (-884.590) [-883.092] -- 0:00:38
393500 -- (-883.882) (-888.020) [-883.059] (-883.265) * (-883.667) [-883.468] (-884.186) (-882.690) -- 0:00:38
394000 -- (-884.023) (-883.430) [-882.652] (-883.583) * (-888.084) [-886.383] (-885.824) (-884.482) -- 0:00:38
394500 -- (-883.946) [-884.530] (-883.125) (-884.845) * [-884.498] (-882.644) (-890.405) (-883.191) -- 0:00:38
395000 -- (-883.080) (-884.818) [-884.533] (-884.722) * (-884.270) (-884.896) [-885.726] (-884.494) -- 0:00:38
Average standard deviation of split frequencies: 0.007843
395500 -- [-885.973] (-884.357) (-883.468) (-883.995) * (-886.066) (-883.957) (-884.247) [-883.480] -- 0:00:38
396000 -- [-882.644] (-887.261) (-886.034) (-883.648) * (-885.225) (-883.563) [-883.154] (-886.860) -- 0:00:38
396500 -- [-884.766] (-885.047) (-886.596) (-885.309) * (-884.765) [-884.199] (-884.255) (-886.668) -- 0:00:38
397000 -- [-887.000] (-884.807) (-885.709) (-887.424) * [-883.703] (-884.473) (-888.190) (-883.443) -- 0:00:37
397500 -- (-885.588) (-884.372) [-887.753] (-885.318) * (-885.528) (-884.720) (-889.175) [-886.585] -- 0:00:37
398000 -- (-884.058) (-885.729) [-883.524] (-885.356) * (-884.719) (-883.901) (-886.886) [-888.918] -- 0:00:37
398500 -- (-884.437) (-884.753) (-884.545) [-883.032] * (-883.665) (-885.016) [-884.634] (-886.102) -- 0:00:37
399000 -- [-886.421] (-883.151) (-884.407) (-887.744) * [-882.900] (-886.301) (-884.228) (-884.731) -- 0:00:37
399500 -- (-888.787) (-885.651) (-883.197) [-884.847] * (-883.410) (-883.667) [-886.033] (-884.573) -- 0:00:37
400000 -- (-885.840) (-883.670) (-886.036) [-883.772] * (-882.778) (-883.619) (-884.474) [-886.384] -- 0:00:37
Average standard deviation of split frequencies: 0.007821
400500 -- (-886.822) [-886.902] (-886.912) (-883.401) * (-887.390) (-884.084) [-883.354] (-884.554) -- 0:00:37
401000 -- [-888.130] (-885.312) (-882.549) (-885.836) * (-884.720) [-886.213] (-884.113) (-883.475) -- 0:00:37
401500 -- (-887.856) (-884.256) (-887.204) [-884.099] * (-885.999) (-883.616) (-885.590) [-885.070] -- 0:00:37
402000 -- [-885.250] (-885.672) (-886.651) (-882.458) * [-886.645] (-884.594) (-886.373) (-882.576) -- 0:00:37
402500 -- (-882.875) (-884.839) [-885.504] (-883.686) * [-883.904] (-883.431) (-882.849) (-883.207) -- 0:00:37
403000 -- (-884.327) (-889.774) [-884.157] (-886.108) * (-883.566) [-884.870] (-884.867) (-883.954) -- 0:00:37
403500 -- [-884.475] (-885.050) (-883.083) (-885.945) * (-885.159) (-885.469) [-884.131] (-886.442) -- 0:00:36
404000 -- [-883.978] (-885.540) (-884.683) (-883.389) * (-883.117) (-885.435) [-885.190] (-884.186) -- 0:00:36
404500 -- (-887.833) [-884.057] (-885.032) (-883.446) * (-883.688) (-883.604) (-884.211) [-884.310] -- 0:00:36
405000 -- [-889.296] (-886.012) (-885.337) (-885.023) * (-882.726) (-885.427) [-886.562] (-884.642) -- 0:00:36
Average standard deviation of split frequencies: 0.007991
405500 -- [-883.436] (-884.645) (-886.734) (-884.817) * (-885.327) (-884.337) (-886.451) [-884.124] -- 0:00:36
406000 -- (-884.251) (-883.136) (-883.503) [-885.158] * (-887.239) (-883.644) [-883.024] (-884.225) -- 0:00:36
406500 -- [-884.769] (-886.150) (-887.573) (-884.701) * (-885.371) [-885.204] (-883.294) (-884.438) -- 0:00:36
407000 -- (-884.731) (-884.598) (-889.024) [-884.390] * (-885.487) (-884.596) (-884.233) [-883.677] -- 0:00:36
407500 -- (-889.009) (-885.940) (-884.657) [-883.751] * (-882.882) [-884.736] (-883.497) (-884.726) -- 0:00:37
408000 -- (-883.610) (-884.152) [-883.545] (-884.161) * (-885.521) (-885.512) [-883.772] (-887.307) -- 0:00:37
408500 -- (-882.306) (-884.611) (-886.980) [-887.281] * (-884.487) (-886.397) (-884.829) [-883.504] -- 0:00:37
409000 -- [-884.965] (-889.751) (-886.077) (-887.947) * [-885.631] (-884.609) (-884.647) (-883.093) -- 0:00:37
409500 -- [-885.889] (-886.026) (-884.499) (-886.836) * (-888.238) (-884.181) [-885.881] (-885.371) -- 0:00:37
410000 -- (-885.987) [-883.991] (-890.129) (-887.126) * [-883.519] (-888.264) (-884.207) (-887.036) -- 0:00:37
Average standard deviation of split frequencies: 0.008466
410500 -- [-884.174] (-885.978) (-884.873) (-882.796) * (-883.284) (-886.165) (-884.152) [-883.548] -- 0:00:37
411000 -- [-883.425] (-884.796) (-886.440) (-882.789) * (-882.795) (-886.287) (-885.191) [-883.337] -- 0:00:37
411500 -- [-884.686] (-890.813) (-885.388) (-884.699) * (-883.784) (-887.256) [-882.499] (-885.886) -- 0:00:37
412000 -- (-884.520) (-884.642) (-886.572) [-884.652] * (-883.725) (-883.452) (-885.517) [-882.607] -- 0:00:37
412500 -- (-888.381) (-883.582) (-886.799) [-883.306] * (-883.784) [-885.045] (-884.011) (-887.590) -- 0:00:37
413000 -- (-889.212) [-882.751] (-885.671) (-886.272) * (-882.836) (-883.285) (-886.755) [-885.631] -- 0:00:36
413500 -- (-888.282) (-883.426) (-884.267) [-883.624] * (-883.348) (-883.005) [-883.144] (-885.328) -- 0:00:36
414000 -- (-886.504) (-885.089) (-883.687) [-883.777] * (-883.335) (-884.508) [-884.266] (-886.589) -- 0:00:36
414500 -- (-886.019) (-892.441) [-885.096] (-884.065) * (-884.868) [-884.572] (-887.544) (-888.332) -- 0:00:36
415000 -- (-883.668) (-886.267) (-884.402) [-884.571] * (-884.868) (-886.195) (-884.492) [-884.069] -- 0:00:36
Average standard deviation of split frequencies: 0.009420
415500 -- (-883.484) (-882.866) (-882.785) [-884.439] * (-883.803) (-886.253) [-883.405] (-886.495) -- 0:00:36
416000 -- (-884.140) (-886.897) [-883.167] (-885.080) * (-882.714) (-884.038) (-886.661) [-884.211] -- 0:00:36
416500 -- [-884.064] (-887.493) (-883.002) (-885.491) * (-885.528) (-883.248) (-884.208) [-885.048] -- 0:00:36
417000 -- (-885.579) [-883.893] (-883.038) (-885.342) * [-889.808] (-887.042) (-884.849) (-884.441) -- 0:00:36
417500 -- [-886.678] (-887.433) (-883.379) (-884.773) * (-884.471) [-887.805] (-885.323) (-883.887) -- 0:00:36
418000 -- (-883.220) (-884.758) (-884.221) [-889.794] * (-886.500) (-889.467) (-888.508) [-885.215] -- 0:00:36
418500 -- (-882.939) (-885.044) [-885.114] (-883.118) * [-884.045] (-886.768) (-887.434) (-883.591) -- 0:00:36
419000 -- [-882.960] (-883.814) (-883.951) (-885.769) * [-886.684] (-885.089) (-887.944) (-884.234) -- 0:00:36
419500 -- (-884.611) [-885.403] (-884.403) (-884.167) * (-883.996) (-883.325) (-884.457) [-883.641] -- 0:00:35
420000 -- [-883.631] (-886.106) (-884.040) (-885.532) * (-885.747) (-883.351) [-884.124] (-886.916) -- 0:00:35
Average standard deviation of split frequencies: 0.009385
420500 -- (-882.735) (-886.202) [-885.861] (-884.044) * (-885.119) (-882.823) [-884.368] (-885.861) -- 0:00:35
421000 -- (-883.768) [-885.057] (-883.986) (-887.694) * (-884.410) (-883.719) [-885.362] (-887.048) -- 0:00:35
421500 -- (-882.998) (-883.739) [-884.743] (-887.858) * [-884.167] (-883.254) (-882.348) (-884.581) -- 0:00:35
422000 -- (-882.563) (-886.384) (-884.817) [-886.983] * [-882.749] (-883.854) (-882.742) (-884.720) -- 0:00:35
422500 -- [-883.499] (-885.162) (-885.778) (-884.453) * (-885.064) [-883.596] (-885.586) (-884.290) -- 0:00:35
423000 -- (-883.141) (-886.944) [-883.203] (-886.135) * [-885.722] (-883.679) (-883.647) (-884.107) -- 0:00:35
423500 -- [-882.840] (-882.808) (-882.694) (-886.271) * [-884.271] (-883.370) (-883.289) (-885.223) -- 0:00:35
424000 -- (-884.702) (-883.948) [-884.513] (-882.588) * (-887.550) (-883.743) [-883.816] (-886.670) -- 0:00:35
424500 -- (-883.694) [-884.196] (-884.954) (-884.862) * [-887.268] (-883.507) (-883.072) (-884.565) -- 0:00:36
425000 -- (-884.137) (-882.881) [-884.428] (-883.748) * (-886.447) (-882.763) [-885.882] (-885.124) -- 0:00:36
Average standard deviation of split frequencies: 0.009406
425500 -- [-883.258] (-883.418) (-888.108) (-883.277) * (-885.871) (-883.683) [-884.929] (-885.038) -- 0:00:36
426000 -- [-883.323] (-884.298) (-884.928) (-883.697) * [-886.275] (-883.408) (-884.130) (-886.602) -- 0:00:36
426500 -- [-882.469] (-886.551) (-883.568) (-886.643) * (-883.867) [-884.041] (-883.521) (-885.750) -- 0:00:36
427000 -- (-883.929) (-884.262) (-885.452) [-883.993] * (-888.138) (-887.978) [-883.302] (-884.387) -- 0:00:36
427500 -- (-887.574) (-888.626) (-885.564) [-883.858] * (-886.268) (-886.062) (-883.483) [-883.042] -- 0:00:36
428000 -- (-883.947) (-886.603) (-889.868) [-883.311] * (-883.373) (-885.824) [-883.566] (-884.958) -- 0:00:36
428500 -- (-882.744) [-883.506] (-883.690) (-884.031) * (-882.943) [-887.747] (-885.655) (-885.196) -- 0:00:36
429000 -- (-886.244) (-883.393) [-882.584] (-885.607) * (-887.175) (-885.580) [-883.070] (-890.894) -- 0:00:35
429500 -- [-884.158] (-888.660) (-885.948) (-884.604) * (-882.678) [-887.718] (-883.881) (-884.186) -- 0:00:35
430000 -- (-884.251) [-884.556] (-884.003) (-884.614) * (-882.754) (-886.128) (-882.922) [-885.417] -- 0:00:35
Average standard deviation of split frequencies: 0.009920
430500 -- [-885.156] (-884.838) (-883.845) (-884.587) * (-884.107) (-886.847) (-888.146) [-883.620] -- 0:00:35
431000 -- (-882.770) [-883.849] (-883.139) (-886.272) * (-884.243) (-883.508) [-882.794] (-885.860) -- 0:00:35
431500 -- [-883.285] (-883.900) (-883.002) (-886.337) * [-883.633] (-890.153) (-883.314) (-888.946) -- 0:00:35
432000 -- (-883.571) (-883.305) (-883.761) [-885.305] * [-885.428] (-883.125) (-887.739) (-885.683) -- 0:00:35
432500 -- [-886.475] (-883.482) (-885.504) (-884.297) * [-883.768] (-884.458) (-884.110) (-885.469) -- 0:00:35
433000 -- (-888.922) (-882.972) [-885.510] (-883.955) * (-883.031) [-884.507] (-887.221) (-883.456) -- 0:00:35
433500 -- [-885.687] (-887.319) (-883.579) (-885.828) * [-886.134] (-888.033) (-884.131) (-886.138) -- 0:00:35
434000 -- (-882.660) (-885.895) (-883.695) [-885.000] * (-887.950) (-886.694) (-884.781) [-883.488] -- 0:00:35
434500 -- (-883.721) (-884.616) [-882.872] (-885.999) * (-888.784) (-883.930) (-887.178) [-884.718] -- 0:00:35
435000 -- (-885.428) [-885.320] (-889.156) (-887.873) * (-884.060) [-883.334] (-887.179) (-884.880) -- 0:00:35
Average standard deviation of split frequencies: 0.010136
435500 -- (-885.001) (-883.843) (-891.145) [-886.007] * (-883.409) (-883.378) (-883.613) [-887.364] -- 0:00:34
436000 -- (-884.833) (-884.618) (-889.859) [-885.669] * [-883.061] (-884.933) (-884.981) (-883.823) -- 0:00:34
436500 -- (-885.336) (-885.213) (-884.901) [-884.346] * (-884.001) (-887.457) [-883.109] (-884.844) -- 0:00:34
437000 -- (-888.839) [-885.557] (-883.393) (-882.935) * (-887.165) (-891.223) (-885.437) [-882.791] -- 0:00:34
437500 -- [-887.486] (-884.869) (-884.828) (-887.246) * (-885.864) [-887.763] (-889.708) (-882.558) -- 0:00:34
438000 -- (-883.438) (-884.095) [-884.629] (-883.490) * (-885.479) (-885.380) (-886.175) [-883.436] -- 0:00:34
438500 -- [-883.750] (-883.654) (-887.154) (-884.359) * (-883.496) [-886.357] (-888.724) (-884.910) -- 0:00:34
439000 -- (-882.847) (-884.563) [-882.556] (-884.667) * (-884.369) (-884.599) (-885.494) [-883.523] -- 0:00:34
439500 -- (-884.451) (-885.875) (-883.352) [-889.718] * [-884.027] (-884.322) (-883.376) (-884.099) -- 0:00:34
440000 -- (-884.905) (-886.613) (-885.145) [-886.414] * (-885.199) [-883.323] (-886.692) (-887.652) -- 0:00:34
Average standard deviation of split frequencies: 0.010430
440500 -- [-885.025] (-886.455) (-885.333) (-883.619) * [-885.170] (-883.136) (-884.482) (-883.232) -- 0:00:34
441000 -- (-888.053) (-884.311) (-882.816) [-882.523] * [-883.867] (-885.403) (-885.383) (-883.782) -- 0:00:34
441500 -- (-883.603) [-885.345] (-886.516) (-883.781) * (-887.059) [-885.052] (-884.724) (-884.084) -- 0:00:35
442000 -- (-884.090) (-884.494) (-884.073) [-884.802] * (-888.022) (-883.864) (-885.086) [-883.558] -- 0:00:35
442500 -- (-884.879) (-884.127) [-886.732] (-885.474) * [-883.608] (-886.625) (-884.471) (-882.792) -- 0:00:35
443000 -- (-885.745) (-885.828) [-883.636] (-888.136) * [-885.243] (-889.764) (-885.227) (-882.601) -- 0:00:35
443500 -- (-884.804) (-883.543) (-884.317) [-885.394] * (-890.561) (-888.801) [-884.901] (-884.123) -- 0:00:35
444000 -- (-886.198) (-883.470) (-884.986) [-882.748] * (-883.622) (-890.126) (-885.587) [-883.761] -- 0:00:35
444500 -- [-886.401] (-884.481) (-887.013) (-885.047) * (-883.948) [-886.007] (-886.136) (-883.965) -- 0:00:34
445000 -- (-883.304) (-882.636) [-883.544] (-884.264) * (-883.126) (-883.978) [-888.136] (-883.769) -- 0:00:34
Average standard deviation of split frequencies: 0.010107
445500 -- [-885.664] (-886.044) (-883.220) (-884.258) * (-886.610) (-883.941) (-884.213) [-883.840] -- 0:00:34
446000 -- (-884.583) (-884.849) (-884.942) [-884.464] * (-884.916) (-886.459) (-885.263) [-884.571] -- 0:00:34
446500 -- (-884.138) (-883.528) (-884.452) [-883.764] * (-884.372) (-884.373) (-890.342) [-886.339] -- 0:00:34
447000 -- (-885.375) (-885.890) [-884.794] (-886.049) * (-885.296) (-883.115) [-884.881] (-882.547) -- 0:00:34
447500 -- (-883.399) (-883.290) [-883.670] (-886.818) * [-883.470] (-883.082) (-888.519) (-883.673) -- 0:00:34
448000 -- (-883.910) (-883.660) [-882.746] (-888.318) * [-883.276] (-883.353) (-884.642) (-882.988) -- 0:00:34
448500 -- (-885.018) [-882.512] (-882.653) (-883.729) * (-883.314) (-885.440) [-886.084] (-883.705) -- 0:00:34
449000 -- (-885.177) (-884.769) (-883.803) [-887.466] * (-884.705) (-885.093) [-887.184] (-886.126) -- 0:00:34
449500 -- (-884.868) (-884.596) (-882.456) [-884.019] * (-885.509) (-884.080) [-885.377] (-885.259) -- 0:00:34
450000 -- (-886.296) (-882.513) (-883.471) [-887.721] * [-882.740] (-882.572) (-883.672) (-885.665) -- 0:00:34
Average standard deviation of split frequencies: 0.010133
450500 -- (-886.063) [-883.846] (-883.441) (-883.189) * (-882.805) (-883.397) [-887.024] (-884.301) -- 0:00:34
451000 -- [-885.050] (-882.502) (-882.998) (-884.281) * (-884.011) [-886.323] (-889.000) (-884.294) -- 0:00:34
451500 -- (-883.982) [-885.896] (-883.188) (-883.999) * (-885.690) (-884.781) [-883.296] (-885.586) -- 0:00:34
452000 -- (-883.632) (-889.814) (-883.100) [-883.499] * (-883.914) (-885.160) (-884.968) [-886.781] -- 0:00:33
452500 -- [-883.687] (-886.444) (-883.149) (-884.743) * (-883.918) [-886.488] (-884.450) (-888.199) -- 0:00:33
453000 -- [-885.237] (-884.940) (-885.162) (-883.894) * (-884.930) (-883.845) [-884.969] (-887.187) -- 0:00:33
453500 -- (-888.377) (-886.083) (-883.456) [-884.705] * (-883.671) [-884.726] (-883.481) (-889.614) -- 0:00:33
454000 -- (-885.167) (-884.438) (-886.211) [-885.153] * [-884.948] (-887.455) (-884.517) (-883.967) -- 0:00:33
454500 -- (-884.627) [-885.158] (-884.707) (-883.011) * (-887.241) (-882.921) (-884.131) [-884.433] -- 0:00:33
455000 -- (-888.423) [-883.570] (-882.819) (-883.542) * (-886.135) (-883.772) (-882.626) [-884.298] -- 0:00:33
Average standard deviation of split frequencies: 0.010079
455500 -- (-886.898) (-883.549) [-884.332] (-883.700) * (-888.141) [-885.785] (-885.793) (-884.917) -- 0:00:33
456000 -- (-891.125) [-883.850] (-884.483) (-883.092) * (-885.463) (-888.546) [-886.992] (-884.569) -- 0:00:33
456500 -- (-887.909) (-885.162) [-883.495] (-883.880) * (-885.358) (-883.605) [-886.641] (-883.288) -- 0:00:33
457000 -- [-882.566] (-886.456) (-885.776) (-887.772) * (-883.424) [-883.352] (-883.640) (-882.849) -- 0:00:33
457500 -- [-883.263] (-887.118) (-886.512) (-884.791) * (-884.032) [-883.383] (-884.597) (-885.742) -- 0:00:33
458000 -- (-882.495) [-885.017] (-886.406) (-887.602) * (-883.303) (-885.368) [-882.470] (-883.681) -- 0:00:33
458500 -- [-885.468] (-883.049) (-885.624) (-882.672) * (-884.058) (-883.383) (-882.470) [-883.681] -- 0:00:34
459000 -- (-884.082) (-884.051) (-883.633) [-883.202] * [-884.349] (-883.532) (-884.312) (-887.695) -- 0:00:34
459500 -- (-884.694) [-885.192] (-886.240) (-883.923) * (-886.075) (-882.923) (-883.114) [-888.129] -- 0:00:34
460000 -- (-883.023) (-887.489) (-883.977) [-883.953] * (-883.564) [-883.549] (-886.096) (-885.533) -- 0:00:34
Average standard deviation of split frequencies: 0.010301
460500 -- (-884.961) [-886.713] (-883.666) (-883.568) * (-883.657) (-883.300) [-883.907] (-883.560) -- 0:00:33
461000 -- [-887.984] (-885.228) (-885.773) (-883.551) * (-883.219) [-884.433] (-883.901) (-883.133) -- 0:00:33
461500 -- (-887.769) [-883.575] (-886.528) (-884.091) * [-885.309] (-885.614) (-883.871) (-882.776) -- 0:00:33
462000 -- [-883.577] (-883.007) (-885.027) (-884.924) * (-885.333) (-886.515) (-883.153) [-883.837] -- 0:00:33
462500 -- (-883.179) (-885.401) [-887.490] (-885.157) * (-886.675) [-886.108] (-883.795) (-886.194) -- 0:00:33
463000 -- (-884.758) (-885.045) [-886.840] (-883.770) * (-887.640) (-884.758) [-883.607] (-889.707) -- 0:00:33
463500 -- [-885.020] (-885.061) (-890.341) (-887.886) * (-889.542) [-883.708] (-884.840) (-889.912) -- 0:00:33
464000 -- (-887.563) (-883.248) [-883.095] (-886.002) * (-886.037) (-883.752) (-884.280) [-886.616] -- 0:00:33
464500 -- [-884.533] (-886.383) (-887.443) (-884.075) * (-883.708) (-883.130) (-883.583) [-885.030] -- 0:00:33
465000 -- (-884.717) (-884.490) [-883.734] (-886.171) * (-886.524) (-885.184) [-883.456] (-883.557) -- 0:00:33
Average standard deviation of split frequencies: 0.010369
465500 -- (-884.160) [-884.500] (-886.636) (-885.383) * (-883.520) (-884.269) (-883.145) [-883.413] -- 0:00:33
466000 -- [-884.090] (-883.650) (-886.004) (-882.553) * (-884.095) [-884.044] (-887.809) (-883.009) -- 0:00:33
466500 -- (-883.266) (-885.091) [-885.063] (-883.406) * (-884.611) (-885.670) [-884.559] (-883.204) -- 0:00:33
467000 -- (-882.509) (-887.160) [-889.134] (-885.262) * (-883.820) (-883.200) [-885.584] (-885.706) -- 0:00:33
467500 -- (-882.753) (-885.496) (-886.682) [-885.022] * (-883.558) (-882.497) (-883.795) [-885.217] -- 0:00:33
468000 -- (-883.437) [-886.571] (-885.729) (-885.002) * (-884.970) (-884.569) [-884.327] (-885.470) -- 0:00:32
468500 -- (-886.130) [-886.416] (-887.137) (-883.643) * (-883.625) (-886.429) [-882.871] (-888.322) -- 0:00:32
469000 -- (-884.600) (-885.238) [-884.769] (-885.258) * (-884.328) (-888.116) [-889.433] (-890.792) -- 0:00:32
469500 -- [-883.296] (-885.396) (-883.871) (-885.596) * (-884.000) (-887.649) [-885.563] (-885.349) -- 0:00:32
470000 -- (-883.615) (-883.210) [-885.149] (-886.927) * (-885.298) (-883.206) (-887.305) [-883.467] -- 0:00:32
Average standard deviation of split frequencies: 0.010149
470500 -- (-883.502) (-883.954) [-890.319] (-882.704) * (-883.604) (-882.704) (-886.253) [-885.536] -- 0:00:32
471000 -- (-886.042) (-883.788) (-893.356) [-883.884] * (-883.474) (-884.285) [-885.869] (-885.078) -- 0:00:32
471500 -- (-888.407) (-883.945) [-884.595] (-884.723) * (-882.903) (-883.326) [-885.443] (-886.262) -- 0:00:32
472000 -- (-887.080) (-885.045) (-888.473) [-883.921] * (-885.000) [-882.910] (-884.530) (-890.309) -- 0:00:32
472500 -- [-885.529] (-885.756) (-883.739) (-882.779) * (-891.930) [-882.740] (-886.273) (-884.861) -- 0:00:32
473000 -- (-888.714) (-884.469) (-882.922) [-883.383] * [-886.202] (-882.712) (-887.287) (-885.864) -- 0:00:32
473500 -- (-886.326) (-887.161) [-885.645] (-885.774) * (-889.064) (-883.304) (-885.681) [-884.439] -- 0:00:32
474000 -- (-883.928) [-883.853] (-888.225) (-882.638) * (-886.411) (-884.411) (-885.315) [-886.016] -- 0:00:32
474500 -- (-882.574) (-883.536) [-883.803] (-883.767) * (-888.576) [-884.926] (-884.118) (-887.365) -- 0:00:32
475000 -- [-886.271] (-884.430) (-882.938) (-883.397) * (-884.011) (-886.158) [-883.543] (-883.725) -- 0:00:33
Average standard deviation of split frequencies: 0.009837
475500 -- (-885.407) (-886.582) [-885.479] (-883.065) * (-886.017) (-884.601) [-883.133] (-883.696) -- 0:00:33
476000 -- (-885.645) [-887.013] (-884.499) (-883.888) * (-883.520) [-883.408] (-885.245) (-883.940) -- 0:00:33
476500 -- (-884.084) [-886.269] (-886.233) (-883.764) * (-883.337) [-883.156] (-887.307) (-886.878) -- 0:00:32
477000 -- (-884.279) (-885.926) [-885.008] (-884.979) * (-884.294) [-884.251] (-884.178) (-887.656) -- 0:00:32
477500 -- (-883.415) [-886.590] (-884.946) (-883.504) * (-885.610) (-883.074) (-885.349) [-883.730] -- 0:00:32
478000 -- (-883.592) (-883.356) [-885.806] (-883.963) * (-886.306) (-883.936) [-883.209] (-886.346) -- 0:00:32
478500 -- (-883.468) (-882.858) (-885.975) [-883.994] * (-886.489) (-884.415) (-883.233) [-883.211] -- 0:00:32
479000 -- (-883.825) (-885.731) [-883.713] (-888.406) * (-887.251) (-883.640) [-885.353] (-882.751) -- 0:00:32
479500 -- [-883.540] (-883.566) (-886.227) (-884.387) * (-884.477) (-885.031) (-883.982) [-884.502] -- 0:00:32
480000 -- (-884.967) [-884.527] (-886.680) (-886.739) * (-884.027) [-884.146] (-883.819) (-889.709) -- 0:00:32
Average standard deviation of split frequencies: 0.010003
480500 -- (-886.231) (-886.622) (-886.908) [-882.775] * (-884.055) (-886.226) (-884.155) [-886.069] -- 0:00:32
481000 -- [-890.335] (-884.833) (-884.805) (-885.761) * (-882.897) [-887.171] (-882.722) (-888.934) -- 0:00:32
481500 -- (-885.322) (-890.032) (-883.212) [-883.855] * (-885.241) (-883.592) (-885.913) [-885.185] -- 0:00:32
482000 -- (-883.580) [-888.724] (-883.887) (-884.871) * (-883.621) [-883.750] (-883.203) (-883.593) -- 0:00:32
482500 -- (-882.672) [-883.273] (-883.757) (-883.961) * (-883.616) [-884.245] (-884.547) (-884.004) -- 0:00:32
483000 -- (-889.763) (-882.928) (-885.650) [-885.900] * (-886.149) (-883.202) (-883.028) [-886.706] -- 0:00:32
483500 -- (-888.642) (-885.010) (-887.250) [-884.320] * (-889.534) (-883.715) [-883.002] (-885.173) -- 0:00:32
484000 -- (-890.859) [-884.278] (-885.184) (-883.107) * (-883.795) [-887.008] (-885.053) (-885.104) -- 0:00:31
484500 -- (-883.041) (-884.272) (-882.923) [-883.329] * (-882.600) (-887.050) [-884.504] (-885.889) -- 0:00:31
485000 -- (-883.351) [-883.227] (-884.723) (-887.137) * [-883.287] (-885.816) (-882.902) (-888.475) -- 0:00:31
Average standard deviation of split frequencies: 0.010670
485500 -- (-883.220) (-883.581) [-884.247] (-886.389) * [-882.892] (-886.501) (-883.890) (-887.159) -- 0:00:31
486000 -- (-885.524) [-883.899] (-885.043) (-883.588) * (-883.783) (-883.488) (-887.490) [-884.911] -- 0:00:31
486500 -- (-883.847) [-883.483] (-883.726) (-883.036) * [-883.325] (-887.196) (-889.174) (-885.103) -- 0:00:31
487000 -- [-885.819] (-887.471) (-891.109) (-883.230) * (-883.753) (-884.810) (-886.804) [-884.999] -- 0:00:31
487500 -- (-885.098) [-884.072] (-884.799) (-888.835) * (-884.670) (-883.324) (-884.050) [-883.975] -- 0:00:31
488000 -- (-884.089) (-883.058) [-884.069] (-884.702) * [-884.951] (-886.597) (-883.078) (-884.823) -- 0:00:31
488500 -- (-883.865) [-884.930] (-883.858) (-885.171) * (-883.989) (-886.356) [-886.112] (-884.374) -- 0:00:31
489000 -- (-887.617) (-884.185) (-890.398) [-884.647] * (-887.553) (-885.924) (-887.909) [-882.949] -- 0:00:31
489500 -- (-884.713) (-883.779) (-885.948) [-883.448] * (-886.944) (-884.691) [-885.182] (-884.760) -- 0:00:31
490000 -- (-884.525) (-885.082) (-884.261) [-882.439] * (-884.670) [-884.065] (-885.103) (-884.937) -- 0:00:31
Average standard deviation of split frequencies: 0.009890
490500 -- [-883.813] (-886.449) (-887.477) (-884.743) * [-884.125] (-886.276) (-886.113) (-883.553) -- 0:00:31
491000 -- (-889.214) [-883.887] (-885.509) (-884.212) * [-882.411] (-884.744) (-883.553) (-883.216) -- 0:00:31
491500 -- [-885.518] (-882.852) (-890.300) (-883.217) * (-882.537) (-883.769) [-883.957] (-882.431) -- 0:00:32
492000 -- [-885.708] (-884.632) (-886.719) (-885.116) * [-883.086] (-884.029) (-885.407) (-884.862) -- 0:00:32
492500 -- (-886.113) [-885.814] (-884.715) (-888.357) * (-884.011) [-883.446] (-886.514) (-884.537) -- 0:00:31
493000 -- (-884.219) (-883.654) [-882.626] (-883.857) * (-885.495) (-886.418) [-885.468] (-883.074) -- 0:00:31
493500 -- (-888.276) (-884.639) (-882.457) [-883.001] * [-882.642] (-887.171) (-883.901) (-884.173) -- 0:00:31
494000 -- (-889.361) [-883.644] (-882.438) (-884.504) * (-883.378) (-883.087) [-883.222] (-883.587) -- 0:00:31
494500 -- (-885.093) (-883.091) [-884.552] (-882.873) * (-886.055) (-884.368) (-885.341) [-883.554] -- 0:00:31
495000 -- (-884.093) (-883.125) (-886.657) [-883.378] * (-884.230) (-883.278) [-889.025] (-885.627) -- 0:00:31
Average standard deviation of split frequencies: 0.009564
495500 -- [-885.481] (-884.000) (-884.382) (-884.065) * (-886.342) (-884.859) [-885.066] (-885.330) -- 0:00:31
496000 -- (-884.062) (-887.876) [-883.926] (-883.077) * (-884.800) (-886.572) (-885.236) [-884.799] -- 0:00:31
496500 -- (-883.964) (-889.840) [-883.507] (-885.978) * (-885.289) (-885.199) [-884.488] (-888.719) -- 0:00:31
497000 -- (-884.239) [-887.216] (-888.162) (-884.498) * (-883.079) (-884.111) (-883.237) [-885.836] -- 0:00:31
497500 -- (-884.178) (-886.531) [-882.804] (-884.314) * (-884.094) (-884.214) [-883.548] (-885.079) -- 0:00:31
498000 -- (-885.411) (-884.197) (-883.432) [-884.013] * (-884.084) (-884.840) [-883.205] (-884.777) -- 0:00:31
498500 -- (-885.743) (-883.718) [-884.019] (-882.659) * [-884.557] (-886.970) (-885.209) (-883.947) -- 0:00:31
499000 -- (-886.046) [-884.823] (-883.714) (-885.149) * (-883.782) [-884.858] (-883.469) (-885.409) -- 0:00:31
499500 -- (-883.443) (-885.181) [-886.616] (-885.959) * [-883.172] (-888.322) (-883.968) (-885.472) -- 0:00:31
500000 -- [-885.643] (-886.520) (-886.603) (-883.783) * (-883.006) (-883.731) (-885.504) [-883.063] -- 0:00:31
Average standard deviation of split frequencies: 0.009667
500500 -- [-883.204] (-884.357) (-887.092) (-883.569) * [-883.601] (-883.142) (-883.813) (-883.992) -- 0:00:30
501000 -- (-884.127) [-883.680] (-886.494) (-891.204) * (-886.293) [-886.892] (-884.287) (-883.673) -- 0:00:30
501500 -- (-888.416) (-888.106) (-887.680) [-885.163] * (-884.883) [-888.500] (-883.179) (-885.897) -- 0:00:30
502000 -- (-887.143) (-886.341) (-888.983) [-886.884] * (-885.181) (-884.904) (-882.905) [-883.869] -- 0:00:30
502500 -- [-885.582] (-883.474) (-884.961) (-885.945) * [-883.722] (-884.250) (-886.602) (-886.485) -- 0:00:30
503000 -- (-884.156) [-889.160] (-884.434) (-888.199) * [-884.445] (-884.716) (-884.938) (-885.485) -- 0:00:30
503500 -- (-889.261) (-887.368) [-884.691] (-885.749) * [-884.626] (-885.388) (-883.585) (-884.630) -- 0:00:30
504000 -- [-884.483] (-889.824) (-884.248) (-884.948) * (-886.019) (-887.621) [-887.461] (-885.486) -- 0:00:30
504500 -- (-882.384) [-883.062] (-883.383) (-883.671) * [-884.709] (-885.338) (-886.050) (-884.875) -- 0:00:30
505000 -- (-886.190) (-885.669) (-883.814) [-884.569] * (-883.227) (-887.034) [-884.124] (-886.996) -- 0:00:30
Average standard deviation of split frequencies: 0.009426
505500 -- [-885.248] (-888.150) (-884.173) (-883.134) * [-885.598] (-887.476) (-884.394) (-887.395) -- 0:00:30
506000 -- (-885.492) (-884.623) [-883.772] (-888.320) * (-887.607) [-886.398] (-885.422) (-886.539) -- 0:00:30
506500 -- (-885.270) (-883.878) [-884.853] (-884.319) * (-885.982) (-884.778) [-883.627] (-885.750) -- 0:00:30
507000 -- (-886.511) [-882.303] (-888.043) (-884.889) * [-885.662] (-886.807) (-883.864) (-891.625) -- 0:00:30
507500 -- (-884.954) (-884.695) (-882.794) [-885.601] * (-884.289) (-887.729) (-885.316) [-883.402] -- 0:00:30
508000 -- (-884.647) (-883.310) [-882.720] (-885.723) * (-884.820) (-884.779) [-883.329] (-885.466) -- 0:00:30
508500 -- (-884.412) [-883.578] (-883.501) (-885.803) * (-885.879) (-884.896) (-885.384) [-886.359] -- 0:00:30
509000 -- [-883.839] (-885.180) (-882.414) (-883.923) * (-885.481) (-885.532) (-882.958) [-886.501] -- 0:00:30
509500 -- (-883.798) [-885.769] (-882.505) (-883.713) * [-887.868] (-885.390) (-886.183) (-886.862) -- 0:00:30
510000 -- (-885.248) [-885.266] (-883.100) (-884.893) * (-888.391) (-886.641) (-883.592) [-885.327] -- 0:00:30
Average standard deviation of split frequencies: 0.009937
510500 -- (-885.369) [-883.822] (-884.774) (-885.335) * [-883.480] (-884.226) (-882.425) (-883.377) -- 0:00:30
511000 -- (-887.982) (-884.891) (-885.222) [-887.393] * (-884.121) (-883.491) (-883.976) [-882.695] -- 0:00:30
511500 -- (-887.373) (-884.627) (-885.959) [-883.962] * [-885.188] (-884.535) (-884.752) (-883.707) -- 0:00:30
512000 -- [-886.217] (-886.311) (-883.820) (-884.664) * [-885.731] (-886.550) (-883.240) (-883.953) -- 0:00:30
512500 -- [-884.711] (-884.390) (-884.643) (-889.319) * [-884.534] (-883.170) (-883.406) (-886.246) -- 0:00:30
513000 -- (-887.308) (-885.664) (-884.065) [-883.064] * [-884.785] (-886.841) (-884.635) (-894.355) -- 0:00:30
513500 -- [-885.392] (-883.778) (-884.211) (-884.257) * (-886.815) [-884.634] (-884.760) (-889.333) -- 0:00:30
514000 -- (-883.987) (-883.684) [-889.003] (-885.141) * [-884.419] (-885.887) (-884.686) (-888.456) -- 0:00:30
514500 -- (-884.703) [-883.661] (-885.053) (-884.134) * (-884.205) (-882.739) (-884.072) [-884.108] -- 0:00:30
515000 -- (-884.783) [-886.964] (-882.710) (-883.252) * (-886.478) (-885.146) [-888.328] (-887.773) -- 0:00:30
Average standard deviation of split frequencies: 0.010694
515500 -- (-884.689) (-884.480) (-885.951) [-882.547] * (-884.157) (-883.768) (-885.170) [-884.001] -- 0:00:30
516000 -- (-884.344) (-888.414) [-886.117] (-882.918) * (-885.892) [-884.431] (-887.767) (-884.842) -- 0:00:30
516500 -- (-886.439) (-885.025) (-885.177) [-883.757] * (-890.876) [-885.372] (-883.455) (-883.411) -- 0:00:29
517000 -- (-884.124) (-887.436) [-884.011] (-884.208) * (-885.232) (-883.596) [-884.052] (-885.562) -- 0:00:29
517500 -- (-883.813) (-885.524) (-885.724) [-883.617] * (-883.789) (-884.851) (-883.669) [-886.579] -- 0:00:29
518000 -- (-883.123) [-887.084] (-883.300) (-883.568) * (-884.473) (-884.322) [-883.597] (-886.731) -- 0:00:29
518500 -- [-882.903] (-885.110) (-883.253) (-884.468) * [-883.576] (-885.379) (-885.827) (-886.958) -- 0:00:29
519000 -- (-884.526) (-886.957) (-883.557) [-884.430] * [-884.314] (-885.793) (-886.573) (-886.149) -- 0:00:29
519500 -- (-884.037) [-882.801] (-884.225) (-885.543) * (-885.752) (-884.311) (-886.600) [-892.767] -- 0:00:29
520000 -- (-883.432) [-885.931] (-884.145) (-885.862) * (-884.828) [-884.991] (-883.925) (-887.468) -- 0:00:29
Average standard deviation of split frequencies: 0.010978
520500 -- (-885.391) (-889.640) [-884.950] (-885.271) * (-885.100) (-883.374) [-883.169] (-884.128) -- 0:00:29
521000 -- [-883.502] (-884.006) (-883.353) (-885.184) * (-883.372) [-883.856] (-885.947) (-887.091) -- 0:00:29
521500 -- (-886.173) [-883.976] (-882.532) (-884.397) * [-883.280] (-884.112) (-885.348) (-886.820) -- 0:00:29
522000 -- (-886.934) [-883.740] (-884.537) (-883.776) * [-883.100] (-888.982) (-884.685) (-883.722) -- 0:00:29
522500 -- (-886.136) [-883.269] (-887.672) (-884.535) * (-885.661) [-885.578] (-882.951) (-890.272) -- 0:00:29
523000 -- [-887.395] (-882.452) (-884.720) (-886.244) * (-885.959) (-885.493) (-882.893) [-884.870] -- 0:00:29
523500 -- (-887.794) [-884.571] (-882.448) (-884.008) * [-887.429] (-884.888) (-883.184) (-883.392) -- 0:00:29
524000 -- (-894.038) (-883.205) [-883.686] (-884.479) * (-884.398) (-885.737) (-883.076) [-883.613] -- 0:00:29
524500 -- (-885.216) [-884.421] (-883.914) (-884.411) * (-885.921) (-884.557) (-884.723) [-883.614] -- 0:00:29
525000 -- (-885.745) (-886.698) (-884.165) [-885.349] * (-888.044) (-883.144) [-883.937] (-883.699) -- 0:00:29
Average standard deviation of split frequencies: 0.010385
525500 -- [-887.069] (-886.091) (-885.687) (-890.418) * (-885.166) (-887.371) [-886.178] (-885.748) -- 0:00:29
526000 -- (-883.555) [-883.818] (-886.063) (-892.352) * (-886.907) (-883.714) [-883.791] (-888.492) -- 0:00:29
526500 -- [-886.947] (-883.538) (-887.290) (-886.505) * (-885.555) [-882.842] (-882.821) (-892.576) -- 0:00:29
527000 -- (-883.478) (-885.942) [-886.114] (-891.681) * (-884.826) (-882.855) [-884.190] (-885.260) -- 0:00:29
527500 -- (-885.637) (-884.769) [-883.747] (-890.004) * [-885.031] (-884.703) (-884.956) (-884.965) -- 0:00:29
528000 -- [-883.647] (-888.432) (-885.678) (-883.636) * (-886.489) (-883.776) [-885.885] (-884.873) -- 0:00:29
528500 -- (-887.908) (-884.868) (-886.966) [-882.995] * (-886.262) (-883.275) [-883.291] (-883.733) -- 0:00:29
529000 -- (-884.474) (-883.730) (-889.049) [-883.156] * (-886.821) (-888.622) (-885.265) [-883.608] -- 0:00:29
529500 -- (-884.297) (-892.988) [-889.781] (-883.703) * (-885.309) [-888.473] (-884.133) (-882.926) -- 0:00:29
530000 -- (-884.957) (-893.647) (-887.740) [-884.037] * (-883.835) (-884.405) (-884.869) [-883.296] -- 0:00:29
Average standard deviation of split frequencies: 0.010271
530500 -- (-882.708) (-886.842) [-882.852] (-884.826) * [-883.184] (-887.655) (-886.022) (-885.620) -- 0:00:29
531000 -- (-882.829) [-884.734] (-885.546) (-886.183) * (-886.034) (-885.989) [-884.340] (-886.181) -- 0:00:29
531500 -- (-894.142) [-884.043] (-885.997) (-882.898) * [-884.085] (-884.929) (-887.819) (-886.147) -- 0:00:29
532000 -- (-883.521) (-883.878) (-892.065) [-883.928] * (-882.818) [-884.503] (-885.000) (-884.211) -- 0:00:29
532500 -- (-882.734) [-885.459] (-885.619) (-883.906) * (-883.317) (-884.810) [-883.927] (-884.203) -- 0:00:28
533000 -- (-882.957) [-884.802] (-885.965) (-883.678) * [-883.154] (-888.433) (-886.876) (-883.037) -- 0:00:28
533500 -- [-885.945] (-888.852) (-887.355) (-886.690) * (-892.721) (-884.510) (-883.956) [-884.660] -- 0:00:28
534000 -- (-884.654) (-884.681) (-882.725) [-887.628] * (-887.462) (-884.957) [-886.944] (-886.627) -- 0:00:28
534500 -- [-884.022] (-883.119) (-886.132) (-887.441) * (-884.479) (-886.972) [-884.764] (-888.129) -- 0:00:28
535000 -- (-884.441) [-883.916] (-885.416) (-885.924) * (-883.660) [-884.740] (-884.246) (-887.619) -- 0:00:28
Average standard deviation of split frequencies: 0.010279
535500 -- (-885.997) (-883.191) [-887.178] (-884.780) * (-887.842) [-883.911] (-884.383) (-883.649) -- 0:00:28
536000 -- [-883.036] (-885.904) (-891.297) (-886.516) * [-887.769] (-884.245) (-887.581) (-883.453) -- 0:00:28
536500 -- (-885.169) (-886.049) [-883.837] (-884.423) * (-885.271) (-884.437) [-883.878] (-887.988) -- 0:00:28
537000 -- [-885.122] (-885.773) (-885.498) (-888.078) * (-888.411) (-885.725) [-884.078] (-882.856) -- 0:00:28
537500 -- (-886.097) (-885.017) (-883.299) [-884.797] * [-888.169] (-882.805) (-882.809) (-883.920) -- 0:00:28
538000 -- (-884.938) (-882.593) (-885.330) [-887.291] * (-887.410) (-883.134) [-882.914] (-885.126) -- 0:00:28
538500 -- (-884.213) [-883.761] (-886.012) (-884.519) * (-884.369) (-886.022) (-883.303) [-885.089] -- 0:00:28
539000 -- (-883.053) [-885.585] (-886.974) (-884.940) * (-885.167) (-889.858) (-883.361) [-883.471] -- 0:00:28
539500 -- (-885.186) (-884.818) (-884.448) [-884.062] * (-886.192) (-884.326) (-883.350) [-883.735] -- 0:00:28
540000 -- (-882.966) (-884.021) [-887.424] (-886.302) * (-886.501) (-885.840) [-884.563] (-885.323) -- 0:00:28
Average standard deviation of split frequencies: 0.010081
540500 -- (-883.679) (-886.638) [-884.889] (-883.706) * (-884.056) (-886.568) [-886.957] (-882.715) -- 0:00:28
541000 -- (-885.129) (-886.171) [-883.200] (-885.727) * [-883.244] (-886.081) (-884.250) (-883.391) -- 0:00:27
541500 -- [-883.678] (-885.916) (-882.690) (-884.091) * (-884.395) (-887.378) (-883.919) [-884.769] -- 0:00:27
542000 -- (-884.508) (-885.922) (-882.628) [-883.257] * (-887.610) (-884.128) (-884.498) [-887.880] -- 0:00:28
542500 -- (-884.453) (-883.850) (-883.091) [-884.450] * (-883.882) (-883.192) [-885.312] (-884.860) -- 0:00:28
543000 -- (-887.680) [-883.885] (-888.165) (-883.134) * (-884.835) [-885.809] (-885.141) (-884.731) -- 0:00:28
543500 -- (-888.447) (-883.131) [-888.017] (-883.920) * (-887.138) (-883.655) [-885.602] (-884.000) -- 0:00:28
544000 -- (-884.367) [-884.648] (-883.699) (-883.953) * [-889.649] (-887.009) (-887.486) (-883.036) -- 0:00:28
544500 -- [-884.027] (-884.463) (-885.924) (-885.900) * (-887.129) (-885.468) [-887.975] (-885.290) -- 0:00:28
545000 -- (-883.590) [-883.085] (-883.391) (-887.714) * (-887.343) (-882.952) [-885.123] (-889.200) -- 0:00:28
Average standard deviation of split frequencies: 0.010522
545500 -- (-887.450) (-882.608) [-887.378] (-886.547) * (-886.873) [-883.020] (-887.101) (-886.327) -- 0:00:28
546000 -- (-886.754) (-883.069) (-888.042) [-887.236] * (-884.334) [-886.846] (-883.944) (-884.269) -- 0:00:28
546500 -- (-883.404) (-883.327) (-884.069) [-885.085] * [-883.639] (-884.854) (-888.690) (-883.523) -- 0:00:28
547000 -- (-885.510) [-886.441] (-884.873) (-886.357) * (-883.677) (-884.757) (-896.037) [-884.578] -- 0:00:28
547500 -- (-888.989) [-884.908] (-885.373) (-883.875) * (-883.485) (-884.413) [-884.759] (-883.390) -- 0:00:28
548000 -- (-884.908) (-886.687) [-883.323] (-884.719) * [-882.770] (-885.554) (-882.689) (-883.345) -- 0:00:28
548500 -- (-883.616) (-886.533) (-886.256) [-882.596] * (-883.311) (-885.428) (-888.274) [-885.592] -- 0:00:27
549000 -- (-883.321) [-883.500] (-886.681) (-884.467) * [-884.958] (-882.891) (-885.474) (-885.816) -- 0:00:27
549500 -- (-888.954) (-882.598) (-885.514) [-885.107] * (-890.668) [-882.930] (-884.005) (-884.580) -- 0:00:27
550000 -- (-882.669) [-883.473] (-884.705) (-884.020) * (-886.180) (-882.420) [-884.217] (-885.536) -- 0:00:27
Average standard deviation of split frequencies: 0.009738
550500 -- (-883.388) [-883.645] (-883.902) (-887.472) * (-883.742) [-882.764] (-884.246) (-883.462) -- 0:00:27
551000 -- (-883.880) [-884.568] (-891.108) (-883.678) * (-883.474) (-883.626) (-883.210) [-884.846] -- 0:00:27
551500 -- (-882.749) [-884.053] (-891.153) (-885.113) * (-886.067) (-884.296) [-883.094] (-884.663) -- 0:00:27
552000 -- (-883.972) (-884.838) (-884.270) [-884.752] * [-883.641] (-884.286) (-884.542) (-883.334) -- 0:00:27
552500 -- (-886.028) [-885.921] (-882.992) (-884.639) * (-882.640) (-885.823) [-884.986] (-887.229) -- 0:00:27
553000 -- [-884.124] (-892.792) (-883.467) (-887.403) * (-883.144) [-883.253] (-885.068) (-883.845) -- 0:00:27
553500 -- (-883.029) (-884.492) (-887.099) [-883.435] * (-884.004) (-883.029) [-884.124] (-886.572) -- 0:00:27
554000 -- (-883.701) (-883.508) (-886.116) [-883.143] * (-886.567) [-885.935] (-885.385) (-884.448) -- 0:00:27
554500 -- (-885.189) [-883.680] (-883.714) (-882.960) * (-890.315) (-884.925) [-884.740] (-883.172) -- 0:00:27
555000 -- [-883.537] (-884.115) (-885.186) (-884.860) * (-886.486) (-884.018) (-884.374) [-883.858] -- 0:00:27
Average standard deviation of split frequencies: 0.009750
555500 -- (-885.891) [-884.718] (-884.164) (-885.863) * [-883.735] (-884.980) (-884.118) (-885.876) -- 0:00:27
556000 -- (-883.679) [-883.654] (-884.203) (-884.274) * (-885.235) (-882.909) (-884.556) [-883.462] -- 0:00:27
556500 -- (-886.604) [-883.978] (-886.794) (-883.191) * (-886.255) (-886.730) (-883.632) [-885.966] -- 0:00:27
557000 -- (-885.017) [-883.499] (-888.647) (-882.836) * (-889.030) (-887.574) (-884.911) [-887.487] -- 0:00:27
557500 -- (-883.701) (-884.529) (-885.932) [-882.858] * (-883.793) (-883.415) (-883.633) [-883.911] -- 0:00:26
558000 -- (-886.984) (-883.548) (-882.988) [-885.210] * (-883.748) (-883.569) [-883.875] (-884.781) -- 0:00:26
558500 -- (-886.801) (-883.600) [-883.204] (-885.868) * (-892.621) (-885.381) (-883.575) [-883.726] -- 0:00:27
559000 -- (-886.532) (-884.674) [-884.830] (-886.977) * (-884.279) (-885.168) [-885.062] (-884.826) -- 0:00:27
559500 -- [-887.032] (-883.648) (-884.662) (-884.838) * (-884.848) (-888.006) (-883.000) [-884.777] -- 0:00:27
560000 -- (-885.375) (-886.400) (-885.894) [-883.916] * (-890.305) [-883.405] (-884.708) (-885.203) -- 0:00:27
Average standard deviation of split frequencies: 0.010300
560500 -- (-882.990) [-884.370] (-884.464) (-883.834) * (-887.465) (-885.529) [-884.722] (-885.249) -- 0:00:27
561000 -- (-882.838) (-886.124) [-884.213] (-883.774) * (-883.268) [-887.421] (-884.726) (-886.426) -- 0:00:27
561500 -- (-884.400) (-885.070) (-885.268) [-884.106] * (-884.501) (-885.620) [-882.959] (-886.122) -- 0:00:27
562000 -- [-885.366] (-887.403) (-882.880) (-882.658) * [-887.864] (-885.528) (-883.232) (-884.712) -- 0:00:27
562500 -- (-883.866) [-885.845] (-883.602) (-884.740) * (-885.564) [-888.184] (-888.371) (-883.698) -- 0:00:27
563000 -- [-882.387] (-883.780) (-882.948) (-882.437) * [-885.172] (-884.353) (-885.030) (-885.504) -- 0:00:27
563500 -- (-884.744) (-885.052) (-883.196) [-888.252] * (-884.595) (-889.685) [-887.388] (-887.964) -- 0:00:27
564000 -- [-884.728] (-884.521) (-882.525) (-882.880) * (-882.507) (-886.909) [-883.459] (-885.527) -- 0:00:27
564500 -- [-884.906] (-884.723) (-885.199) (-883.061) * (-883.518) (-886.320) [-885.720] (-883.205) -- 0:00:27
565000 -- (-888.713) (-884.737) (-884.493) [-883.503] * (-882.868) (-885.004) [-886.145] (-882.881) -- 0:00:26
Average standard deviation of split frequencies: 0.009942
565500 -- (-885.814) (-884.441) [-885.387] (-883.141) * (-882.606) (-885.325) [-884.973] (-883.358) -- 0:00:26
566000 -- (-886.110) [-883.757] (-883.371) (-883.343) * [-883.871] (-887.054) (-884.657) (-885.745) -- 0:00:26
566500 -- (-886.318) (-884.680) [-883.317] (-883.254) * (-884.101) (-885.397) (-882.683) [-885.062] -- 0:00:26
567000 -- (-883.755) (-884.154) [-884.523] (-883.049) * [-884.531] (-885.690) (-883.930) (-885.457) -- 0:00:26
567500 -- (-885.366) (-884.119) [-884.299] (-884.182) * (-884.291) (-884.673) (-884.751) [-883.580] -- 0:00:26
568000 -- (-885.516) (-883.813) [-883.854] (-882.876) * (-886.086) [-884.266] (-884.653) (-883.794) -- 0:00:26
568500 -- (-884.421) [-884.156] (-883.290) (-882.876) * (-885.034) (-884.197) [-886.030] (-886.436) -- 0:00:26
569000 -- (-887.064) (-883.017) [-883.902] (-882.764) * (-883.873) (-885.220) (-883.831) [-888.768] -- 0:00:26
569500 -- [-887.724] (-889.026) (-883.632) (-885.525) * (-884.657) [-886.972] (-883.723) (-886.773) -- 0:00:26
570000 -- (-884.189) [-884.969] (-885.512) (-886.391) * (-884.933) [-885.167] (-883.111) (-885.388) -- 0:00:26
Average standard deviation of split frequencies: 0.009500
570500 -- (-886.071) (-885.611) [-887.792] (-884.467) * [-883.699] (-888.697) (-885.272) (-888.620) -- 0:00:26
571000 -- (-887.210) [-885.969] (-885.746) (-882.973) * (-883.868) (-885.822) [-883.577] (-888.104) -- 0:00:26
571500 -- (-887.388) (-887.250) (-886.511) [-883.807] * (-884.900) (-882.381) [-883.739] (-885.397) -- 0:00:26
572000 -- (-886.566) (-883.848) (-888.379) [-883.161] * (-883.484) [-882.750] (-883.784) (-886.912) -- 0:00:26
572500 -- (-885.913) (-884.162) [-884.910] (-883.161) * (-884.396) (-885.548) (-883.727) [-887.041] -- 0:00:26
573000 -- (-886.368) [-883.806] (-885.913) (-883.386) * (-889.353) (-884.068) (-884.916) [-883.423] -- 0:00:26
573500 -- (-883.381) (-883.665) [-884.216] (-888.756) * (-884.194) [-883.375] (-886.541) (-884.703) -- 0:00:26
574000 -- [-884.126] (-883.547) (-887.180) (-888.465) * (-888.963) (-884.421) [-884.215] (-885.940) -- 0:00:25
574500 -- [-884.655] (-884.707) (-888.473) (-886.398) * (-883.955) (-886.271) [-883.399] (-885.870) -- 0:00:25
575000 -- (-883.615) (-884.603) (-884.221) [-884.979] * (-882.732) (-886.388) (-885.424) [-884.280] -- 0:00:25
Average standard deviation of split frequencies: 0.008951
575500 -- (-882.981) (-884.291) (-886.658) [-884.241] * [-882.492] (-884.619) (-888.474) (-883.664) -- 0:00:26
576000 -- [-885.974] (-885.031) (-883.886) (-885.366) * [-883.304] (-882.912) (-883.782) (-883.706) -- 0:00:26
576500 -- (-884.089) (-888.100) [-884.630] (-885.851) * (-886.721) [-883.325] (-883.145) (-885.300) -- 0:00:26
577000 -- (-884.742) (-885.235) (-887.732) [-885.147] * (-886.454) [-885.495] (-883.374) (-883.014) -- 0:00:26
577500 -- (-886.575) [-884.398] (-883.576) (-884.425) * (-888.399) [-884.681] (-884.604) (-884.298) -- 0:00:26
578000 -- (-885.116) [-888.625] (-883.871) (-882.854) * (-886.329) [-890.841] (-882.577) (-884.478) -- 0:00:26
578500 -- [-888.368] (-887.816) (-887.499) (-883.049) * [-884.331] (-889.153) (-883.125) (-884.593) -- 0:00:26
579000 -- (-885.640) (-884.088) [-884.278] (-884.858) * (-883.147) [-883.782] (-891.157) (-885.915) -- 0:00:26
579500 -- [-883.151] (-882.708) (-884.990) (-886.077) * [-884.069] (-883.283) (-887.445) (-883.587) -- 0:00:26
580000 -- (-883.258) (-885.160) (-884.614) [-884.273] * (-885.449) [-884.374] (-886.284) (-883.746) -- 0:00:26
Average standard deviation of split frequencies: 0.008575
580500 -- (-885.017) (-885.973) (-886.025) [-884.683] * (-884.154) (-882.940) [-887.945] (-884.825) -- 0:00:26
581000 -- [-885.965] (-885.470) (-884.832) (-884.032) * (-885.725) [-884.843] (-885.854) (-886.252) -- 0:00:25
581500 -- (-886.851) (-884.535) [-886.451] (-884.713) * [-884.774] (-885.068) (-884.483) (-885.671) -- 0:00:25
582000 -- (-884.296) (-883.603) (-886.554) [-883.123] * [-883.538] (-884.218) (-887.127) (-885.959) -- 0:00:25
582500 -- (-883.912) (-883.794) (-886.546) [-884.005] * [-886.690] (-884.973) (-883.288) (-883.152) -- 0:00:25
583000 -- (-884.893) [-883.925] (-887.438) (-884.163) * (-883.348) [-888.667] (-883.249) (-883.138) -- 0:00:25
583500 -- (-884.425) [-884.859] (-883.431) (-884.522) * (-883.293) (-886.683) (-884.752) [-884.412] -- 0:00:25
584000 -- [-885.271] (-884.797) (-887.747) (-885.718) * (-887.318) (-885.892) [-884.990] (-883.284) -- 0:00:25
584500 -- (-885.838) (-887.015) [-883.446] (-888.027) * (-891.556) (-885.293) (-886.866) [-883.713] -- 0:00:25
585000 -- (-883.100) (-885.817) [-885.239] (-883.167) * (-885.633) (-888.669) [-884.992] (-883.054) -- 0:00:25
Average standard deviation of split frequencies: 0.008346
585500 -- [-882.639] (-886.161) (-882.859) (-885.669) * (-884.652) [-886.128] (-884.204) (-882.543) -- 0:00:25
586000 -- [-883.826] (-885.479) (-884.301) (-884.667) * (-883.424) (-885.243) (-884.205) [-885.446] -- 0:00:25
586500 -- (-886.944) (-885.154) [-890.119] (-886.074) * (-883.420) (-887.433) (-883.960) [-885.514] -- 0:00:25
587000 -- (-883.876) (-883.625) [-883.678] (-887.196) * (-883.945) (-883.571) (-882.421) [-884.662] -- 0:00:25
587500 -- [-884.993] (-885.501) (-883.820) (-884.940) * (-886.792) [-883.396] (-883.151) (-882.994) -- 0:00:25
588000 -- (-883.803) [-884.707] (-887.260) (-887.173) * (-886.415) (-883.351) [-884.956] (-884.156) -- 0:00:25
588500 -- [-886.025] (-885.688) (-883.635) (-887.468) * (-884.247) [-885.199] (-884.181) (-884.126) -- 0:00:25
589000 -- (-886.348) (-885.455) [-885.147] (-886.515) * [-885.935] (-885.698) (-884.054) (-883.936) -- 0:00:25
589500 -- (-883.961) [-886.343] (-884.370) (-884.628) * [-885.773] (-882.857) (-885.026) (-884.156) -- 0:00:25
590000 -- [-884.378] (-885.240) (-884.036) (-883.406) * (-883.715) [-886.369] (-886.801) (-886.321) -- 0:00:25
Average standard deviation of split frequencies: 0.008979
590500 -- (-884.953) (-889.365) (-893.914) [-886.276] * (-884.089) [-886.008] (-885.840) (-885.053) -- 0:00:24
591000 -- (-884.273) [-883.837] (-883.882) (-887.510) * [-884.274] (-885.502) (-885.096) (-884.841) -- 0:00:24
591500 -- (-886.013) (-885.626) [-884.182] (-884.174) * (-886.445) (-887.336) (-884.008) [-885.267] -- 0:00:24
592000 -- (-882.560) (-883.860) (-882.905) [-885.963] * (-885.554) [-883.992] (-886.027) (-887.452) -- 0:00:25
592500 -- [-882.577] (-885.994) (-891.086) (-884.830) * (-883.450) (-884.836) [-883.737] (-887.020) -- 0:00:25
593000 -- (-885.596) (-886.104) [-882.562] (-891.336) * (-885.073) (-883.251) [-886.106] (-887.579) -- 0:00:25
593500 -- (-887.315) [-884.661] (-884.014) (-890.672) * (-886.499) [-882.932] (-882.710) (-883.927) -- 0:00:25
594000 -- (-885.365) (-884.245) (-884.267) [-883.927] * (-885.426) (-882.786) (-883.635) [-885.177] -- 0:00:25
594500 -- (-882.837) (-883.418) [-883.963] (-883.034) * (-884.418) [-883.174] (-882.571) (-884.825) -- 0:00:25
595000 -- (-889.698) [-884.736] (-891.038) (-892.821) * (-885.487) (-884.475) (-882.824) [-883.621] -- 0:00:25
Average standard deviation of split frequencies: 0.008651
595500 -- (-886.183) (-884.614) (-883.631) [-882.519] * (-888.248) (-885.408) [-882.808] (-884.496) -- 0:00:25
596000 -- (-885.972) (-884.765) (-885.116) [-882.689] * (-884.112) (-885.432) (-883.447) [-888.025] -- 0:00:25
596500 -- [-883.464] (-884.507) (-885.980) (-885.228) * [-883.914] (-887.419) (-884.053) (-886.432) -- 0:00:25
597000 -- [-888.321] (-883.064) (-884.343) (-885.553) * [-882.984] (-886.440) (-884.084) (-884.663) -- 0:00:24
597500 -- (-887.198) [-883.701] (-883.959) (-886.959) * (-883.295) (-887.339) (-884.891) [-885.345] -- 0:00:24
598000 -- (-884.780) (-885.215) [-888.564] (-884.583) * [-886.031] (-884.532) (-886.022) (-883.923) -- 0:00:24
598500 -- (-890.212) (-884.532) (-884.798) [-884.960] * [-885.442] (-884.998) (-886.545) (-883.984) -- 0:00:24
599000 -- (-889.291) (-882.998) (-883.878) [-884.571] * (-884.124) (-886.913) (-884.106) [-886.360] -- 0:00:24
599500 -- (-884.196) (-883.138) (-884.667) [-884.775] * (-885.274) (-889.025) [-884.326] (-886.639) -- 0:00:24
600000 -- [-882.746] (-886.331) (-883.238) (-890.130) * [-884.496] (-883.305) (-886.873) (-883.029) -- 0:00:24
Average standard deviation of split frequencies: 0.008005
600500 -- (-884.892) (-885.016) (-894.405) [-884.656] * (-885.104) (-886.204) (-884.600) [-885.117] -- 0:00:24
601000 -- (-888.193) (-892.160) (-885.104) [-883.272] * (-885.282) (-883.790) (-884.299) [-884.089] -- 0:00:24
601500 -- (-883.544) (-883.052) (-887.614) [-882.810] * (-885.491) [-885.034] (-883.847) (-884.097) -- 0:00:24
602000 -- (-884.928) [-885.705] (-886.134) (-885.554) * (-887.070) (-887.978) [-883.861] (-884.071) -- 0:00:24
602500 -- [-885.179] (-885.523) (-890.744) (-885.510) * (-885.293) (-887.478) (-885.660) [-884.266] -- 0:00:24
603000 -- [-883.097] (-884.163) (-883.263) (-887.738) * (-885.393) (-885.743) (-886.184) [-883.765] -- 0:00:24
603500 -- (-885.387) [-884.767] (-882.403) (-884.797) * [-884.197] (-885.876) (-883.832) (-884.569) -- 0:00:24
604000 -- [-883.455] (-883.590) (-885.515) (-884.999) * (-883.329) (-888.710) [-883.116] (-883.810) -- 0:00:24
604500 -- [-883.294] (-884.967) (-884.874) (-883.765) * (-886.269) (-888.803) [-883.882] (-885.065) -- 0:00:24
605000 -- (-886.932) [-884.466] (-888.896) (-886.328) * (-883.216) (-886.007) [-886.504] (-884.201) -- 0:00:24
Average standard deviation of split frequencies: 0.008246
605500 -- [-882.626] (-884.353) (-883.186) (-886.918) * [-884.167] (-886.671) (-885.766) (-883.907) -- 0:00:24
606000 -- [-884.436] (-885.368) (-885.195) (-885.516) * (-884.075) (-883.807) (-885.821) [-885.000] -- 0:00:24
606500 -- (-885.386) [-884.750] (-885.173) (-883.158) * [-884.855] (-885.689) (-885.358) (-883.464) -- 0:00:24
607000 -- (-883.023) [-885.106] (-887.636) (-893.370) * (-884.609) (-883.212) (-885.077) [-883.241] -- 0:00:23
607500 -- (-884.047) (-886.978) [-885.220] (-886.199) * (-889.411) (-884.438) [-884.822] (-884.725) -- 0:00:23
608000 -- (-883.013) (-883.207) [-884.327] (-885.569) * (-883.305) (-884.772) (-883.178) [-884.631] -- 0:00:23
608500 -- (-886.539) (-884.245) (-884.814) [-888.740] * [-883.734] (-884.603) (-888.513) (-886.057) -- 0:00:24
609000 -- (-883.932) (-887.222) (-883.512) [-883.229] * [-882.660] (-884.701) (-886.295) (-885.313) -- 0:00:24
609500 -- (-884.673) [-885.023] (-883.546) (-883.939) * (-883.711) [-884.865] (-884.644) (-883.421) -- 0:00:24
610000 -- (-883.008) (-885.401) (-883.466) [-883.033] * (-884.519) [-885.678] (-884.156) (-883.539) -- 0:00:24
Average standard deviation of split frequencies: 0.008080
610500 -- (-886.073) (-883.955) (-883.410) [-883.853] * (-885.511) [-884.701] (-884.847) (-886.781) -- 0:00:24
611000 -- (-884.541) (-883.490) (-886.256) [-885.043] * (-885.244) (-882.547) [-883.225] (-883.320) -- 0:00:24
611500 -- (-887.225) [-883.661] (-883.922) (-884.304) * (-883.618) (-884.299) (-884.079) [-882.581] -- 0:00:24
612000 -- (-887.960) [-884.262] (-885.887) (-885.068) * [-884.871] (-889.796) (-886.210) (-884.545) -- 0:00:24
612500 -- (-892.017) [-885.177] (-886.943) (-883.823) * (-884.069) (-886.097) (-887.839) [-883.143] -- 0:00:24
613000 -- [-888.447] (-885.069) (-883.500) (-883.390) * (-882.673) (-883.861) [-883.566] (-882.415) -- 0:00:23
613500 -- (-883.466) (-888.610) (-884.033) [-884.283] * [-883.059] (-890.248) (-885.314) (-884.246) -- 0:00:23
614000 -- [-883.301] (-886.056) (-884.545) (-890.597) * (-884.873) [-888.484] (-884.044) (-883.953) -- 0:00:23
614500 -- [-883.162] (-883.614) (-883.275) (-884.907) * (-886.246) (-886.065) (-883.558) [-882.292] -- 0:00:23
615000 -- (-883.432) (-884.174) [-883.158] (-884.513) * (-886.734) (-887.419) [-883.790] (-883.456) -- 0:00:23
Average standard deviation of split frequencies: 0.007959
615500 -- (-886.653) (-883.194) [-884.621] (-885.280) * (-883.005) (-887.339) [-883.283] (-882.858) -- 0:00:23
616000 -- (-888.649) (-883.791) [-883.664] (-885.037) * [-884.358] (-886.618) (-892.047) (-882.705) -- 0:00:23
616500 -- (-883.289) (-883.919) (-888.012) [-884.843] * (-882.409) [-885.408] (-889.201) (-885.653) -- 0:00:23
617000 -- [-884.107] (-886.318) (-886.089) (-891.317) * [-883.049] (-885.598) (-885.217) (-885.071) -- 0:00:23
617500 -- (-884.571) (-884.639) [-886.621] (-887.736) * (-889.166) (-885.405) [-883.944] (-883.203) -- 0:00:23
618000 -- (-884.535) (-887.602) [-886.062] (-887.278) * (-885.997) (-883.552) (-890.289) [-882.610] -- 0:00:23
618500 -- (-887.119) (-885.219) (-885.617) [-882.795] * (-883.775) (-886.112) (-888.558) [-885.282] -- 0:00:23
619000 -- [-885.735] (-885.447) (-888.472) (-883.796) * (-883.657) [-887.685] (-883.303) (-882.938) -- 0:00:23
619500 -- (-885.439) (-886.693) [-885.185] (-884.139) * [-884.366] (-888.586) (-885.835) (-885.946) -- 0:00:23
620000 -- (-885.860) (-883.561) (-884.792) [-885.196] * (-883.407) [-883.201] (-887.171) (-882.623) -- 0:00:23
Average standard deviation of split frequencies: 0.007595
620500 -- [-887.879] (-888.678) (-884.891) (-883.530) * (-887.069) (-882.702) (-886.248) [-884.157] -- 0:00:23
621000 -- [-884.183] (-884.540) (-884.263) (-890.094) * (-885.923) (-882.548) [-883.398] (-884.181) -- 0:00:23
621500 -- (-883.660) (-885.200) (-884.417) [-887.862] * (-883.716) (-883.719) [-882.649] (-883.995) -- 0:00:23
622000 -- (-885.143) (-883.704) (-886.427) [-884.302] * (-885.413) (-885.053) (-883.377) [-885.820] -- 0:00:23
622500 -- (-883.783) (-885.455) [-883.789] (-884.025) * (-886.852) (-885.964) [-883.778] (-884.905) -- 0:00:23
623000 -- (-882.745) [-883.903] (-885.697) (-883.864) * [-884.601] (-885.841) (-883.333) (-883.380) -- 0:00:22
623500 -- (-883.315) [-884.451] (-884.700) (-886.316) * (-888.648) (-886.239) [-886.651] (-886.612) -- 0:00:22
624000 -- (-883.580) (-884.081) (-885.937) [-886.685] * [-885.482] (-883.196) (-884.291) (-883.801) -- 0:00:22
624500 -- (-882.977) (-885.863) [-883.919] (-885.069) * (-884.649) (-885.346) [-885.050] (-892.950) -- 0:00:22
625000 -- (-884.599) (-884.577) (-886.510) [-885.907] * (-884.357) (-884.692) [-887.555] (-883.172) -- 0:00:22
Average standard deviation of split frequencies: 0.007279
625500 -- (-885.200) (-882.985) [-884.744] (-884.348) * [-886.464] (-884.475) (-885.730) (-886.445) -- 0:00:23
626000 -- (-883.749) (-885.886) [-883.730] (-887.354) * (-886.779) (-882.875) [-885.591] (-884.926) -- 0:00:23
626500 -- (-886.864) (-886.601) (-884.085) [-885.856] * (-884.266) (-883.611) [-883.081] (-882.930) -- 0:00:23
627000 -- (-888.183) (-885.254) [-885.862] (-884.227) * (-882.794) (-883.030) (-886.912) [-883.853] -- 0:00:23
627500 -- [-884.746] (-882.978) (-883.372) (-886.054) * [-882.731] (-882.897) (-889.999) (-883.920) -- 0:00:23
628000 -- (-886.290) (-883.866) (-885.759) [-883.651] * (-884.317) [-882.448] (-891.810) (-885.880) -- 0:00:23
628500 -- [-885.844] (-884.492) (-883.733) (-883.161) * [-882.737] (-884.257) (-891.800) (-883.868) -- 0:00:23
629000 -- (-884.499) (-884.231) [-883.755] (-883.798) * (-884.537) (-885.895) [-886.726] (-885.879) -- 0:00:23
629500 -- (-886.612) (-883.339) [-886.920] (-887.371) * (-883.765) (-883.672) [-885.143] (-886.202) -- 0:00:22
630000 -- (-884.090) (-885.973) [-882.946] (-885.135) * (-883.999) (-885.901) [-884.133] (-883.087) -- 0:00:22
Average standard deviation of split frequencies: 0.007774
630500 -- (-885.852) (-883.642) (-883.552) [-885.805] * [-885.133] (-885.252) (-885.497) (-884.057) -- 0:00:22
631000 -- (-884.749) [-882.375] (-883.410) (-883.631) * (-884.061) (-885.962) [-884.690] (-883.620) -- 0:00:22
631500 -- (-885.269) [-884.109] (-883.392) (-884.155) * (-882.851) [-885.336] (-884.814) (-883.598) -- 0:00:22
632000 -- (-884.150) [-883.007] (-884.240) (-884.351) * (-885.224) (-886.290) (-886.003) [-888.133] -- 0:00:22
632500 -- (-885.995) (-883.551) [-885.042] (-884.690) * (-885.516) (-885.674) [-883.826] (-888.061) -- 0:00:22
633000 -- (-887.065) (-884.689) [-885.556] (-884.090) * (-883.717) [-885.635] (-883.452) (-883.951) -- 0:00:22
633500 -- (-885.608) (-884.715) [-883.939] (-884.961) * (-888.606) [-884.160] (-884.005) (-884.429) -- 0:00:22
634000 -- [-888.631] (-886.418) (-886.610) (-883.318) * (-883.942) (-887.108) (-889.195) [-884.047] -- 0:00:22
634500 -- (-884.019) (-886.261) (-884.740) [-883.731] * [-889.181] (-886.018) (-883.878) (-884.364) -- 0:00:22
635000 -- (-885.124) (-882.684) [-883.275] (-890.116) * (-884.918) (-886.114) [-882.725] (-886.805) -- 0:00:22
Average standard deviation of split frequencies: 0.007116
635500 -- (-887.754) (-882.977) (-884.017) [-884.325] * (-882.487) (-883.724) [-883.942] (-886.156) -- 0:00:22
636000 -- (-886.096) (-884.985) (-884.581) [-884.400] * (-882.461) (-884.841) (-882.510) [-886.801] -- 0:00:22
636500 -- (-891.319) (-883.982) (-885.909) [-886.166] * [-883.208] (-883.214) (-885.960) (-885.724) -- 0:00:22
637000 -- (-885.820) [-882.529] (-884.172) (-885.565) * (-884.280) [-892.534] (-888.872) (-885.225) -- 0:00:22
637500 -- (-890.945) [-884.157] (-886.078) (-885.422) * [-883.318] (-886.033) (-884.032) (-884.710) -- 0:00:22
638000 -- (-884.517) [-886.220] (-884.831) (-884.404) * [-883.768] (-886.014) (-885.146) (-885.005) -- 0:00:22
638500 -- [-885.552] (-885.672) (-885.003) (-885.320) * (-884.969) [-884.046] (-890.016) (-887.289) -- 0:00:22
639000 -- (-887.225) (-883.538) (-885.657) [-882.568] * (-887.127) [-882.951] (-882.814) (-883.083) -- 0:00:22
639500 -- (-888.890) (-883.033) (-885.717) [-883.904] * (-882.856) (-885.949) (-883.657) [-885.496] -- 0:00:21
640000 -- (-886.272) [-883.334] (-885.720) (-889.353) * (-883.239) [-884.019] (-883.591) (-883.763) -- 0:00:21
Average standard deviation of split frequencies: 0.007309
640500 -- (-887.219) (-886.591) [-883.049] (-884.253) * (-885.215) (-886.800) [-882.367] (-885.686) -- 0:00:21
641000 -- (-883.876) (-884.255) [-885.134] (-884.312) * (-885.106) (-885.599) [-882.198] (-882.926) -- 0:00:21
641500 -- [-885.107] (-882.385) (-890.459) (-884.376) * (-887.915) (-883.566) [-884.571] (-884.876) -- 0:00:21
642000 -- (-885.041) (-883.800) (-885.919) [-884.972] * (-883.162) [-882.793] (-883.870) (-884.082) -- 0:00:22
642500 -- [-888.012] (-883.187) (-885.427) (-883.779) * (-883.568) (-891.116) [-885.683] (-883.484) -- 0:00:22
643000 -- (-884.176) (-883.001) (-887.897) [-884.147] * (-884.434) [-889.793] (-884.294) (-894.013) -- 0:00:22
643500 -- [-883.187] (-883.135) (-885.102) (-885.971) * (-883.572) (-887.453) [-884.283] (-893.839) -- 0:00:22
644000 -- (-887.106) (-884.852) [-883.940] (-885.809) * (-883.248) (-884.486) [-884.470] (-888.112) -- 0:00:22
644500 -- (-885.947) (-883.292) [-886.167] (-890.925) * (-884.606) (-884.864) (-886.931) [-886.070] -- 0:00:22
645000 -- (-885.067) (-885.360) [-885.476] (-885.849) * (-884.198) (-886.433) (-884.179) [-883.814] -- 0:00:22
Average standard deviation of split frequencies: 0.007434
645500 -- (-883.998) [-888.565] (-884.118) (-890.278) * (-884.965) (-891.032) [-885.058] (-885.234) -- 0:00:21
646000 -- (-884.452) [-883.799] (-884.020) (-889.940) * [-885.044] (-885.579) (-886.056) (-886.405) -- 0:00:21
646500 -- (-883.506) (-885.916) (-883.107) [-883.764] * (-884.080) (-883.302) (-884.595) [-884.677] -- 0:00:21
647000 -- (-883.001) [-884.146] (-887.249) (-883.405) * (-885.729) (-885.710) [-883.364] (-883.835) -- 0:00:21
647500 -- (-889.916) (-886.407) (-885.470) [-883.251] * (-884.244) [-883.915] (-886.921) (-889.668) -- 0:00:21
648000 -- (-891.089) (-883.173) [-885.498] (-883.525) * [-890.202] (-885.155) (-891.356) (-884.618) -- 0:00:21
648500 -- (-886.130) [-882.678] (-886.185) (-883.289) * (-882.953) (-884.134) [-886.055] (-888.051) -- 0:00:21
649000 -- (-883.299) [-883.355] (-887.459) (-883.980) * (-888.558) (-884.533) (-884.032) [-888.195] -- 0:00:21
649500 -- [-884.844] (-884.433) (-886.244) (-885.299) * [-883.473] (-885.668) (-883.812) (-883.936) -- 0:00:21
650000 -- (-883.507) (-888.645) [-882.501] (-885.133) * (-884.497) (-884.796) [-884.349] (-883.354) -- 0:00:21
Average standard deviation of split frequencies: 0.007438
650500 -- (-885.875) [-888.091] (-883.423) (-885.768) * (-886.662) (-887.603) [-883.917] (-883.161) -- 0:00:21
651000 -- [-882.831] (-884.835) (-885.885) (-883.409) * (-883.244) (-883.553) (-883.825) [-882.366] -- 0:00:21
651500 -- (-885.614) (-887.175) [-884.185] (-885.111) * (-885.497) [-883.855] (-885.526) (-885.779) -- 0:00:21
652000 -- (-884.410) [-885.024] (-885.934) (-884.997) * (-884.643) [-883.075] (-886.003) (-883.114) -- 0:00:21
652500 -- (-886.771) (-883.887) (-884.892) [-886.638] * (-885.279) (-882.849) [-882.972] (-884.573) -- 0:00:21
653000 -- (-887.645) (-884.827) (-884.426) [-883.445] * [-883.049] (-883.724) (-882.755) (-884.306) -- 0:00:21
653500 -- (-887.016) (-888.066) [-883.007] (-888.322) * (-886.005) [-886.199] (-883.851) (-883.166) -- 0:00:21
654000 -- (-883.967) [-887.460] (-883.553) (-886.359) * [-884.985] (-884.288) (-885.809) (-883.518) -- 0:00:21
654500 -- (-883.782) (-883.369) (-884.779) [-882.780] * (-887.382) (-883.312) (-884.084) [-884.877] -- 0:00:21
655000 -- (-883.523) (-883.904) (-886.961) [-883.463] * [-886.808] (-882.904) (-886.875) (-884.718) -- 0:00:21
Average standard deviation of split frequencies: 0.007330
655500 -- [-884.062] (-884.666) (-883.153) (-883.301) * (-883.414) (-884.343) (-887.005) [-885.750] -- 0:00:21
656000 -- (-885.007) (-885.702) (-887.599) [-883.656] * (-883.982) (-883.481) [-884.199] (-885.626) -- 0:00:20
656500 -- [-883.757] (-884.872) (-885.933) (-883.609) * [-885.749] (-885.304) (-886.135) (-882.504) -- 0:00:20
657000 -- (-884.311) [-886.630] (-885.571) (-883.593) * (-884.599) (-886.180) [-883.754] (-882.830) -- 0:00:20
657500 -- (-886.039) [-884.336] (-885.137) (-888.343) * (-883.603) (-886.571) (-884.256) [-884.630] -- 0:00:20
658000 -- (-885.249) (-883.937) [-886.448] (-882.702) * (-883.551) (-883.215) [-883.910] (-884.764) -- 0:00:20
658500 -- (-883.947) [-883.198] (-888.721) (-882.922) * (-886.072) (-882.972) [-886.807] (-886.021) -- 0:00:21
659000 -- [-884.495] (-884.340) (-886.176) (-884.801) * (-884.291) [-883.909] (-885.758) (-885.554) -- 0:00:21
659500 -- (-884.098) (-887.786) [-886.638] (-886.934) * [-883.993] (-883.999) (-886.532) (-884.002) -- 0:00:21
660000 -- (-887.893) (-885.266) (-883.699) [-886.313] * (-883.460) (-882.813) [-883.922] (-884.866) -- 0:00:21
Average standard deviation of split frequencies: 0.007326
660500 -- (-884.590) (-885.519) [-883.301] (-886.719) * (-882.746) [-883.274] (-883.304) (-883.422) -- 0:00:21
661000 -- (-886.906) (-884.713) (-883.774) [-884.409] * (-883.430) (-887.358) [-886.293] (-884.449) -- 0:00:21
661500 -- (-883.306) (-884.556) [-884.094] (-882.559) * (-883.552) [-888.778] (-884.415) (-884.185) -- 0:00:20
662000 -- (-885.487) (-884.747) [-882.967] (-886.534) * (-885.925) [-884.881] (-884.025) (-884.128) -- 0:00:20
662500 -- [-884.099] (-884.865) (-883.529) (-883.124) * (-888.168) (-885.352) (-883.726) [-886.275] -- 0:00:20
663000 -- [-885.289] (-883.726) (-884.725) (-883.121) * (-891.151) (-886.101) [-883.472] (-885.055) -- 0:00:20
663500 -- (-886.663) [-884.456] (-886.440) (-883.273) * (-883.931) [-883.435] (-884.416) (-884.137) -- 0:00:20
664000 -- (-889.804) [-886.047] (-884.699) (-887.059) * [-883.815] (-883.807) (-883.994) (-883.455) -- 0:00:20
664500 -- [-885.992] (-885.611) (-886.030) (-885.917) * (-883.280) [-885.656] (-883.363) (-883.953) -- 0:00:20
665000 -- (-883.724) (-885.961) [-885.134] (-886.631) * (-884.736) (-886.454) [-886.501] (-882.933) -- 0:00:20
Average standard deviation of split frequencies: 0.007125
665500 -- (-884.759) [-883.833] (-887.617) (-885.223) * [-883.163] (-882.327) (-888.540) (-887.879) -- 0:00:20
666000 -- (-884.698) (-886.722) (-892.174) [-884.104] * [-883.901] (-883.553) (-884.695) (-886.307) -- 0:00:20
666500 -- (-887.488) (-884.910) (-883.839) [-888.433] * (-884.461) (-884.568) (-886.130) [-885.311] -- 0:00:20
667000 -- (-888.416) (-884.869) [-889.000] (-882.927) * [-883.194] (-883.813) (-888.373) (-885.692) -- 0:00:20
667500 -- (-883.871) [-888.155] (-886.338) (-884.332) * (-883.388) (-883.024) (-885.284) [-883.658] -- 0:00:20
668000 -- (-884.638) [-884.544] (-884.146) (-886.520) * (-884.858) (-885.654) (-884.913) [-884.108] -- 0:00:20
668500 -- (-885.061) (-885.138) (-882.921) [-883.533] * (-883.771) (-883.892) [-884.344] (-888.070) -- 0:00:20
669000 -- (-888.223) (-884.056) [-885.162] (-884.357) * [-883.245] (-883.625) (-883.966) (-885.521) -- 0:00:20
669500 -- (-887.378) (-889.329) (-884.416) [-883.367] * (-882.567) (-884.939) (-883.418) [-885.467] -- 0:00:20
670000 -- (-884.650) (-885.224) (-884.354) [-883.462] * (-886.792) [-884.064] (-884.075) (-892.478) -- 0:00:20
Average standard deviation of split frequencies: 0.007357
670500 -- (-885.166) (-883.813) (-883.864) [-884.552] * [-885.333] (-882.737) (-883.831) (-885.891) -- 0:00:20
671000 -- (-887.335) (-883.287) (-883.781) [-886.119] * [-883.912] (-882.973) (-884.122) (-887.261) -- 0:00:20
671500 -- (-886.681) [-884.041] (-883.246) (-886.611) * (-883.308) [-882.976] (-885.806) (-887.864) -- 0:00:20
672000 -- (-886.443) (-884.380) [-884.435] (-884.117) * (-883.971) [-883.780] (-885.683) (-885.298) -- 0:00:20
672500 -- (-885.863) (-887.252) (-886.773) [-884.117] * (-883.637) [-885.754] (-883.755) (-886.784) -- 0:00:19
673000 -- (-883.895) [-883.919] (-883.927) (-884.123) * (-883.176) (-884.473) (-884.298) [-884.104] -- 0:00:19
673500 -- (-886.241) [-886.988] (-883.873) (-885.260) * [-884.688] (-884.481) (-885.251) (-883.804) -- 0:00:19
674000 -- [-883.587] (-885.047) (-884.029) (-884.341) * (-884.661) (-883.274) [-884.243] (-883.088) -- 0:00:19
674500 -- (-882.992) (-884.306) (-883.039) [-886.442] * [-885.051] (-887.784) (-882.870) (-883.330) -- 0:00:19
675000 -- (-884.911) [-884.103] (-884.373) (-885.563) * (-887.384) [-886.535] (-886.178) (-883.778) -- 0:00:19
Average standard deviation of split frequencies: 0.007624
675500 -- (-888.957) [-883.742] (-885.808) (-883.990) * [-886.475] (-884.916) (-889.976) (-883.688) -- 0:00:20
676000 -- [-885.952] (-883.389) (-886.021) (-887.110) * (-884.916) (-888.249) [-887.157] (-887.085) -- 0:00:20
676500 -- (-884.055) (-883.584) [-882.965] (-886.481) * [-883.974] (-884.056) (-884.332) (-886.638) -- 0:00:20
677000 -- (-888.605) (-883.867) (-883.834) [-887.486] * (-882.929) [-883.537] (-885.174) (-883.474) -- 0:00:20
677500 -- (-888.300) (-885.182) (-888.290) [-888.424] * (-885.543) (-885.773) (-883.885) [-885.239] -- 0:00:19
678000 -- (-884.297) (-885.995) (-882.793) [-885.892] * (-885.722) [-888.651] (-884.073) (-885.416) -- 0:00:19
678500 -- [-883.278] (-883.590) (-889.916) (-885.429) * (-884.661) (-888.804) (-883.407) [-886.039] -- 0:00:19
679000 -- (-884.310) [-887.154] (-891.136) (-884.670) * (-886.503) (-883.385) [-884.440] (-884.093) -- 0:00:19
679500 -- (-885.437) (-884.039) [-882.950] (-885.857) * [-888.058] (-884.139) (-887.328) (-883.894) -- 0:00:19
680000 -- (-886.500) (-888.130) [-883.087] (-883.179) * [-888.045] (-883.220) (-887.752) (-884.986) -- 0:00:19
Average standard deviation of split frequencies: 0.007341
680500 -- [-884.042] (-885.917) (-883.164) (-884.570) * (-884.361) [-884.459] (-883.135) (-884.290) -- 0:00:19
681000 -- (-887.395) [-885.671] (-883.184) (-884.556) * (-884.368) (-884.078) (-883.483) [-885.763] -- 0:00:19
681500 -- (-884.036) (-883.157) (-882.868) [-883.553] * (-885.382) (-886.454) [-884.504] (-883.704) -- 0:00:19
682000 -- (-887.337) (-883.159) [-884.961] (-883.222) * (-885.863) (-885.344) (-885.321) [-884.718] -- 0:00:19
682500 -- [-886.700] (-886.008) (-884.933) (-883.838) * (-884.442) [-883.172] (-884.854) (-886.565) -- 0:00:19
683000 -- (-885.361) (-884.501) (-885.267) [-885.454] * (-884.336) (-883.602) [-883.249] (-888.485) -- 0:00:19
683500 -- (-884.787) [-883.285] (-884.667) (-883.875) * (-887.784) [-884.613] (-886.806) (-889.763) -- 0:00:19
684000 -- [-888.912] (-890.038) (-883.624) (-884.046) * (-886.725) (-885.803) [-883.818] (-888.228) -- 0:00:19
684500 -- (-883.604) [-884.094] (-883.194) (-883.424) * [-882.903] (-882.528) (-883.162) (-888.344) -- 0:00:19
685000 -- (-885.988) (-884.239) (-884.156) [-885.763] * [-883.970] (-883.624) (-884.593) (-883.258) -- 0:00:19
Average standard deviation of split frequencies: 0.008160
685500 -- (-884.253) [-887.888] (-883.258) (-884.439) * (-886.430) [-883.851] (-884.820) (-882.632) -- 0:00:19
686000 -- (-882.513) (-883.701) (-882.792) [-883.869] * (-884.965) (-885.696) (-883.748) [-884.165] -- 0:00:19
686500 -- [-883.550] (-885.363) (-883.734) (-882.984) * (-884.335) (-890.227) [-884.280] (-884.122) -- 0:00:19
687000 -- (-883.225) (-885.017) (-883.375) [-882.984] * (-884.599) [-886.185] (-888.735) (-884.140) -- 0:00:19
687500 -- (-884.477) (-883.221) [-883.682] (-884.896) * (-884.165) (-886.021) [-883.162] (-884.274) -- 0:00:19
688000 -- (-885.517) (-885.115) [-887.622] (-889.233) * (-884.925) (-884.599) (-887.362) [-887.443] -- 0:00:19
688500 -- [-883.222] (-884.200) (-884.661) (-884.967) * (-887.048) (-883.363) [-886.090] (-888.300) -- 0:00:19
689000 -- [-884.359] (-884.392) (-884.781) (-883.265) * [-883.530] (-882.820) (-884.121) (-883.519) -- 0:00:18
689500 -- [-884.029] (-885.148) (-884.188) (-884.678) * (-884.210) [-884.082] (-883.480) (-883.958) -- 0:00:18
690000 -- [-882.863] (-885.182) (-885.554) (-883.638) * (-888.493) (-896.279) [-883.376] (-884.798) -- 0:00:18
Average standard deviation of split frequencies: 0.007235
690500 -- (-884.641) (-885.909) (-884.090) [-883.591] * (-886.328) (-886.897) (-883.621) [-883.698] -- 0:00:18
691000 -- (-885.108) (-884.758) [-882.374] (-885.243) * [-884.006] (-882.701) (-885.282) (-885.218) -- 0:00:18
691500 -- (-884.425) (-885.932) (-886.883) [-884.639] * [-883.762] (-886.641) (-887.424) (-885.999) -- 0:00:18
692000 -- (-883.759) (-885.055) (-886.407) [-885.731] * [-884.289] (-887.396) (-883.984) (-885.494) -- 0:00:19
692500 -- [-885.742] (-886.040) (-883.592) (-885.899) * (-887.129) (-885.110) [-885.438] (-887.802) -- 0:00:19
693000 -- (-884.812) (-886.422) (-884.067) [-883.620] * (-886.021) (-883.950) (-885.278) [-882.918] -- 0:00:19
693500 -- (-885.900) (-887.078) (-886.918) [-884.655] * (-885.570) (-886.548) [-884.802] (-886.108) -- 0:00:19
694000 -- [-882.832] (-884.655) (-885.945) (-883.578) * (-882.684) (-886.409) (-887.560) [-888.233] -- 0:00:18
694500 -- (-885.627) [-884.302] (-884.427) (-884.003) * [-883.019] (-884.009) (-891.207) (-884.840) -- 0:00:18
695000 -- (-884.378) [-883.572] (-889.983) (-885.642) * (-885.952) (-884.817) (-886.347) [-882.858] -- 0:00:18
Average standard deviation of split frequencies: 0.008255
695500 -- (-883.636) (-883.374) (-889.537) [-884.206] * (-883.739) (-887.096) (-885.370) [-882.874] -- 0:00:18
696000 -- (-883.657) (-885.690) (-891.085) [-884.769] * (-883.358) (-884.301) [-883.829] (-887.189) -- 0:00:18
696500 -- (-884.190) [-886.730] (-891.242) (-885.753) * (-888.280) [-883.104] (-885.175) (-886.007) -- 0:00:18
697000 -- (-884.238) (-883.801) (-884.566) [-885.740] * [-888.149] (-884.892) (-885.028) (-886.492) -- 0:00:18
697500 -- (-886.387) [-888.861] (-883.027) (-884.049) * (-885.820) (-885.847) (-883.923) [-884.413] -- 0:00:18
698000 -- (-886.827) (-885.290) [-883.756] (-885.115) * (-883.260) (-890.867) [-885.284] (-883.707) -- 0:00:18
698500 -- (-887.198) [-883.757] (-883.673) (-885.530) * (-883.512) (-883.971) [-885.860] (-887.450) -- 0:00:18
699000 -- (-883.862) [-883.832] (-883.990) (-886.077) * (-885.863) [-887.276] (-885.280) (-883.638) -- 0:00:18
699500 -- (-887.422) (-884.120) (-885.147) [-884.660] * (-885.412) (-885.005) [-887.449] (-882.814) -- 0:00:18
700000 -- [-885.665] (-884.026) (-883.532) (-886.452) * [-884.494] (-888.825) (-884.450) (-884.978) -- 0:00:18
Average standard deviation of split frequencies: 0.008284
700500 -- (-887.544) (-886.324) [-884.942] (-884.609) * (-883.307) (-889.267) [-884.864] (-885.012) -- 0:00:18
701000 -- [-883.482] (-889.152) (-886.497) (-885.269) * (-883.862) [-892.434] (-885.710) (-885.129) -- 0:00:18
701500 -- [-882.816] (-888.571) (-884.851) (-885.440) * (-889.875) [-889.087] (-883.489) (-888.583) -- 0:00:18
702000 -- (-886.406) (-885.558) [-886.842] (-884.923) * (-883.384) (-884.280) [-884.478] (-884.736) -- 0:00:18
702500 -- (-888.417) [-883.611] (-885.398) (-885.453) * (-882.777) (-886.152) (-884.136) [-885.059] -- 0:00:18
703000 -- (-886.172) (-884.541) [-883.931] (-886.012) * [-886.341] (-882.987) (-884.908) (-887.819) -- 0:00:18
703500 -- (-882.928) (-883.198) (-884.514) [-883.780] * (-886.207) (-882.975) [-884.910] (-884.620) -- 0:00:18
704000 -- [-882.916] (-883.102) (-883.769) (-885.485) * (-883.814) (-884.105) (-887.696) [-883.629] -- 0:00:18
704500 -- [-887.522] (-882.903) (-883.547) (-883.043) * (-884.298) (-884.750) [-887.641] (-883.508) -- 0:00:18
705000 -- (-885.736) (-882.996) [-884.050] (-882.859) * (-888.626) (-886.326) (-883.809) [-886.753] -- 0:00:17
Average standard deviation of split frequencies: 0.008597
705500 -- (-887.625) [-885.050] (-885.903) (-883.711) * (-887.351) [-887.098] (-883.551) (-889.786) -- 0:00:17
706000 -- [-882.770] (-884.463) (-885.847) (-884.773) * [-889.323] (-886.554) (-883.946) (-890.948) -- 0:00:17
706500 -- [-884.295] (-885.285) (-884.163) (-885.176) * [-883.839] (-884.358) (-886.017) (-890.890) -- 0:00:17
707000 -- (-884.138) (-887.550) [-883.087] (-882.689) * (-885.697) (-882.920) (-883.777) [-883.042] -- 0:00:17
707500 -- (-883.326) (-886.610) (-887.421) [-885.229] * (-883.117) (-886.102) [-884.584] (-884.143) -- 0:00:17
708000 -- (-886.219) (-885.998) [-884.225] (-885.455) * [-882.901] (-883.840) (-883.019) (-884.682) -- 0:00:17
708500 -- (-884.031) (-888.097) [-883.696] (-887.538) * [-887.306] (-884.883) (-883.026) (-889.591) -- 0:00:18
709000 -- (-885.474) [-883.908] (-883.130) (-883.722) * (-883.562) (-884.081) [-886.436] (-885.525) -- 0:00:18
709500 -- (-884.654) (-885.788) [-884.699] (-883.871) * (-887.437) (-886.193) (-884.176) [-883.183] -- 0:00:18
710000 -- (-885.338) [-886.411] (-883.010) (-887.043) * (-883.893) [-885.899] (-883.055) (-884.487) -- 0:00:17
Average standard deviation of split frequencies: 0.008748
710500 -- (-885.986) (-887.318) (-883.417) [-887.611] * (-883.935) (-886.479) [-882.439] (-883.798) -- 0:00:17
711000 -- (-884.834) [-884.505] (-887.526) (-887.546) * (-883.130) (-885.685) (-887.370) [-882.757] -- 0:00:17
711500 -- (-884.172) [-884.986] (-888.464) (-885.275) * [-883.715] (-884.999) (-885.851) (-885.620) -- 0:00:17
712000 -- (-883.245) (-885.728) (-884.734) [-883.627] * (-885.140) (-887.848) [-884.040] (-884.915) -- 0:00:17
712500 -- (-884.482) (-882.846) (-883.016) [-885.223] * (-883.925) (-883.142) (-884.003) [-884.725] -- 0:00:17
713000 -- [-883.094] (-884.118) (-883.137) (-885.592) * (-883.049) (-883.482) (-882.847) [-883.407] -- 0:00:17
713500 -- (-885.687) (-884.696) (-884.133) [-883.501] * (-884.949) [-884.634] (-887.332) (-883.493) -- 0:00:17
714000 -- [-882.723] (-884.012) (-883.194) (-884.510) * (-885.922) (-885.785) [-885.798] (-885.234) -- 0:00:17
714500 -- (-887.230) (-882.329) (-884.905) [-883.241] * [-885.727] (-884.592) (-888.216) (-888.905) -- 0:00:17
715000 -- (-887.171) [-883.500] (-886.840) (-882.561) * [-882.834] (-887.122) (-882.850) (-886.436) -- 0:00:17
Average standard deviation of split frequencies: 0.007901
715500 -- [-884.933] (-887.071) (-883.899) (-884.265) * (-883.457) [-884.164] (-886.031) (-887.309) -- 0:00:17
716000 -- (-885.543) (-882.928) [-883.334] (-883.914) * (-883.014) (-882.998) [-889.096] (-891.534) -- 0:00:17
716500 -- (-887.117) (-885.955) [-885.350] (-884.582) * (-883.813) [-885.676] (-887.724) (-887.148) -- 0:00:17
717000 -- (-884.901) (-885.238) [-884.540] (-883.511) * (-885.382) (-888.975) [-884.145] (-886.702) -- 0:00:17
717500 -- (-891.113) (-887.110) (-884.734) [-886.106] * (-886.049) (-883.744) (-882.412) [-883.689] -- 0:00:17
718000 -- (-888.206) [-886.659] (-884.756) (-884.573) * (-890.114) (-883.172) [-882.759] (-883.238) -- 0:00:17
718500 -- (-883.649) (-884.950) (-885.732) [-884.520] * (-886.751) (-885.839) [-882.693] (-885.110) -- 0:00:17
719000 -- [-884.410] (-883.644) (-890.388) (-883.739) * (-883.286) (-886.294) (-884.211) [-883.221] -- 0:00:17
719500 -- (-887.822) (-883.003) (-884.991) [-884.452] * (-885.505) (-883.158) (-887.844) [-884.318] -- 0:00:17
720000 -- (-891.365) (-883.686) (-885.193) [-886.931] * (-887.799) (-882.848) [-883.707] (-884.065) -- 0:00:17
Average standard deviation of split frequencies: 0.007762
720500 -- (-885.410) (-884.518) (-883.068) [-885.466] * (-885.782) (-884.745) [-885.083] (-885.060) -- 0:00:17
721000 -- (-884.641) (-885.710) (-885.187) [-883.810] * (-883.999) (-885.598) (-884.225) [-888.751] -- 0:00:17
721500 -- (-888.070) (-885.695) (-885.831) [-884.196] * (-882.907) (-886.122) (-882.886) [-886.288] -- 0:00:16
722000 -- [-883.320] (-884.849) (-885.905) (-884.796) * (-883.094) (-886.255) (-882.888) [-883.880] -- 0:00:16
722500 -- (-883.388) (-884.679) [-882.834] (-883.638) * (-886.263) (-883.906) [-882.997] (-884.096) -- 0:00:16
723000 -- (-882.908) (-883.370) (-885.110) [-884.769] * (-886.202) (-883.652) [-883.601] (-884.004) -- 0:00:16
723500 -- (-882.846) [-882.632] (-885.232) (-885.997) * (-884.959) [-884.022] (-884.840) (-883.915) -- 0:00:16
724000 -- (-884.317) (-883.861) (-885.288) [-887.192] * (-884.884) [-884.396] (-882.923) (-888.227) -- 0:00:16
724500 -- (-883.684) (-883.965) (-889.171) [-882.575] * (-882.412) (-884.549) [-883.815] (-883.258) -- 0:00:16
725000 -- (-891.732) [-884.998] (-884.637) (-884.189) * (-882.402) (-885.485) (-886.057) [-883.365] -- 0:00:17
Average standard deviation of split frequencies: 0.008441
725500 -- (-885.869) (-883.497) (-887.376) [-887.224] * (-882.445) (-884.916) (-882.891) [-883.611] -- 0:00:17
726000 -- (-884.079) (-884.111) (-887.558) [-882.756] * (-883.951) [-885.429] (-884.086) (-884.753) -- 0:00:16
726500 -- (-885.936) (-884.374) (-885.439) [-886.346] * (-884.610) [-884.159] (-882.489) (-888.648) -- 0:00:16
727000 -- (-883.598) (-885.444) [-884.637] (-885.993) * (-882.768) (-885.410) [-887.063] (-887.673) -- 0:00:16
727500 -- (-883.769) (-886.309) [-885.494] (-884.577) * (-885.196) (-883.366) [-883.525] (-883.267) -- 0:00:16
728000 -- [-884.703] (-883.406) (-883.807) (-884.402) * (-887.555) (-882.823) (-884.314) [-883.075] -- 0:00:16
728500 -- (-882.631) (-883.013) [-883.538] (-884.180) * [-884.608] (-883.143) (-888.793) (-883.076) -- 0:00:16
729000 -- (-884.521) [-883.530] (-886.456) (-883.028) * (-886.731) [-883.151] (-889.516) (-882.474) -- 0:00:16
729500 -- (-883.817) [-885.564] (-886.203) (-885.927) * (-884.164) [-883.892] (-885.128) (-883.987) -- 0:00:16
730000 -- (-884.145) (-885.359) [-884.308] (-885.097) * [-883.510] (-885.771) (-886.799) (-886.117) -- 0:00:16
Average standard deviation of split frequencies: 0.008428
730500 -- (-882.665) (-884.010) (-884.643) [-884.788] * (-882.305) [-886.582] (-884.454) (-886.079) -- 0:00:16
731000 -- (-883.955) (-886.839) (-885.432) [-883.485] * (-884.542) (-883.651) [-885.611] (-885.294) -- 0:00:16
731500 -- (-888.419) (-882.485) [-884.541] (-882.819) * [-883.604] (-883.765) (-883.234) (-884.335) -- 0:00:16
732000 -- [-886.249] (-885.340) (-885.699) (-884.893) * (-883.683) [-888.634] (-883.387) (-887.574) -- 0:00:16
732500 -- (-886.113) [-891.133] (-883.668) (-883.467) * (-885.862) (-882.818) (-883.382) [-884.924] -- 0:00:16
733000 -- [-884.028] (-886.079) (-884.794) (-883.052) * [-884.269] (-884.780) (-883.044) (-882.739) -- 0:00:16
733500 -- [-885.642] (-882.743) (-883.429) (-884.776) * [-886.778] (-891.191) (-886.980) (-883.065) -- 0:00:16
734000 -- [-893.071] (-883.095) (-885.798) (-883.910) * (-884.883) (-882.870) (-884.181) [-885.359] -- 0:00:16
734500 -- (-889.378) (-883.873) [-883.560] (-886.530) * [-882.812] (-883.145) (-886.854) (-885.837) -- 0:00:16
735000 -- (-883.921) [-885.125] (-884.248) (-886.148) * (-884.453) (-883.340) [-882.969] (-884.020) -- 0:00:16
Average standard deviation of split frequencies: 0.008487
735500 -- (-884.040) (-882.955) [-886.115] (-884.128) * [-885.173] (-883.173) (-883.266) (-884.516) -- 0:00:16
736000 -- (-883.429) (-885.050) (-888.971) [-884.118] * (-884.003) [-885.725] (-886.267) (-884.707) -- 0:00:16
736500 -- (-882.769) [-884.585] (-883.516) (-884.080) * (-883.412) [-882.843] (-884.610) (-885.694) -- 0:00:16
737000 -- (-890.400) (-883.914) [-883.145] (-883.604) * [-883.653] (-885.115) (-883.666) (-885.922) -- 0:00:16
737500 -- (-892.919) [-883.995] (-884.032) (-884.222) * [-882.995] (-884.930) (-885.696) (-884.643) -- 0:00:16
738000 -- (-889.396) [-883.915] (-883.580) (-884.163) * (-883.521) [-884.707] (-887.423) (-884.038) -- 0:00:15
738500 -- (-884.562) (-883.111) [-885.930] (-884.559) * [-883.490] (-884.856) (-884.219) (-882.672) -- 0:00:15
739000 -- [-884.296] (-883.775) (-882.698) (-883.783) * [-886.204] (-885.792) (-883.846) (-883.642) -- 0:00:15
739500 -- (-883.706) [-887.760] (-883.614) (-884.189) * (-884.102) (-883.180) (-887.593) [-882.622] -- 0:00:15
740000 -- (-882.994) (-884.249) [-886.611] (-884.754) * (-884.512) [-887.881] (-885.318) (-884.812) -- 0:00:15
Average standard deviation of split frequencies: 0.007256
740500 -- (-884.641) (-883.906) (-885.829) [-885.532] * (-885.083) (-887.466) [-889.252] (-887.000) -- 0:00:15
741000 -- [-883.913] (-883.967) (-883.354) (-887.993) * (-885.247) [-883.031] (-890.314) (-887.454) -- 0:00:15
741500 -- [-883.835] (-883.660) (-884.612) (-883.310) * (-884.655) [-883.219] (-884.718) (-888.469) -- 0:00:16
742000 -- [-883.542] (-889.603) (-883.274) (-883.313) * (-885.512) [-883.452] (-886.548) (-883.794) -- 0:00:15
742500 -- (-889.625) (-888.645) [-883.605] (-889.111) * (-883.076) [-884.579] (-883.551) (-882.970) -- 0:00:15
743000 -- (-888.721) (-887.130) [-885.954] (-884.440) * (-883.192) [-886.946] (-884.311) (-884.195) -- 0:00:15
743500 -- (-883.281) (-886.254) [-882.353] (-885.783) * (-883.104) [-886.365] (-883.774) (-883.301) -- 0:00:15
744000 -- (-884.846) (-885.484) (-884.088) [-883.124] * [-882.757] (-884.674) (-882.846) (-883.269) -- 0:00:15
744500 -- (-887.814) [-885.605] (-883.497) (-885.377) * (-887.993) [-886.010] (-885.463) (-884.846) -- 0:00:15
745000 -- (-885.894) (-884.409) [-886.996] (-884.008) * (-886.708) [-884.470] (-885.052) (-884.601) -- 0:00:15
Average standard deviation of split frequencies: 0.007978
745500 -- [-886.509] (-884.202) (-882.919) (-886.339) * (-882.981) (-885.774) (-887.601) [-883.626] -- 0:00:15
746000 -- (-882.598) [-884.572] (-884.531) (-885.318) * [-883.819] (-883.442) (-884.047) (-883.867) -- 0:00:15
746500 -- [-884.882] (-887.167) (-883.392) (-887.688) * [-883.272] (-884.374) (-887.122) (-884.451) -- 0:00:15
747000 -- (-884.796) (-885.506) (-885.431) [-884.393] * [-883.211] (-884.861) (-884.851) (-886.355) -- 0:00:15
747500 -- (-885.172) [-887.081] (-887.596) (-886.005) * (-882.955) (-885.553) (-884.872) [-884.585] -- 0:00:15
748000 -- (-884.738) [-882.843] (-889.479) (-888.080) * (-883.153) (-889.188) (-885.856) [-885.293] -- 0:00:15
748500 -- [-885.621] (-886.007) (-885.039) (-887.605) * (-891.888) (-885.782) (-884.249) [-883.518] -- 0:00:15
749000 -- (-888.853) (-886.190) [-883.894] (-884.377) * [-886.657] (-883.282) (-884.497) (-887.970) -- 0:00:15
749500 -- (-884.101) (-884.356) [-884.835] (-883.721) * (-884.783) [-884.092] (-885.561) (-883.819) -- 0:00:15
750000 -- (-884.844) (-887.218) [-884.047] (-883.739) * (-886.739) [-886.494] (-888.228) (-883.940) -- 0:00:15
Average standard deviation of split frequencies: 0.007033
750500 -- (-884.244) (-883.274) [-884.373] (-883.543) * (-886.288) (-885.705) (-885.165) [-884.996] -- 0:00:15
751000 -- (-883.823) (-882.776) [-885.322] (-885.584) * (-886.151) (-883.491) [-884.763] (-883.478) -- 0:00:15
751500 -- (-884.552) [-884.350] (-883.331) (-885.708) * (-886.145) (-882.769) (-884.784) [-886.228] -- 0:00:15
752000 -- (-883.953) [-885.361] (-884.704) (-888.373) * (-887.893) (-887.623) [-885.617] (-886.105) -- 0:00:15
752500 -- (-884.346) (-885.906) [-886.499] (-887.669) * (-883.905) (-888.274) (-882.405) [-885.600] -- 0:00:15
753000 -- (-884.772) [-886.021] (-886.116) (-885.180) * (-885.431) [-885.795] (-882.591) (-886.392) -- 0:00:15
753500 -- [-883.010] (-887.690) (-883.986) (-884.274) * (-884.210) [-885.250] (-882.408) (-885.204) -- 0:00:15
754000 -- (-885.835) (-886.760) [-884.019] (-883.240) * (-883.429) (-885.269) [-886.800] (-886.978) -- 0:00:15
754500 -- (-885.441) (-883.967) (-885.982) [-883.723] * (-883.625) (-883.057) [-884.947] (-883.672) -- 0:00:14
755000 -- (-885.130) (-885.131) (-884.883) [-886.429] * (-887.259) (-884.778) (-885.457) [-883.647] -- 0:00:14
Average standard deviation of split frequencies: 0.007441
755500 -- (-885.276) [-885.657] (-884.938) (-884.513) * (-886.134) (-883.175) (-883.579) [-884.116] -- 0:00:14
756000 -- (-884.673) (-892.298) [-882.894] (-888.103) * (-884.472) (-884.154) (-884.624) [-883.944] -- 0:00:14
756500 -- (-884.704) [-886.544] (-882.710) (-885.071) * (-884.015) (-886.090) (-888.247) [-885.128] -- 0:00:14
757000 -- (-883.345) (-884.473) (-883.339) [-885.569] * (-886.028) (-884.051) (-889.105) [-884.503] -- 0:00:14
757500 -- (-885.560) [-882.857] (-884.445) (-884.310) * (-882.751) (-883.651) [-888.229] (-887.303) -- 0:00:14
758000 -- (-883.811) (-886.851) [-884.642] (-885.764) * [-884.743] (-887.005) (-885.233) (-885.910) -- 0:00:14
758500 -- [-883.745] (-884.334) (-886.290) (-884.237) * (-885.630) (-884.187) [-887.369] (-883.045) -- 0:00:14
759000 -- (-884.295) (-884.565) [-884.194] (-888.252) * (-884.902) (-882.797) [-884.062] (-882.967) -- 0:00:14
759500 -- (-885.099) [-883.014] (-886.759) (-884.422) * (-885.328) [-884.208] (-884.512) (-885.409) -- 0:00:14
760000 -- (-891.301) [-883.999] (-886.903) (-886.883) * (-885.212) (-885.219) (-883.395) [-887.587] -- 0:00:14
Average standard deviation of split frequencies: 0.007643
760500 -- (-886.715) [-888.169] (-886.363) (-890.364) * [-884.150] (-883.582) (-886.202) (-891.687) -- 0:00:14
761000 -- [-883.622] (-885.716) (-884.204) (-888.117) * (-883.318) (-883.564) [-885.107] (-886.280) -- 0:00:14
761500 -- [-883.296] (-884.965) (-885.107) (-883.987) * [-883.357] (-886.262) (-886.976) (-884.836) -- 0:00:14
762000 -- (-883.811) (-883.851) (-886.516) [-883.540] * (-884.648) (-890.964) (-890.545) [-883.835] -- 0:00:14
762500 -- [-883.487] (-886.449) (-885.211) (-884.081) * (-884.543) (-888.627) [-885.056] (-886.274) -- 0:00:14
763000 -- [-883.689] (-892.677) (-886.169) (-883.468) * (-883.537) (-886.041) (-885.886) [-884.409] -- 0:00:14
763500 -- [-885.739] (-883.346) (-884.613) (-887.323) * (-884.971) (-883.891) (-885.673) [-885.951] -- 0:00:14
764000 -- (-883.248) (-890.533) (-883.950) [-884.852] * [-884.954] (-883.302) (-888.781) (-885.761) -- 0:00:14
764500 -- (-884.085) [-884.599] (-884.816) (-885.884) * (-883.986) (-883.589) (-884.748) [-885.230] -- 0:00:14
765000 -- (-883.179) (-888.107) (-884.572) [-887.744] * [-886.329] (-884.026) (-887.038) (-885.048) -- 0:00:14
Average standard deviation of split frequencies: 0.007713
765500 -- [-884.006] (-885.358) (-884.103) (-883.750) * [-883.729] (-885.962) (-882.743) (-883.583) -- 0:00:14
766000 -- (-885.997) (-885.245) (-883.799) [-884.866] * (-884.548) [-884.428] (-885.626) (-887.249) -- 0:00:14
766500 -- (-882.751) (-882.415) (-885.485) [-883.542] * (-889.049) (-886.518) [-885.170] (-886.086) -- 0:00:14
767000 -- (-883.007) (-885.987) (-884.892) [-882.930] * (-885.241) (-888.924) (-886.401) [-885.478] -- 0:00:14
767500 -- [-882.393] (-883.363) (-883.427) (-885.076) * (-883.095) [-887.006] (-884.081) (-883.194) -- 0:00:14
768000 -- [-885.212] (-883.743) (-883.456) (-883.904) * [-882.763] (-882.453) (-883.606) (-884.121) -- 0:00:14
768500 -- (-886.065) (-885.689) [-883.781] (-883.948) * (-882.564) (-883.597) (-883.059) [-884.501] -- 0:00:14
769000 -- [-883.287] (-885.916) (-885.724) (-888.400) * (-883.890) [-882.839] (-887.427) (-887.866) -- 0:00:14
769500 -- [-884.737] (-884.481) (-884.627) (-888.369) * (-884.405) [-886.118] (-891.042) (-886.863) -- 0:00:14
770000 -- (-884.792) (-884.588) (-885.515) [-883.206] * (-886.979) (-886.367) (-885.591) [-883.270] -- 0:00:14
Average standard deviation of split frequencies: 0.007911
770500 -- [-885.167] (-884.200) (-885.309) (-884.246) * (-885.325) (-883.834) [-885.954] (-886.999) -- 0:00:13
771000 -- (-885.272) (-883.913) (-883.043) [-886.271] * (-887.294) [-886.263] (-885.074) (-885.847) -- 0:00:13
771500 -- (-883.151) [-883.582] (-884.856) (-888.354) * (-883.058) (-884.261) [-884.836] (-886.214) -- 0:00:13
772000 -- [-883.397] (-885.603) (-884.031) (-886.538) * (-885.771) [-884.481] (-884.947) (-885.594) -- 0:00:13
772500 -- (-882.561) (-883.012) [-884.445] (-884.718) * [-883.875] (-883.498) (-886.071) (-884.979) -- 0:00:13
773000 -- (-882.939) (-882.965) [-885.476] (-883.959) * (-886.692) (-885.593) (-883.509) [-883.254] -- 0:00:13
773500 -- [-884.952] (-884.201) (-885.590) (-884.275) * (-884.411) (-886.225) (-884.070) [-883.041] -- 0:00:13
774000 -- (-883.889) [-882.801] (-884.913) (-884.067) * (-884.135) (-885.351) [-882.578] (-883.697) -- 0:00:13
774500 -- (-884.040) (-884.433) (-886.760) [-884.423] * (-883.358) (-887.772) (-889.230) [-884.825] -- 0:00:13
775000 -- (-882.688) (-889.051) [-885.590] (-882.973) * [-884.055] (-887.306) (-886.703) (-885.313) -- 0:00:13
Average standard deviation of split frequencies: 0.007776
775500 -- (-883.241) [-885.184] (-886.378) (-884.069) * [-888.385] (-895.391) (-887.048) (-886.314) -- 0:00:13
776000 -- (-882.918) (-883.731) [-882.633] (-886.145) * (-886.254) (-887.952) [-888.124] (-887.090) -- 0:00:13
776500 -- (-884.652) [-888.126] (-885.184) (-887.172) * (-882.577) (-885.174) [-883.869] (-886.402) -- 0:00:13
777000 -- (-884.796) (-885.226) (-884.413) [-886.817] * (-882.855) [-884.457] (-885.748) (-883.845) -- 0:00:13
777500 -- (-891.151) (-887.335) (-883.284) [-886.576] * (-883.726) (-884.682) [-885.578] (-884.010) -- 0:00:13
778000 -- (-885.584) (-883.936) [-884.186] (-885.539) * (-887.497) (-888.781) [-883.305] (-884.223) -- 0:00:13
778500 -- [-885.067] (-886.677) (-882.832) (-885.615) * (-883.913) [-886.663] (-885.370) (-885.965) -- 0:00:13
779000 -- (-885.490) (-887.379) (-885.903) [-886.416] * (-885.114) [-883.682] (-883.995) (-883.129) -- 0:00:13
779500 -- (-884.282) (-883.880) [-885.791] (-886.952) * (-886.275) (-886.081) (-883.464) [-884.250] -- 0:00:13
780000 -- (-884.245) (-889.791) [-885.579] (-884.859) * (-889.202) (-889.328) [-883.040] (-884.752) -- 0:00:13
Average standard deviation of split frequencies: 0.007528
780500 -- (-883.999) (-890.233) (-883.013) [-885.708] * [-883.686] (-882.941) (-888.607) (-884.339) -- 0:00:13
781000 -- (-882.989) (-886.063) (-885.586) [-883.038] * (-885.600) (-889.413) (-886.471) [-883.615] -- 0:00:13
781500 -- (-882.622) (-883.633) [-885.235] (-884.388) * [-884.156] (-885.949) (-882.896) (-885.116) -- 0:00:13
782000 -- [-885.205] (-883.207) (-883.290) (-882.588) * (-886.087) [-884.660] (-882.985) (-884.876) -- 0:00:13
782500 -- (-884.032) [-883.230] (-887.426) (-885.793) * (-884.697) (-885.490) [-883.783] (-883.873) -- 0:00:13
783000 -- (-884.965) (-883.687) [-884.195] (-890.373) * [-883.072] (-884.313) (-883.343) (-885.136) -- 0:00:13
783500 -- (-884.160) [-887.129] (-882.903) (-884.468) * (-884.274) [-884.315] (-883.531) (-885.023) -- 0:00:13
784000 -- (-884.223) (-885.149) [-883.092] (-886.948) * (-883.770) [-885.621] (-883.494) (-885.805) -- 0:00:13
784500 -- (-886.230) (-884.111) (-883.594) [-883.320] * (-889.117) (-884.574) [-882.727] (-885.236) -- 0:00:13
785000 -- (-884.322) (-883.825) [-884.960] (-883.035) * (-884.345) [-885.597] (-883.876) (-884.791) -- 0:00:13
Average standard deviation of split frequencies: 0.007437
785500 -- [-882.405] (-886.023) (-883.531) (-885.361) * (-884.605) [-884.655] (-891.548) (-885.405) -- 0:00:13
786000 -- (-883.677) (-889.344) (-883.363) [-884.897] * (-883.511) (-884.696) (-885.290) [-884.521] -- 0:00:13
786500 -- (-884.452) [-884.128] (-883.528) (-887.656) * (-883.340) [-884.865] (-885.846) (-887.148) -- 0:00:13
787000 -- [-884.882] (-886.069) (-883.611) (-888.122) * (-891.166) [-884.880] (-892.581) (-885.554) -- 0:00:12
787500 -- [-884.776] (-884.161) (-887.128) (-883.944) * (-887.575) (-884.564) (-882.786) [-886.127] -- 0:00:12
788000 -- (-882.792) (-884.167) (-884.615) [-885.838] * (-883.152) (-882.892) (-882.829) [-883.334] -- 0:00:12
788500 -- (-883.869) (-884.683) [-886.728] (-883.332) * (-884.778) [-883.665] (-887.003) (-882.973) -- 0:00:12
789000 -- [-885.008] (-884.269) (-885.722) (-883.833) * (-887.099) [-885.056] (-885.339) (-883.416) -- 0:00:12
789500 -- [-885.677] (-886.973) (-887.709) (-882.814) * (-884.180) [-884.274] (-886.504) (-888.252) -- 0:00:12
790000 -- (-886.576) (-882.867) [-886.452] (-883.655) * (-885.093) [-884.804] (-883.890) (-890.402) -- 0:00:12
Average standard deviation of split frequencies: 0.007234
790500 -- (-890.388) (-883.298) [-884.894] (-883.804) * (-888.202) (-884.233) (-883.694) [-883.689] -- 0:00:12
791000 -- (-884.772) (-884.231) [-884.779] (-888.976) * (-884.544) (-884.277) [-882.774] (-883.434) -- 0:00:12
791500 -- (-884.529) [-885.381] (-886.072) (-885.736) * [-885.261] (-882.957) (-885.939) (-887.731) -- 0:00:12
792000 -- (-887.100) (-884.264) [-886.518] (-883.546) * (-883.111) (-882.957) (-884.572) [-883.982] -- 0:00:12
792500 -- (-885.875) [-886.852] (-883.626) (-882.396) * (-885.113) (-883.635) [-887.583] (-883.769) -- 0:00:12
793000 -- (-884.608) (-888.504) (-883.505) [-882.396] * (-888.467) [-883.140] (-887.855) (-887.714) -- 0:00:12
793500 -- (-883.887) [-884.581] (-886.671) (-885.816) * (-888.475) (-883.958) [-885.278] (-884.285) -- 0:00:12
794000 -- (-884.314) (-888.085) (-885.358) [-888.227] * (-883.314) (-883.538) (-890.001) [-884.345] -- 0:00:12
794500 -- (-886.599) [-886.830] (-890.893) (-882.890) * (-883.353) (-883.012) (-884.840) [-885.256] -- 0:00:12
795000 -- (-887.938) [-885.352] (-888.882) (-884.992) * [-884.233] (-887.035) (-885.120) (-883.634) -- 0:00:12
Average standard deviation of split frequencies: 0.007218
795500 -- (-890.567) [-883.300] (-886.388) (-886.368) * (-884.294) [-887.143] (-888.240) (-884.781) -- 0:00:12
796000 -- (-889.460) (-884.629) [-883.264] (-885.046) * (-884.754) (-888.041) [-882.520] (-886.380) -- 0:00:12
796500 -- (-888.334) (-882.527) [-884.074] (-885.050) * (-884.263) (-884.957) [-882.397] (-884.247) -- 0:00:12
797000 -- [-886.933] (-884.360) (-884.541) (-884.010) * (-884.005) (-883.515) (-883.425) [-883.582] -- 0:00:12
797500 -- [-885.015] (-885.777) (-883.447) (-887.249) * (-887.555) [-886.141] (-884.284) (-885.075) -- 0:00:12
798000 -- (-887.719) (-885.924) [-885.952] (-883.114) * (-886.230) (-885.600) (-885.316) [-884.586] -- 0:00:12
798500 -- (-885.817) (-885.923) (-886.214) [-882.835] * [-885.816] (-883.127) (-884.760) (-883.179) -- 0:00:12
799000 -- (-883.618) (-884.164) (-887.526) [-884.011] * (-882.459) [-886.031] (-883.472) (-883.790) -- 0:00:12
799500 -- [-888.987] (-885.543) (-885.053) (-884.343) * (-883.404) (-892.294) [-882.618] (-883.546) -- 0:00:12
800000 -- (-884.634) (-888.612) (-884.556) [-884.444] * (-883.528) (-887.683) [-883.333] (-883.566) -- 0:00:12
Average standard deviation of split frequencies: 0.007249
800500 -- [-883.443] (-882.684) (-883.334) (-885.156) * (-891.835) (-884.984) [-886.133] (-885.502) -- 0:00:12
801000 -- (-882.610) (-882.927) [-885.218] (-884.091) * (-885.863) [-886.868] (-883.924) (-885.816) -- 0:00:12
801500 -- (-883.832) (-883.673) [-884.204] (-884.067) * (-883.805) (-885.061) [-884.540] (-884.929) -- 0:00:12
802000 -- (-885.885) (-884.247) (-884.192) [-883.633] * [-883.977] (-890.705) (-883.678) (-884.913) -- 0:00:12
802500 -- (-884.793) [-883.437] (-885.022) (-882.727) * (-885.576) (-884.722) (-887.201) [-883.100] -- 0:00:12
803000 -- (-883.360) [-885.075] (-883.637) (-888.168) * [-883.441] (-885.159) (-894.201) (-883.407) -- 0:00:12
803500 -- (-885.356) (-883.949) [-884.155] (-886.425) * (-883.413) (-888.003) (-887.200) [-883.889] -- 0:00:11
804000 -- (-886.314) (-886.629) [-882.947] (-885.791) * [-886.180] (-883.862) (-884.576) (-884.912) -- 0:00:11
804500 -- (-882.944) (-885.845) [-882.636] (-885.268) * (-889.999) (-884.376) [-887.903] (-885.654) -- 0:00:11
805000 -- (-883.585) [-884.348] (-883.364) (-886.810) * (-884.328) (-888.833) [-883.820] (-886.805) -- 0:00:11
Average standard deviation of split frequencies: 0.007092
805500 -- (-883.273) [-882.533] (-884.817) (-885.429) * (-885.472) (-884.936) [-884.157] (-886.174) -- 0:00:11
806000 -- (-885.091) (-882.375) (-885.530) [-883.714] * (-884.665) (-884.387) [-884.387] (-884.003) -- 0:00:11
806500 -- (-885.907) [-883.906] (-885.222) (-884.184) * (-887.879) [-886.115] (-886.538) (-882.816) -- 0:00:11
807000 -- (-883.556) (-884.171) (-884.434) [-883.577] * [-886.546] (-887.116) (-884.248) (-884.456) -- 0:00:11
807500 -- [-884.176] (-883.462) (-884.157) (-883.111) * (-888.054) [-887.857] (-886.818) (-884.761) -- 0:00:11
808000 -- [-885.100] (-884.369) (-884.467) (-883.150) * (-885.700) (-885.061) (-886.485) [-884.961] -- 0:00:11
808500 -- (-884.148) (-884.599) [-884.782] (-885.907) * (-890.020) (-885.829) [-885.622] (-885.043) -- 0:00:11
809000 -- (-884.763) (-886.997) (-886.761) [-884.085] * (-886.637) (-886.148) [-885.674] (-884.633) -- 0:00:11
809500 -- (-883.592) (-883.914) (-888.405) [-885.432] * (-885.191) [-885.518] (-887.045) (-884.734) -- 0:00:11
810000 -- [-882.859] (-889.357) (-887.660) (-887.682) * (-886.317) (-885.774) (-885.148) [-883.622] -- 0:00:11
Average standard deviation of split frequencies: 0.007123
810500 -- (-882.623) (-885.421) (-884.675) [-886.768] * (-888.430) [-885.893] (-885.520) (-883.141) -- 0:00:11
811000 -- (-882.623) [-883.540] (-885.436) (-886.816) * (-887.175) (-889.390) (-889.677) [-883.306] -- 0:00:11
811500 -- (-884.275) (-883.891) [-887.405] (-890.162) * [-886.242] (-886.161) (-885.239) (-883.153) -- 0:00:11
812000 -- (-886.667) (-885.550) (-884.369) [-887.898] * (-889.024) (-883.974) [-885.745] (-888.455) -- 0:00:11
812500 -- [-883.350] (-883.372) (-884.622) (-887.446) * (-886.235) (-882.841) (-883.915) [-883.725] -- 0:00:11
813000 -- [-883.772] (-883.185) (-882.905) (-888.227) * [-883.382] (-883.098) (-886.116) (-883.408) -- 0:00:11
813500 -- [-884.428] (-882.360) (-885.030) (-883.820) * [-889.126] (-886.966) (-883.785) (-884.843) -- 0:00:11
814000 -- (-883.379) (-884.946) (-886.228) [-884.700] * (-884.055) (-885.893) (-883.856) [-883.212] -- 0:00:11
814500 -- [-883.269] (-884.047) (-886.083) (-884.665) * [-885.857] (-884.830) (-884.178) (-883.865) -- 0:00:11
815000 -- (-883.269) [-884.983] (-886.756) (-884.937) * [-886.727] (-884.427) (-883.101) (-882.961) -- 0:00:11
Average standard deviation of split frequencies: 0.007402
815500 -- (-889.960) [-883.511] (-885.799) (-884.564) * [-888.211] (-885.828) (-882.850) (-883.022) -- 0:00:11
816000 -- (-886.211) (-883.223) [-884.906] (-887.545) * (-886.798) [-885.986] (-884.517) (-883.491) -- 0:00:11
816500 -- (-888.599) (-891.638) (-883.354) [-884.890] * (-886.003) (-889.307) [-883.336] (-886.364) -- 0:00:11
817000 -- [-883.521] (-886.278) (-887.038) (-886.546) * (-882.803) (-885.988) [-883.846] (-885.774) -- 0:00:11
817500 -- (-882.568) (-884.624) [-886.674] (-889.291) * [-884.906] (-887.449) (-883.100) (-884.578) -- 0:00:11
818000 -- (-883.050) [-888.077] (-884.641) (-891.376) * (-886.044) (-886.660) (-887.302) [-884.091] -- 0:00:11
818500 -- (-883.225) [-885.542] (-883.332) (-885.177) * (-885.077) (-883.275) [-883.823] (-884.243) -- 0:00:11
819000 -- (-885.322) [-884.411] (-883.608) (-884.728) * [-883.984] (-885.071) (-886.504) (-883.444) -- 0:00:11
819500 -- (-883.604) (-883.532) (-886.747) [-885.220] * (-883.923) (-884.201) (-883.670) [-883.441] -- 0:00:11
820000 -- (-885.812) (-884.519) (-886.627) [-884.191] * [-883.107] (-884.076) (-883.594) (-884.330) -- 0:00:10
Average standard deviation of split frequencies: 0.007503
820500 -- (-885.048) (-885.690) [-884.399] (-885.807) * [-883.005] (-883.920) (-883.767) (-887.284) -- 0:00:10
821000 -- (-884.036) (-882.742) [-884.944] (-885.599) * (-885.602) (-887.043) [-885.308] (-884.596) -- 0:00:10
821500 -- [-883.402] (-885.688) (-883.685) (-885.900) * (-884.199) (-884.789) [-884.673] (-884.931) -- 0:00:10
822000 -- (-887.014) (-883.637) [-884.682] (-884.414) * (-889.011) (-883.636) [-885.951] (-883.334) -- 0:00:10
822500 -- [-884.667] (-884.261) (-883.819) (-890.230) * (-887.129) [-885.330] (-885.992) (-883.801) -- 0:00:10
823000 -- (-882.933) [-882.817] (-883.735) (-882.555) * (-887.389) (-885.175) [-883.252] (-886.058) -- 0:00:10
823500 -- (-885.125) (-882.880) [-883.565] (-883.616) * (-884.040) [-885.735] (-882.974) (-883.773) -- 0:00:10
824000 -- [-884.695] (-885.322) (-884.810) (-882.457) * (-883.942) [-883.543] (-883.790) (-887.375) -- 0:00:10
824500 -- (-885.240) (-885.819) [-886.146] (-882.804) * [-884.675] (-884.628) (-883.430) (-886.702) -- 0:00:10
825000 -- (-883.572) (-884.905) [-883.884] (-882.992) * (-887.852) (-885.541) [-886.190] (-887.608) -- 0:00:10
Average standard deviation of split frequencies: 0.007455
825500 -- (-884.584) (-885.139) [-883.759] (-882.997) * (-889.343) (-888.213) (-884.528) [-884.875] -- 0:00:10
826000 -- (-884.312) (-884.853) [-888.683] (-884.310) * (-887.664) (-883.750) [-884.311] (-884.839) -- 0:00:10
826500 -- (-886.293) (-883.209) (-886.515) [-885.948] * [-885.072] (-883.627) (-886.138) (-883.228) -- 0:00:10
827000 -- (-887.282) [-883.228] (-885.888) (-885.697) * [-884.421] (-884.971) (-885.040) (-885.198) -- 0:00:10
827500 -- (-888.587) [-884.408] (-884.049) (-885.642) * (-884.643) [-884.609] (-886.959) (-885.817) -- 0:00:10
828000 -- (-885.192) (-883.952) (-884.245) [-883.336] * (-884.779) (-884.376) (-885.003) [-885.009] -- 0:00:10
828500 -- (-884.657) (-885.525) [-885.110] (-882.946) * [-886.025] (-884.619) (-884.693) (-886.629) -- 0:00:10
829000 -- (-884.694) [-883.205] (-883.190) (-885.754) * (-886.049) (-886.875) [-885.321] (-885.845) -- 0:00:10
829500 -- [-885.234] (-882.791) (-883.770) (-883.024) * [-884.368] (-883.851) (-883.516) (-886.627) -- 0:00:10
830000 -- (-885.399) (-885.051) [-884.249] (-885.197) * (-888.470) (-884.899) (-884.655) [-887.043] -- 0:00:10
Average standard deviation of split frequencies: 0.007626
830500 -- (-886.069) [-883.891] (-883.531) (-888.737) * (-889.604) (-884.408) (-887.952) [-886.718] -- 0:00:10
831000 -- (-886.513) (-883.082) [-884.284] (-885.236) * (-883.724) (-884.813) (-884.688) [-885.876] -- 0:00:10
831500 -- (-883.570) (-886.632) [-884.859] (-887.257) * (-884.662) (-884.652) (-885.710) [-886.635] -- 0:00:10
832000 -- (-889.284) (-884.769) (-890.928) [-884.864] * (-885.613) (-882.831) (-890.630) [-882.736] -- 0:00:10
832500 -- [-884.528] (-886.565) (-885.764) (-887.365) * (-886.174) (-884.459) [-885.079] (-883.404) -- 0:00:10
833000 -- [-883.419] (-886.755) (-883.129) (-882.808) * (-888.646) (-884.846) (-884.961) [-883.229] -- 0:00:10
833500 -- [-884.200] (-882.731) (-884.762) (-885.093) * (-887.311) [-888.010] (-885.975) (-883.221) -- 0:00:10
834000 -- (-884.723) (-882.917) [-887.031] (-886.354) * (-883.159) (-887.140) [-883.929] (-883.496) -- 0:00:10
834500 -- (-888.344) (-887.412) [-885.206] (-883.763) * (-883.824) (-886.241) (-884.394) [-883.496] -- 0:00:10
835000 -- (-886.326) (-884.825) (-887.011) [-885.868] * (-884.715) (-887.495) [-884.616] (-885.431) -- 0:00:10
Average standard deviation of split frequencies: 0.007366
835500 -- (-886.693) (-886.316) [-888.371] (-884.853) * (-884.028) [-886.539] (-884.710) (-886.742) -- 0:00:10
836000 -- (-884.313) (-886.719) [-884.037] (-884.324) * [-883.647] (-885.666) (-887.931) (-886.928) -- 0:00:10
836500 -- (-884.088) (-885.337) (-891.563) [-885.203] * (-883.222) (-886.035) [-887.743] (-885.537) -- 0:00:09
837000 -- (-882.878) [-885.351] (-885.126) (-885.247) * (-886.558) (-885.402) [-883.707] (-887.601) -- 0:00:09
837500 -- (-886.605) [-885.192] (-884.356) (-884.646) * (-883.503) (-886.495) (-886.175) [-885.189] -- 0:00:09
838000 -- (-884.492) [-884.553] (-882.968) (-886.013) * (-883.061) [-885.491] (-885.282) (-884.189) -- 0:00:09
838500 -- [-883.207] (-883.432) (-883.559) (-883.899) * (-883.061) (-888.548) (-886.023) [-882.880] -- 0:00:09
839000 -- (-886.227) (-883.797) (-885.215) [-884.127] * [-884.415] (-885.002) (-885.778) (-885.643) -- 0:00:09
839500 -- (-884.041) (-883.795) [-885.592] (-884.865) * (-885.003) (-888.792) (-884.740) [-885.175] -- 0:00:09
840000 -- (-884.586) [-885.013] (-884.955) (-886.317) * (-886.381) (-888.959) (-883.267) [-884.088] -- 0:00:09
Average standard deviation of split frequencies: 0.007255
840500 -- (-884.085) (-883.629) [-884.037] (-884.955) * (-882.950) (-889.655) [-886.959] (-887.975) -- 0:00:09
841000 -- (-884.258) (-883.778) [-884.411] (-888.939) * (-887.483) (-884.646) [-885.723] (-887.758) -- 0:00:09
841500 -- (-886.889) [-882.763] (-886.723) (-885.092) * (-888.563) [-884.479] (-884.827) (-885.046) -- 0:00:09
842000 -- [-883.709] (-884.339) (-887.463) (-883.153) * (-883.148) [-884.322] (-883.839) (-889.853) -- 0:00:09
842500 -- (-883.839) (-885.597) (-884.530) [-882.585] * (-883.689) [-882.640] (-886.413) (-888.033) -- 0:00:09
843000 -- (-884.540) [-883.474] (-883.523) (-882.544) * [-886.077] (-884.658) (-888.426) (-883.233) -- 0:00:09
843500 -- (-883.248) (-887.754) (-889.598) [-883.006] * (-883.785) (-894.660) (-886.601) [-885.173] -- 0:00:09
844000 -- [-883.418] (-889.539) (-882.855) (-887.489) * (-883.099) (-891.687) [-884.123] (-885.897) -- 0:00:09
844500 -- [-885.331] (-885.661) (-884.911) (-884.444) * (-883.265) (-886.330) (-882.862) [-884.042] -- 0:00:09
845000 -- (-885.134) [-884.024] (-884.318) (-882.869) * (-882.926) (-883.487) [-883.329] (-883.306) -- 0:00:09
Average standard deviation of split frequencies: 0.007244
845500 -- (-889.361) [-883.209] (-883.298) (-885.591) * (-883.299) [-883.766] (-883.329) (-885.382) -- 0:00:09
846000 -- (-890.010) [-883.928] (-885.189) (-885.026) * [-884.694] (-883.608) (-882.812) (-882.605) -- 0:00:09
846500 -- (-885.503) (-885.666) (-885.490) [-885.928] * (-885.755) (-884.327) (-891.186) [-884.633] -- 0:00:09
847000 -- [-883.073] (-882.678) (-886.439) (-885.357) * (-882.367) [-885.729] (-889.614) (-883.381) -- 0:00:09
847500 -- (-886.630) (-882.321) (-885.789) [-883.508] * (-884.736) [-889.159] (-887.894) (-885.260) -- 0:00:09
848000 -- (-888.355) [-882.356] (-887.370) (-886.429) * (-886.060) (-885.726) [-883.623] (-882.604) -- 0:00:09
848500 -- (-885.306) [-888.474] (-884.965) (-885.964) * (-885.622) [-884.721] (-889.262) (-888.465) -- 0:00:09
849000 -- (-884.228) (-883.626) (-884.387) [-885.740] * [-883.696] (-884.951) (-885.712) (-884.926) -- 0:00:09
849500 -- (-882.776) [-883.493] (-886.238) (-886.136) * (-884.371) (-883.985) (-889.063) [-884.070] -- 0:00:09
850000 -- [-882.776] (-883.376) (-885.656) (-889.498) * (-884.328) (-886.046) (-889.880) [-883.796] -- 0:00:09
Average standard deviation of split frequencies: 0.007135
850500 -- (-882.605) (-883.030) (-885.075) [-884.500] * (-883.984) (-885.348) [-886.545] (-883.969) -- 0:00:09
851000 -- (-886.552) (-885.165) [-882.767] (-884.625) * (-886.109) (-887.179) (-882.695) [-886.880] -- 0:00:09
851500 -- (-886.414) (-883.319) [-884.517] (-884.935) * (-882.880) (-887.131) (-884.620) [-888.482] -- 0:00:09
852000 -- [-884.807] (-885.609) (-885.128) (-884.559) * (-883.404) (-884.344) (-884.659) [-884.083] -- 0:00:09
852500 -- (-883.577) (-886.350) [-884.435] (-883.937) * (-884.384) [-888.305] (-883.569) (-883.607) -- 0:00:08
853000 -- (-883.864) (-885.299) (-887.061) [-884.943] * (-885.701) (-885.856) [-883.001] (-883.596) -- 0:00:08
853500 -- (-885.484) (-885.087) (-883.793) [-887.301] * (-883.129) [-887.632] (-882.451) (-884.755) -- 0:00:08
854000 -- (-887.652) [-883.831] (-885.926) (-884.852) * (-885.608) (-886.993) (-883.806) [-885.960] -- 0:00:08
854500 -- (-885.878) [-884.455] (-883.302) (-889.031) * (-889.620) (-885.148) (-883.551) [-885.847] -- 0:00:08
855000 -- (-884.391) [-882.427] (-887.083) (-884.714) * (-886.051) (-886.481) (-884.041) [-885.249] -- 0:00:08
Average standard deviation of split frequencies: 0.007090
855500 -- (-883.531) (-891.394) [-886.062] (-888.138) * (-883.857) [-890.514] (-882.948) (-884.243) -- 0:00:08
856000 -- [-886.044] (-886.353) (-887.855) (-883.539) * (-884.684) (-883.710) [-883.933] (-891.623) -- 0:00:08
856500 -- (-888.225) (-886.269) (-883.359) [-882.970] * (-883.378) (-888.218) (-882.948) [-884.574] -- 0:00:08
857000 -- (-886.104) (-884.278) (-887.303) [-885.177] * (-882.819) (-884.449) [-883.084] (-883.076) -- 0:00:08
857500 -- [-884.908] (-886.646) (-885.382) (-885.173) * [-886.383] (-884.485) (-885.141) (-885.374) -- 0:00:08
858000 -- (-885.057) [-885.945] (-884.286) (-885.604) * (-886.433) (-886.391) [-882.556] (-883.967) -- 0:00:08
858500 -- (-884.515) (-886.644) [-883.129] (-885.393) * (-885.038) (-886.360) (-884.485) [-886.012] -- 0:00:08
859000 -- (-884.695) [-888.935] (-883.656) (-886.223) * [-883.958] (-883.323) (-887.463) (-888.012) -- 0:00:08
859500 -- (-885.250) (-894.224) (-885.508) [-886.629] * (-883.657) (-883.687) (-885.463) [-887.795] -- 0:00:08
860000 -- (-886.409) (-895.255) [-884.063] (-888.994) * [-884.739] (-883.521) (-883.898) (-884.568) -- 0:00:08
Average standard deviation of split frequencies: 0.006901
860500 -- (-887.627) (-888.250) (-885.480) [-884.564] * (-884.427) [-884.871] (-884.957) (-886.032) -- 0:00:08
861000 -- [-885.745] (-888.183) (-884.083) (-886.028) * (-889.791) [-886.517] (-884.429) (-885.749) -- 0:00:08
861500 -- (-894.034) (-884.249) (-888.486) [-885.306] * (-885.439) (-883.644) (-883.243) [-883.790] -- 0:00:08
862000 -- (-887.766) [-883.977] (-883.869) (-883.176) * (-882.532) (-884.702) (-884.375) [-886.396] -- 0:00:08
862500 -- (-885.889) (-889.704) [-885.267] (-886.454) * (-887.286) (-884.060) [-883.329] (-884.039) -- 0:00:08
863000 -- (-883.205) (-883.235) (-884.442) [-885.768] * (-886.040) [-886.023] (-886.002) (-883.671) -- 0:00:08
863500 -- [-884.773] (-884.024) (-884.701) (-884.772) * [-883.432] (-884.244) (-885.287) (-883.494) -- 0:00:08
864000 -- (-886.613) (-890.109) (-888.591) [-887.897] * (-884.988) [-885.283] (-887.803) (-883.511) -- 0:00:08
864500 -- (-884.718) [-886.017] (-888.581) (-886.715) * (-884.318) [-883.356] (-886.375) (-883.795) -- 0:00:08
865000 -- (-886.014) (-884.927) [-884.749] (-884.294) * (-882.730) (-885.523) (-883.410) [-883.460] -- 0:00:08
Average standard deviation of split frequencies: 0.006931
865500 -- (-884.813) (-884.053) (-885.515) [-883.685] * (-883.673) [-886.277] (-886.775) (-886.955) -- 0:00:08
866000 -- (-883.936) (-884.849) [-884.577] (-884.441) * (-884.111) [-884.938] (-887.544) (-883.598) -- 0:00:08
866500 -- (-883.680) [-889.467] (-888.918) (-887.763) * [-884.509] (-885.835) (-883.599) (-884.293) -- 0:00:08
867000 -- (-885.506) (-891.033) (-887.289) [-882.871] * [-883.545] (-884.288) (-883.314) (-888.566) -- 0:00:08
867500 -- (-884.717) (-885.936) (-886.845) [-884.572] * [-882.390] (-883.622) (-886.523) (-884.481) -- 0:00:08
868000 -- [-886.404] (-887.901) (-884.152) (-887.248) * [-882.421] (-884.399) (-889.511) (-884.533) -- 0:00:08
868500 -- (-886.401) [-884.707] (-883.403) (-883.607) * (-883.170) [-883.233] (-889.316) (-882.745) -- 0:00:08
869000 -- (-885.862) [-884.484] (-885.243) (-883.091) * (-886.520) [-885.386] (-882.517) (-885.123) -- 0:00:07
869500 -- (-882.757) (-885.831) (-884.748) [-883.991] * [-884.792] (-884.782) (-885.394) (-883.668) -- 0:00:07
870000 -- (-884.578) (-885.900) [-883.094] (-884.475) * (-886.506) (-887.533) (-884.281) [-882.744] -- 0:00:07
Average standard deviation of split frequencies: 0.007111
870500 -- (-885.511) [-884.581] (-887.014) (-883.826) * (-885.636) (-883.619) (-884.790) [-882.900] -- 0:00:07
871000 -- (-883.021) [-885.345] (-884.047) (-882.934) * [-883.655] (-884.896) (-884.254) (-884.711) -- 0:00:07
871500 -- (-887.859) [-885.285] (-883.761) (-886.964) * (-883.550) (-886.020) [-883.852] (-885.171) -- 0:00:07
872000 -- (-887.443) (-886.078) (-884.999) [-882.943] * (-887.315) (-884.854) [-885.445] (-886.415) -- 0:00:07
872500 -- (-883.179) (-884.388) [-885.035] (-885.761) * (-883.208) (-884.975) [-883.431] (-882.972) -- 0:00:07
873000 -- (-888.114) (-884.932) [-883.790] (-885.412) * [-883.968] (-886.161) (-883.769) (-886.950) -- 0:00:07
873500 -- [-885.999] (-883.224) (-884.294) (-888.063) * (-883.584) (-886.779) (-886.110) [-884.437] -- 0:00:07
874000 -- (-889.178) [-883.665] (-883.123) (-887.820) * (-886.564) (-883.857) (-887.956) [-883.757] -- 0:00:07
874500 -- (-883.021) (-887.131) (-884.500) [-885.508] * (-885.894) (-888.011) (-888.378) [-883.909] -- 0:00:07
875000 -- (-883.007) [-885.473] (-883.598) (-884.123) * (-883.843) (-885.076) [-886.946] (-883.877) -- 0:00:07
Average standard deviation of split frequencies: 0.007498
875500 -- [-884.341] (-884.580) (-883.421) (-884.036) * (-887.475) (-883.270) [-885.810] (-887.240) -- 0:00:07
876000 -- [-888.253] (-884.982) (-885.127) (-884.118) * [-883.304] (-883.290) (-885.225) (-887.780) -- 0:00:07
876500 -- (-889.585) (-886.216) (-890.015) [-883.004] * [-883.532] (-883.837) (-883.056) (-888.358) -- 0:00:07
877000 -- (-891.474) [-885.317] (-886.621) (-884.090) * [-883.741] (-883.745) (-882.859) (-885.747) -- 0:00:07
877500 -- (-887.981) (-883.130) [-883.189] (-883.591) * [-883.882] (-886.503) (-882.517) (-883.812) -- 0:00:07
878000 -- (-883.792) [-884.137] (-884.660) (-883.256) * (-884.386) (-884.065) [-882.532] (-883.645) -- 0:00:07
878500 -- (-883.964) (-884.175) (-884.461) [-887.989] * (-886.647) (-883.702) [-882.787] (-884.119) -- 0:00:07
879000 -- (-886.637) [-884.788] (-886.904) (-888.244) * (-884.666) (-885.304) [-884.480] (-884.286) -- 0:00:07
879500 -- [-886.435] (-883.007) (-884.443) (-886.583) * (-884.549) (-884.248) (-883.568) [-884.968] -- 0:00:07
880000 -- (-885.732) [-883.823] (-884.676) (-886.831) * (-886.733) [-885.200] (-882.550) (-883.603) -- 0:00:07
Average standard deviation of split frequencies: 0.007494
880500 -- (-884.470) [-883.549] (-885.439) (-882.819) * (-886.302) (-887.249) (-883.059) [-883.382] -- 0:00:07
881000 -- (-885.108) (-884.920) (-884.375) [-884.355] * [-882.828] (-884.099) (-882.723) (-883.470) -- 0:00:07
881500 -- (-885.066) [-884.449] (-887.486) (-883.221) * (-885.234) (-886.210) (-882.957) [-883.640] -- 0:00:07
882000 -- (-892.357) (-885.701) (-882.631) [-884.472] * (-885.009) (-883.673) [-886.867] (-884.680) -- 0:00:07
882500 -- [-886.906] (-884.732) (-883.499) (-889.582) * (-885.483) [-882.953] (-882.377) (-888.961) -- 0:00:07
883000 -- [-883.599] (-885.619) (-883.351) (-883.388) * (-884.934) [-883.610] (-883.157) (-884.072) -- 0:00:07
883500 -- (-884.275) (-885.097) [-884.998] (-884.458) * (-885.378) (-882.559) [-882.553] (-884.567) -- 0:00:07
884000 -- (-885.855) [-886.061] (-886.826) (-882.556) * (-885.214) [-883.791] (-883.654) (-884.566) -- 0:00:07
884500 -- [-884.662] (-885.017) (-889.331) (-884.270) * (-886.792) (-883.544) [-882.759] (-884.522) -- 0:00:07
885000 -- (-884.563) (-883.616) [-884.024] (-885.046) * (-883.822) (-883.413) [-885.164] (-885.011) -- 0:00:07
Average standard deviation of split frequencies: 0.007484
885500 -- (-885.134) (-886.859) [-885.905] (-886.194) * (-884.638) [-886.657] (-884.118) (-883.495) -- 0:00:06
886000 -- [-883.385] (-883.038) (-883.214) (-885.396) * (-882.841) (-883.864) (-885.146) [-885.224] -- 0:00:06
886500 -- [-885.012] (-883.172) (-886.309) (-884.658) * (-887.210) (-888.762) [-885.038] (-885.113) -- 0:00:06
887000 -- (-888.092) [-884.295] (-883.911) (-884.518) * [-884.432] (-884.780) (-883.535) (-883.738) -- 0:00:06
887500 -- (-884.413) (-884.570) (-884.473) [-887.315] * [-885.694] (-884.420) (-885.434) (-886.229) -- 0:00:06
888000 -- (-889.075) [-884.248] (-883.210) (-886.656) * (-885.447) (-883.154) (-884.554) [-884.162] -- 0:00:06
888500 -- [-883.060] (-884.821) (-883.572) (-886.872) * (-884.060) (-888.599) (-884.658) [-885.587] -- 0:00:06
889000 -- [-882.473] (-884.842) (-883.512) (-884.425) * [-886.543] (-884.134) (-887.638) (-885.568) -- 0:00:06
889500 -- (-882.974) [-885.169] (-883.916) (-884.568) * (-882.431) [-892.277] (-886.726) (-889.965) -- 0:00:06
890000 -- (-886.294) (-885.108) [-882.922] (-883.944) * [-885.269] (-884.219) (-885.092) (-888.063) -- 0:00:06
Average standard deviation of split frequencies: 0.007163
890500 -- (-882.959) [-885.427] (-884.121) (-883.355) * (-884.121) [-883.746] (-883.725) (-889.032) -- 0:00:06
891000 -- (-883.275) [-886.524] (-886.474) (-884.097) * (-883.895) (-887.915) [-884.744] (-885.894) -- 0:00:06
891500 -- (-883.628) (-885.216) (-882.592) [-884.745] * (-883.728) (-886.767) [-884.417] (-887.326) -- 0:00:06
892000 -- (-886.725) (-885.637) [-883.301] (-885.431) * (-884.978) [-885.269] (-882.714) (-885.007) -- 0:00:06
892500 -- [-886.996] (-886.597) (-884.615) (-884.445) * (-886.237) (-886.617) (-883.044) [-885.642] -- 0:00:06
893000 -- (-883.547) [-887.788] (-889.159) (-885.168) * (-886.935) (-883.412) (-884.426) [-887.195] -- 0:00:06
893500 -- (-883.728) [-883.130] (-887.232) (-885.439) * [-884.892] (-889.453) (-886.524) (-886.641) -- 0:00:06
894000 -- [-885.378] (-883.334) (-885.702) (-887.621) * (-884.395) [-885.310] (-885.253) (-883.906) -- 0:00:06
894500 -- (-884.264) (-884.307) [-883.497] (-885.012) * (-887.852) (-884.541) [-885.168] (-885.593) -- 0:00:06
895000 -- [-886.173] (-885.050) (-886.305) (-884.706) * (-883.428) [-885.724] (-883.838) (-886.583) -- 0:00:06
Average standard deviation of split frequencies: 0.007681
895500 -- (-887.941) (-885.678) (-884.780) [-884.700] * [-883.572] (-884.229) (-882.411) (-884.993) -- 0:00:06
896000 -- (-884.510) (-883.418) [-883.909] (-884.271) * (-883.818) (-883.760) [-884.229] (-883.722) -- 0:00:06
896500 -- (-884.876) [-884.766] (-883.108) (-884.771) * (-884.312) (-884.262) [-885.260] (-884.075) -- 0:00:06
897000 -- (-885.517) (-885.510) [-885.319] (-885.741) * [-884.836] (-885.236) (-885.044) (-883.877) -- 0:00:06
897500 -- (-885.513) (-883.823) [-883.947] (-884.429) * [-887.532] (-882.850) (-887.227) (-885.483) -- 0:00:06
898000 -- (-886.551) (-885.856) [-883.953] (-886.076) * (-884.726) (-884.129) [-883.646] (-883.355) -- 0:00:06
898500 -- (-886.351) (-884.801) (-884.936) [-886.348] * (-887.753) (-886.204) [-883.275] (-883.094) -- 0:00:06
899000 -- [-883.100] (-884.491) (-888.224) (-883.099) * (-886.526) (-886.698) [-883.643] (-884.157) -- 0:00:06
899500 -- (-883.036) (-886.672) [-892.081] (-883.876) * (-883.478) (-885.262) [-883.608] (-883.510) -- 0:00:06
900000 -- (-886.339) (-887.061) (-885.143) [-884.239] * (-883.281) (-883.300) (-882.837) [-883.247] -- 0:00:06
Average standard deviation of split frequencies: 0.007990
900500 -- (-884.911) (-884.771) [-884.782] (-883.858) * (-883.034) [-882.933] (-885.779) (-882.648) -- 0:00:06
901000 -- [-884.557] (-882.479) (-886.204) (-885.490) * (-883.285) (-885.893) [-887.290] (-885.218) -- 0:00:06
901500 -- (-884.368) [-884.326] (-885.008) (-884.841) * (-882.929) (-884.758) [-883.623] (-883.859) -- 0:00:06
902000 -- [-891.603] (-882.923) (-885.130) (-890.249) * (-883.476) (-883.797) (-885.319) [-885.655] -- 0:00:05
902500 -- (-883.040) (-883.730) [-886.230] (-885.503) * (-883.763) (-884.445) (-886.352) [-885.655] -- 0:00:05
903000 -- (-884.473) (-884.481) (-889.748) [-883.271] * [-883.669] (-882.697) (-882.658) (-885.604) -- 0:00:05
903500 -- [-886.415] (-886.198) (-883.849) (-883.156) * (-883.652) (-883.496) (-883.232) [-884.092] -- 0:00:05
904000 -- (-885.413) (-884.269) [-889.250] (-882.594) * (-884.418) (-886.821) [-883.240] (-886.752) -- 0:00:05
904500 -- (-886.685) (-884.177) [-885.228] (-882.736) * [-884.184] (-886.624) (-883.521) (-884.392) -- 0:00:05
905000 -- (-885.149) [-883.211] (-888.071) (-884.279) * (-883.754) (-883.240) [-885.056] (-883.518) -- 0:00:05
Average standard deviation of split frequencies: 0.008082
905500 -- (-885.749) [-883.909] (-884.439) (-883.999) * [-882.724] (-887.186) (-885.554) (-885.824) -- 0:00:05
906000 -- (-883.397) (-884.487) [-883.732] (-883.787) * [-883.657] (-885.721) (-887.733) (-884.730) -- 0:00:05
906500 -- (-888.132) (-883.562) [-883.791] (-885.278) * [-884.139] (-884.051) (-886.312) (-883.547) -- 0:00:05
907000 -- (-884.705) (-883.033) [-884.523] (-883.545) * (-883.938) [-883.971] (-883.723) (-885.798) -- 0:00:05
907500 -- (-884.380) (-888.529) (-882.701) [-882.775] * [-885.397] (-883.154) (-886.808) (-893.195) -- 0:00:05
908000 -- (-885.594) (-882.811) (-888.013) [-884.555] * [-884.702] (-884.497) (-884.332) (-884.213) -- 0:00:05
908500 -- (-884.444) [-883.701] (-886.100) (-883.165) * [-887.047] (-886.439) (-885.323) (-884.097) -- 0:00:05
909000 -- (-883.068) (-888.229) (-886.026) [-882.750] * (-884.496) [-888.446] (-885.199) (-884.336) -- 0:00:05
909500 -- [-883.973] (-886.477) (-883.587) (-883.621) * (-883.795) (-883.213) [-885.587] (-885.457) -- 0:00:05
910000 -- (-882.847) [-882.936] (-882.700) (-886.263) * (-886.291) [-884.985] (-884.414) (-884.356) -- 0:00:05
Average standard deviation of split frequencies: 0.007903
910500 -- (-885.414) (-884.909) (-885.406) [-886.191] * (-882.728) [-886.929] (-883.761) (-883.443) -- 0:00:05
911000 -- (-888.504) (-889.169) (-884.109) [-885.487] * (-882.974) (-886.283) [-884.594] (-883.421) -- 0:00:05
911500 -- (-885.644) [-886.028] (-887.447) (-883.798) * (-883.393) (-883.873) (-885.604) [-883.382] -- 0:00:05
912000 -- (-883.755) [-884.458] (-888.087) (-883.387) * (-885.451) [-882.942] (-884.903) (-882.787) -- 0:00:05
912500 -- (-883.916) [-885.647] (-886.954) (-884.631) * (-883.874) (-884.878) [-884.793] (-885.968) -- 0:00:05
913000 -- (-885.274) [-884.444] (-883.613) (-884.029) * (-883.305) [-883.936] (-888.119) (-885.082) -- 0:00:05
913500 -- (-887.381) (-888.502) [-884.402] (-886.301) * (-884.262) (-883.743) [-887.456] (-886.172) -- 0:00:05
914000 -- (-883.958) [-886.255] (-884.377) (-886.944) * (-884.022) (-892.730) (-886.513) [-884.564] -- 0:00:05
914500 -- (-882.788) (-883.651) (-883.184) [-886.454] * (-883.703) (-883.943) (-884.387) [-883.171] -- 0:00:05
915000 -- (-884.131) [-883.870] (-883.856) (-885.789) * (-883.599) (-882.700) [-885.992] (-882.799) -- 0:00:05
Average standard deviation of split frequencies: 0.008166
915500 -- (-884.474) (-883.744) (-884.099) [-885.681] * [-886.743] (-884.506) (-886.222) (-882.452) -- 0:00:05
916000 -- (-886.622) [-888.468] (-887.411) (-887.917) * (-882.714) (-887.550) [-883.582] (-885.371) -- 0:00:05
916500 -- (-886.345) (-883.741) [-883.667] (-885.601) * (-884.112) (-884.628) (-883.850) [-882.933] -- 0:00:05
917000 -- (-887.515) (-885.888) [-883.605] (-885.688) * (-884.141) (-890.880) [-886.442] (-890.255) -- 0:00:05
917500 -- (-885.979) [-887.071] (-882.646) (-883.171) * (-883.739) [-883.134] (-883.281) (-886.433) -- 0:00:05
918000 -- (-887.908) (-884.845) [-883.714] (-885.304) * (-885.515) [-883.506] (-885.227) (-886.892) -- 0:00:05
918500 -- (-884.368) [-885.557] (-883.686) (-888.845) * (-883.919) [-884.285] (-884.533) (-887.065) -- 0:00:04
919000 -- (-883.524) (-889.342) [-885.941] (-886.163) * [-886.166] (-883.400) (-884.773) (-887.005) -- 0:00:04
919500 -- (-883.630) [-886.404] (-883.629) (-884.705) * (-883.739) [-882.480] (-883.462) (-886.121) -- 0:00:04
920000 -- (-883.918) (-885.532) (-885.652) [-886.036] * [-884.018] (-882.508) (-886.151) (-892.883) -- 0:00:04
Average standard deviation of split frequencies: 0.007783
920500 -- [-882.556] (-886.703) (-886.526) (-891.570) * (-882.784) [-882.509] (-887.178) (-885.423) -- 0:00:04
921000 -- [-884.611] (-885.000) (-890.233) (-887.505) * (-882.784) [-883.087] (-888.847) (-885.989) -- 0:00:04
921500 -- (-884.367) [-883.412] (-885.495) (-886.950) * (-888.430) (-883.769) [-884.234] (-886.786) -- 0:00:04
922000 -- (-883.518) [-883.661] (-886.050) (-884.384) * [-883.044] (-884.002) (-885.924) (-883.801) -- 0:00:04
922500 -- (-887.247) [-886.684] (-884.152) (-889.142) * [-886.149] (-885.791) (-885.933) (-884.837) -- 0:00:04
923000 -- (-883.865) [-885.420] (-883.523) (-888.973) * (-885.656) [-886.049] (-883.817) (-882.644) -- 0:00:04
923500 -- [-883.212] (-884.200) (-884.030) (-884.500) * [-882.541] (-885.044) (-883.298) (-883.482) -- 0:00:04
924000 -- (-883.737) (-884.215) [-883.222] (-887.233) * (-884.624) [-883.082] (-885.169) (-886.612) -- 0:00:04
924500 -- (-885.035) [-883.871] (-885.570) (-884.384) * (-884.269) [-887.741] (-890.955) (-883.249) -- 0:00:04
925000 -- (-883.520) [-884.482] (-883.131) (-884.985) * (-886.586) (-885.956) [-886.245] (-884.402) -- 0:00:04
Average standard deviation of split frequencies: 0.007568
925500 -- (-885.588) (-885.771) (-885.347) [-883.723] * [-883.487] (-883.883) (-890.163) (-886.105) -- 0:00:04
926000 -- (-888.339) (-886.780) [-888.430] (-883.268) * (-882.681) (-883.516) [-884.310] (-885.360) -- 0:00:04
926500 -- [-885.850] (-883.344) (-885.448) (-882.498) * [-883.173] (-884.187) (-883.275) (-885.331) -- 0:00:04
927000 -- [-885.508] (-884.196) (-884.120) (-882.696) * [-885.577] (-885.596) (-888.199) (-883.993) -- 0:00:04
927500 -- (-883.600) (-883.419) (-884.884) [-885.558] * [-883.889] (-887.043) (-884.224) (-884.682) -- 0:00:04
928000 -- [-884.486] (-884.657) (-885.770) (-887.049) * (-883.542) (-887.001) [-888.948] (-883.669) -- 0:00:04
928500 -- (-885.028) (-883.055) [-885.380] (-883.908) * [-885.083] (-884.066) (-884.377) (-889.061) -- 0:00:04
929000 -- (-884.978) (-882.483) (-887.594) [-884.186] * (-884.346) (-885.426) [-884.549] (-883.225) -- 0:00:04
929500 -- [-886.563] (-884.995) (-889.086) (-885.485) * (-883.450) (-884.312) [-885.130] (-883.338) -- 0:00:04
930000 -- (-883.491) (-883.441) [-883.141] (-886.308) * (-885.839) (-884.192) (-885.763) [-885.854] -- 0:00:04
Average standard deviation of split frequencies: 0.007429
930500 -- (-885.035) (-882.373) (-883.243) [-888.827] * (-885.406) (-884.536) [-883.953] (-884.317) -- 0:00:04
931000 -- [-883.950] (-885.477) (-885.633) (-888.810) * (-885.248) [-884.578] (-884.962) (-885.250) -- 0:00:04
931500 -- (-886.559) (-885.191) (-888.161) [-889.623] * (-884.538) (-884.602) (-884.769) [-883.232] -- 0:00:04
932000 -- [-883.644] (-886.586) (-886.411) (-889.583) * (-884.790) [-884.520] (-889.340) (-882.552) -- 0:00:04
932500 -- (-883.387) (-884.704) [-887.705] (-887.413) * (-884.331) (-883.445) [-884.869] (-885.465) -- 0:00:04
933000 -- (-889.671) [-885.952] (-884.686) (-882.443) * [-884.191] (-883.925) (-884.491) (-885.902) -- 0:00:04
933500 -- (-885.612) [-884.638] (-882.737) (-883.625) * (-883.391) [-883.959] (-883.844) (-885.474) -- 0:00:04
934000 -- (-885.434) (-888.966) (-882.856) [-883.648] * (-883.221) [-886.463] (-882.401) (-883.682) -- 0:00:04
934500 -- (-883.695) [-886.364] (-882.840) (-885.657) * (-884.185) (-886.107) [-886.274] (-884.402) -- 0:00:03
935000 -- (-884.799) (-883.592) [-887.125] (-887.200) * (-890.708) [-883.553] (-885.233) (-884.429) -- 0:00:03
Average standard deviation of split frequencies: 0.007387
935500 -- (-885.095) [-884.415] (-887.592) (-883.867) * [-882.936] (-885.250) (-885.235) (-884.133) -- 0:00:03
936000 -- (-885.363) (-885.985) (-884.158) [-884.420] * (-882.660) [-882.754] (-883.723) (-887.496) -- 0:00:03
936500 -- (-884.032) (-886.161) [-883.259] (-883.211) * (-883.461) (-884.146) (-885.402) [-882.850] -- 0:00:03
937000 -- (-885.410) [-884.447] (-883.793) (-885.780) * [-883.598] (-885.084) (-884.195) (-884.133) -- 0:00:03
937500 -- (-883.796) [-884.528] (-884.798) (-883.408) * [-882.605] (-882.792) (-884.124) (-886.769) -- 0:00:03
938000 -- (-883.573) (-884.571) (-885.470) [-882.843] * [-882.613] (-883.123) (-885.108) (-883.948) -- 0:00:03
938500 -- (-885.366) (-885.011) [-884.851] (-883.169) * (-884.192) (-887.051) [-884.032] (-886.758) -- 0:00:03
939000 -- (-885.568) (-887.094) [-883.420] (-882.611) * (-884.298) (-883.417) (-887.937) [-885.995] -- 0:00:03
939500 -- (-883.868) [-884.175] (-883.105) (-883.532) * (-884.133) [-888.918] (-885.576) (-884.780) -- 0:00:03
940000 -- [-885.444] (-883.319) (-883.613) (-884.827) * (-887.376) (-883.378) [-886.541] (-885.113) -- 0:00:03
Average standard deviation of split frequencies: 0.007784
940500 -- (-886.687) [-882.774] (-883.962) (-886.558) * (-883.466) (-883.737) [-883.116] (-891.869) -- 0:00:03
941000 -- (-886.853) (-884.050) (-891.980) [-883.701] * [-883.465] (-892.650) (-883.717) (-890.080) -- 0:00:03
941500 -- (-884.835) (-883.029) [-887.274] (-883.291) * (-883.725) (-884.914) (-883.802) [-884.042] -- 0:00:03
942000 -- [-885.711] (-888.812) (-887.640) (-885.385) * (-887.438) [-883.545] (-883.407) (-887.495) -- 0:00:03
942500 -- (-886.023) (-882.848) (-882.312) [-882.813] * [-883.294] (-887.068) (-882.589) (-887.077) -- 0:00:03
943000 -- (-885.300) [-884.265] (-882.492) (-884.203) * (-883.937) (-889.137) [-885.714] (-886.718) -- 0:00:03
943500 -- (-885.883) (-885.776) (-882.507) [-885.553] * [-883.586] (-887.646) (-884.669) (-882.189) -- 0:00:03
944000 -- [-883.219] (-883.218) (-882.334) (-884.585) * (-883.054) (-887.698) [-884.887] (-882.307) -- 0:00:03
944500 -- (-887.699) (-882.880) (-882.732) [-884.964] * (-886.428) [-883.922] (-885.180) (-884.034) -- 0:00:03
945000 -- [-884.323] (-883.489) (-882.892) (-885.803) * (-889.879) (-890.449) [-883.093] (-885.498) -- 0:00:03
Average standard deviation of split frequencies: 0.008505
945500 -- (-891.930) [-884.398] (-884.879) (-882.964) * [-883.818] (-885.514) (-884.411) (-883.200) -- 0:00:03
946000 -- (-888.836) [-886.032] (-888.478) (-885.134) * (-884.159) (-883.098) [-885.605] (-884.454) -- 0:00:03
946500 -- [-884.836] (-887.166) (-884.020) (-884.727) * (-882.831) (-886.508) (-884.420) [-883.472] -- 0:00:03
947000 -- (-889.928) (-885.059) (-884.383) [-883.596] * [-883.503] (-884.842) (-883.249) (-883.368) -- 0:00:03
947500 -- (-890.733) (-885.558) (-887.261) [-884.699] * (-883.668) [-884.211] (-883.374) (-886.463) -- 0:00:03
948000 -- (-893.927) (-886.402) [-883.901] (-884.529) * (-884.794) (-884.016) (-883.957) [-888.003] -- 0:00:03
948500 -- [-884.443] (-883.930) (-884.544) (-884.432) * (-885.325) (-884.396) [-883.961] (-884.627) -- 0:00:03
949000 -- (-885.362) (-883.396) [-883.219] (-884.439) * (-886.781) [-886.577] (-884.803) (-883.818) -- 0:00:03
949500 -- (-887.952) (-888.097) [-884.953] (-885.198) * (-883.648) (-884.808) (-882.898) [-883.232] -- 0:00:03
950000 -- (-887.143) [-887.277] (-884.404) (-887.129) * (-883.355) (-886.028) (-882.603) [-883.851] -- 0:00:03
Average standard deviation of split frequencies: 0.008198
950500 -- (-884.995) [-886.648] (-888.936) (-883.913) * (-883.004) [-883.933] (-885.886) (-885.562) -- 0:00:03
951000 -- [-885.545] (-887.645) (-885.684) (-884.329) * (-884.731) (-885.860) (-885.713) [-885.364] -- 0:00:02
951500 -- [-883.629] (-887.727) (-886.903) (-884.743) * (-887.621) (-887.137) (-884.483) [-883.532] -- 0:00:02
952000 -- [-884.689] (-885.251) (-887.617) (-886.755) * (-882.457) [-885.569] (-884.373) (-884.101) -- 0:00:02
952500 -- (-884.474) (-884.704) [-884.632] (-884.276) * (-885.987) [-884.775] (-886.649) (-883.864) -- 0:00:02
953000 -- (-885.084) (-883.391) [-884.359] (-885.953) * (-884.686) (-886.002) (-884.780) [-884.247] -- 0:00:02
953500 -- (-883.348) (-883.588) (-884.517) [-883.167] * (-886.223) (-887.013) (-892.295) [-885.044] -- 0:00:02
954000 -- (-882.777) (-883.841) [-883.445] (-885.985) * [-886.731] (-883.337) (-884.202) (-885.830) -- 0:00:02
954500 -- (-884.654) (-886.914) [-882.679] (-884.337) * [-883.961] (-882.688) (-884.818) (-886.563) -- 0:00:02
955000 -- (-883.838) [-884.931] (-884.471) (-885.815) * (-884.386) (-882.953) [-883.147] (-884.279) -- 0:00:02
Average standard deviation of split frequencies: 0.007791
955500 -- (-891.162) (-884.535) [-885.500] (-886.250) * (-884.134) [-883.538] (-882.729) (-883.148) -- 0:00:02
956000 -- (-885.536) (-883.641) [-884.457] (-885.783) * [-882.809] (-884.218) (-883.074) (-884.198) -- 0:00:02
956500 -- (-884.327) (-884.832) (-883.652) [-884.602] * (-882.468) (-883.375) (-884.438) [-884.691] -- 0:00:02
957000 -- [-884.488] (-883.243) (-883.664) (-887.475) * (-886.712) (-883.423) [-884.168] (-884.242) -- 0:00:02
957500 -- (-887.204) (-884.523) [-889.083] (-889.528) * (-883.527) (-884.133) (-884.539) [-885.868] -- 0:00:02
958000 -- (-886.277) (-884.083) (-882.941) [-882.916] * [-883.368] (-883.104) (-884.249) (-883.501) -- 0:00:02
958500 -- (-882.982) (-884.215) (-883.125) [-886.069] * (-883.582) [-887.975] (-885.389) (-885.229) -- 0:00:02
959000 -- (-884.292) (-883.427) [-883.459] (-884.007) * (-883.127) (-889.812) (-886.170) [-888.888] -- 0:00:02
959500 -- (-884.157) [-887.432] (-883.081) (-885.445) * (-885.835) (-885.059) [-886.035] (-884.484) -- 0:00:02
960000 -- [-883.729] (-888.117) (-882.988) (-885.313) * (-883.595) (-884.593) [-883.507] (-886.437) -- 0:00:02
Average standard deviation of split frequencies: 0.007753
960500 -- (-887.688) (-885.489) (-883.791) [-883.658] * (-886.414) [-884.593] (-884.208) (-887.447) -- 0:00:02
961000 -- (-884.932) (-885.496) [-883.791] (-883.671) * [-886.182] (-887.388) (-883.761) (-887.393) -- 0:00:02
961500 -- (-888.930) [-884.673] (-884.702) (-884.604) * (-884.893) (-887.507) (-884.285) [-885.238] -- 0:00:02
962000 -- [-886.092] (-884.655) (-883.317) (-885.268) * (-886.348) (-885.509) (-884.406) [-884.137] -- 0:00:02
962500 -- [-885.279] (-886.835) (-882.990) (-886.204) * [-885.582] (-883.852) (-883.798) (-883.616) -- 0:00:02
963000 -- (-883.846) (-886.317) (-885.015) [-883.629] * (-886.001) (-883.450) (-884.403) [-885.437] -- 0:00:02
963500 -- (-882.807) (-885.931) (-885.402) [-884.636] * (-883.948) [-886.871] (-886.909) (-884.196) -- 0:00:02
964000 -- (-884.368) [-887.242] (-882.619) (-883.113) * (-883.459) (-885.329) (-887.658) [-882.500] -- 0:00:02
964500 -- [-885.061] (-884.861) (-883.922) (-882.749) * (-885.138) (-886.032) [-883.796] (-885.170) -- 0:00:02
965000 -- (-884.999) (-883.638) (-884.015) [-883.938] * (-886.301) (-883.856) (-883.722) [-885.550] -- 0:00:02
Average standard deviation of split frequencies: 0.007840
965500 -- (-883.885) [-887.829] (-885.074) (-884.400) * [-884.192] (-888.589) (-883.814) (-884.698) -- 0:00:02
966000 -- (-884.927) [-885.601] (-883.980) (-884.302) * (-882.952) [-885.426] (-884.788) (-888.953) -- 0:00:02
966500 -- (-886.060) (-882.732) [-883.353] (-883.180) * [-883.636] (-883.838) (-887.823) (-885.709) -- 0:00:02
967000 -- (-884.063) (-882.436) (-883.109) [-884.616] * (-883.468) (-885.330) [-885.000] (-884.837) -- 0:00:02
967500 -- (-885.084) [-882.753] (-885.202) (-887.170) * (-882.957) (-883.289) [-887.112] (-882.621) -- 0:00:01
968000 -- (-883.892) (-886.296) (-884.225) [-885.096] * (-885.257) [-883.568] (-884.622) (-886.911) -- 0:00:01
968500 -- (-886.223) (-886.373) (-882.973) [-890.133] * [-882.850] (-886.465) (-885.674) (-888.639) -- 0:00:01
969000 -- (-885.386) (-884.459) (-883.122) [-883.008] * (-884.364) (-883.299) (-884.719) [-884.819] -- 0:00:01
969500 -- (-883.085) (-883.415) (-884.368) [-884.430] * [-883.283] (-883.054) (-884.539) (-888.971) -- 0:00:01
970000 -- (-883.842) (-883.480) (-887.347) [-883.571] * [-883.604] (-884.591) (-885.063) (-883.881) -- 0:00:01
Average standard deviation of split frequencies: 0.007965
970500 -- (-883.566) (-884.681) [-885.843] (-883.813) * [-883.807] (-884.113) (-883.635) (-883.962) -- 0:00:01
971000 -- [-886.571] (-883.295) (-883.250) (-885.677) * [-885.788] (-884.891) (-890.467) (-884.913) -- 0:00:01
971500 -- (-884.359) (-884.811) [-883.322] (-883.850) * (-884.019) (-885.637) [-883.857] (-892.573) -- 0:00:01
972000 -- (-884.603) [-883.034] (-884.573) (-890.913) * (-884.419) (-884.604) (-883.451) [-883.460] -- 0:00:01
972500 -- (-884.284) [-882.996] (-884.088) (-889.068) * (-883.650) [-884.475] (-888.401) (-884.548) -- 0:00:01
973000 -- (-882.852) (-884.435) (-885.943) [-885.025] * (-883.699) (-883.382) (-884.037) [-884.655] -- 0:00:01
973500 -- [-884.539] (-887.683) (-885.794) (-882.659) * [-885.240] (-885.409) (-884.438) (-883.912) -- 0:00:01
974000 -- (-884.269) (-883.538) (-884.865) [-883.877] * (-885.995) [-885.453] (-884.911) (-884.421) -- 0:00:01
974500 -- (-883.303) (-884.032) (-884.418) [-883.623] * (-883.832) (-885.215) (-889.004) [-884.639] -- 0:00:01
975000 -- (-887.217) (-884.729) [-884.909] (-885.153) * (-884.253) (-884.965) [-886.070] (-885.457) -- 0:00:01
Average standard deviation of split frequencies: 0.007825
975500 -- (-883.604) (-887.186) (-893.895) [-883.897] * (-888.840) [-884.322] (-884.196) (-885.206) -- 0:00:01
976000 -- (-884.601) (-882.875) [-885.032] (-885.348) * (-887.281) (-883.028) (-882.604) [-884.008] -- 0:00:01
976500 -- (-884.358) (-883.857) (-883.174) [-886.038] * (-886.804) (-886.648) [-883.399] (-884.749) -- 0:00:01
977000 -- (-884.506) [-884.188] (-883.509) (-883.746) * (-889.929) (-887.932) (-885.141) [-884.272] -- 0:00:01
977500 -- (-887.926) (-887.130) (-884.882) [-884.809] * (-886.385) (-889.258) (-886.132) [-883.680] -- 0:00:01
978000 -- (-886.616) (-883.953) [-885.494] (-885.234) * (-896.874) (-886.707) (-883.298) [-882.937] -- 0:00:01
978500 -- (-891.114) (-884.534) (-885.507) [-882.675] * (-884.128) (-884.073) (-884.698) [-885.987] -- 0:00:01
979000 -- (-882.805) (-885.283) [-886.159] (-884.681) * (-887.426) [-885.479] (-884.989) (-886.053) -- 0:00:01
979500 -- [-883.505] (-889.584) (-883.487) (-884.779) * (-884.469) (-885.099) (-884.724) [-885.162] -- 0:00:01
980000 -- (-884.097) (-883.343) (-883.101) [-886.532] * (-885.116) (-884.574) [-883.959] (-885.267) -- 0:00:01
Average standard deviation of split frequencies: 0.007915
980500 -- (-886.363) [-884.620] (-884.927) (-885.897) * [-889.863] (-885.695) (-884.919) (-883.764) -- 0:00:01
981000 -- (-885.612) (-885.830) [-884.387] (-884.149) * [-884.299] (-884.561) (-882.572) (-884.601) -- 0:00:01
981500 -- (-884.998) (-883.338) (-886.639) [-885.247] * [-884.615] (-886.452) (-883.586) (-887.534) -- 0:00:01
982000 -- [-883.228] (-883.596) (-885.174) (-882.891) * (-885.611) (-884.869) (-887.079) [-886.695] -- 0:00:01
982500 -- (-884.193) [-883.858] (-882.601) (-882.675) * [-882.829] (-884.012) (-885.429) (-889.526) -- 0:00:01
983000 -- [-887.702] (-884.785) (-882.730) (-883.132) * (-882.279) (-884.768) [-883.817] (-884.990) -- 0:00:01
983500 -- (-884.382) (-883.413) [-883.013] (-882.615) * (-885.389) (-888.695) [-888.530] (-884.162) -- 0:00:01
984000 -- [-883.382] (-883.311) (-884.186) (-883.195) * (-885.134) (-889.295) (-883.097) [-883.689] -- 0:00:00
984500 -- [-882.936] (-886.280) (-885.634) (-886.472) * (-885.276) (-884.058) [-883.223] (-885.039) -- 0:00:00
985000 -- (-883.509) [-885.020] (-885.808) (-887.242) * [-887.518] (-887.734) (-882.454) (-889.308) -- 0:00:00
Average standard deviation of split frequencies: 0.008255
985500 -- (-885.170) [-888.223] (-884.531) (-884.379) * (-884.452) (-889.135) [-886.669] (-883.655) -- 0:00:00
986000 -- (-884.257) (-890.240) [-884.177] (-883.509) * (-887.661) (-887.571) (-884.561) [-882.796] -- 0:00:00
986500 -- (-889.794) [-882.721] (-885.958) (-883.928) * (-886.998) [-884.704] (-884.958) (-883.099) -- 0:00:00
987000 -- (-886.255) (-888.617) [-884.677] (-884.514) * (-890.100) (-885.528) (-885.502) [-885.677] -- 0:00:00
987500 -- [-884.384] (-884.458) (-884.963) (-885.388) * [-885.359] (-889.305) (-885.346) (-886.608) -- 0:00:00
988000 -- (-884.431) (-887.343) (-884.754) [-885.458] * (-886.355) (-888.631) (-883.647) [-884.181] -- 0:00:00
988500 -- (-886.545) (-891.213) [-883.394] (-883.299) * (-886.046) (-890.891) (-890.496) [-883.599] -- 0:00:00
989000 -- (-884.169) (-887.879) [-883.906] (-884.225) * (-883.323) [-883.446] (-887.627) (-886.644) -- 0:00:00
989500 -- [-885.058] (-885.112) (-885.168) (-885.152) * (-884.073) [-882.765] (-883.548) (-884.167) -- 0:00:00
990000 -- (-883.892) (-883.321) (-883.439) [-883.776] * (-883.222) (-883.936) [-886.065] (-887.668) -- 0:00:00
Average standard deviation of split frequencies: 0.007931
990500 -- [-884.719] (-886.740) (-883.835) (-886.392) * [-890.725] (-887.489) (-883.545) (-883.539) -- 0:00:00
991000 -- (-884.186) (-883.691) (-884.592) [-883.202] * (-886.738) [-882.668] (-884.181) (-883.589) -- 0:00:00
991500 -- (-883.917) [-887.762] (-888.866) (-882.496) * [-884.733] (-883.410) (-887.625) (-887.216) -- 0:00:00
992000 -- (-884.579) (-884.318) [-885.197] (-883.931) * (-888.037) [-884.830] (-882.843) (-886.877) -- 0:00:00
992500 -- (-882.673) (-883.530) (-888.064) [-883.958] * (-888.240) (-882.638) (-883.229) [-885.196] -- 0:00:00
993000 -- (-885.304) (-887.355) [-886.072] (-882.724) * (-885.146) (-883.889) (-884.271) [-885.839] -- 0:00:00
993500 -- (-883.386) (-883.469) [-886.179] (-883.423) * (-884.461) [-882.955] (-884.780) (-889.361) -- 0:00:00
994000 -- (-883.412) (-885.315) (-885.044) [-885.881] * [-882.288] (-883.047) (-890.143) (-885.679) -- 0:00:00
994500 -- (-883.856) (-885.465) (-885.886) [-884.483] * [-885.066] (-883.343) (-884.659) (-885.680) -- 0:00:00
995000 -- (-883.273) [-885.334] (-882.722) (-883.711) * (-885.445) (-883.371) [-882.645] (-886.284) -- 0:00:00
Average standard deviation of split frequencies: 0.007857
995500 -- (-884.662) (-885.260) (-884.867) [-885.073] * (-882.890) (-885.848) [-882.332] (-884.172) -- 0:00:00
996000 -- (-883.270) (-885.092) (-887.300) [-882.871] * (-885.075) (-883.746) [-882.626] (-883.888) -- 0:00:00
996500 -- [-883.341] (-882.818) (-883.369) (-884.509) * (-883.416) [-886.357] (-883.373) (-883.870) -- 0:00:00
997000 -- [-883.097] (-882.439) (-884.463) (-883.605) * (-883.588) (-883.425) (-886.330) [-882.899] -- 0:00:00
997500 -- (-884.464) (-883.109) [-888.190] (-884.359) * [-882.925] (-887.951) (-883.918) (-883.638) -- 0:00:00
998000 -- (-887.032) [-883.130] (-883.297) (-885.032) * (-883.395) [-883.950] (-883.007) (-882.824) -- 0:00:00
998500 -- [-885.437] (-884.204) (-883.091) (-886.133) * (-883.601) (-887.769) [-882.425] (-884.924) -- 0:00:00
999000 -- (-884.507) (-884.179) (-882.970) [-883.702] * (-883.800) (-884.298) (-888.786) [-884.522] -- 0:00:00
999500 -- (-890.833) (-882.609) (-883.227) [-882.672] * [-885.367] (-885.749) (-885.124) (-885.950) -- 0:00:00
1000000 -- [-886.526] (-883.792) (-886.385) (-883.905) * (-885.090) (-888.114) [-886.389] (-888.683) -- 0:00:00
Average standard deviation of split frequencies: 0.007331
Analysis completed in 1 mins 1 seconds
Analysis used 59.61 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -882.22
Likelihood of best state for "cold" chain of run 2 was -882.22
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.7 % ( 20 %) Dirichlet(Pi{all})
30.5 % ( 20 %) Slider(Pi{all})
79.1 % ( 52 %) Multiplier(Alpha{1,2})
78.0 % ( 53 %) Multiplier(Alpha{3})
22.2 % ( 20 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 36 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 53 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.2 % ( 31 %) Dirichlet(Pi{all})
30.5 % ( 22 %) Slider(Pi{all})
78.9 % ( 61 %) Multiplier(Alpha{1,2})
78.2 % ( 52 %) Multiplier(Alpha{3})
20.7 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.6 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166583 0.82 0.66
3 | 166609 166298 0.84
4 | 166960 166707 166843
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166945 0.82 0.67
3 | 167517 166281 0.84
4 | 166059 166053 167145
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -884.02
| 2 2 |
| 1 1 |
| 1 2 * * 2 2|
|2 1 2 2 2 1 1 1 1 |
| 1 1 12212 2 1 112 2 2 2 |
|1 1 *1 1 12 12 22122 1 2 21 |
| 2 2 1 1 1 1 2 2 2 2 1 1|
| 22 2 122 1 1 2 2 1 1 1 * |
| 11 2 21 2 1 1 1 11 1 2 |
| 2 1 2 * 1 1 |
| 1 2 2 12 2 2 |
| 11 1 2 2 |
| 22 1 1 |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -885.64
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -883.98 -887.14
2 -883.95 -887.22
--------------------------------------
TOTAL -883.96 -887.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888945 0.087025 0.356496 1.464892 0.860317 1445.11 1455.77 1.000
r(A<->C){all} 0.164478 0.018648 0.000079 0.436268 0.128533 260.52 266.04 1.001
r(A<->G){all} 0.164810 0.021372 0.000001 0.464455 0.121613 143.05 198.47 1.000
r(A<->T){all} 0.179915 0.023207 0.000018 0.478323 0.138602 218.06 280.13 1.000
r(C<->G){all} 0.159010 0.019396 0.000003 0.445173 0.118329 274.61 331.25 1.003
r(C<->T){all} 0.160575 0.018806 0.000018 0.451679 0.122849 302.79 339.51 1.002
r(G<->T){all} 0.171212 0.020471 0.000030 0.455576 0.135109 219.50 220.93 1.004
pi(A){all} 0.245032 0.000288 0.211775 0.277298 0.244632 1152.71 1326.86 1.000
pi(C){all} 0.302260 0.000333 0.267852 0.339272 0.301641 1238.57 1277.35 1.003
pi(G){all} 0.257634 0.000300 0.225195 0.291175 0.257504 1054.39 1155.16 1.000
pi(T){all} 0.195075 0.000241 0.165000 0.225355 0.195202 1250.91 1352.48 1.001
alpha{1,2} 0.419986 0.225627 0.000116 1.367610 0.250957 1134.80 1200.03 1.002
alpha{3} 0.463984 0.235642 0.000313 1.449328 0.299544 1175.47 1338.23 1.001
pinvar{all} 0.997597 0.000008 0.992304 1.000000 0.998482 1280.09 1314.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..*.*.
9 -- .**...
10 -- ....**
11 -- ..****
12 -- .**.**
13 -- .*..*.
14 -- .*.***
15 -- ..**..
16 -- .***.*
17 -- ..*..*
18 -- .*...*
19 -- .*.*..
20 -- .****.
21 -- ...**.
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 466 0.155230 0.006595 0.150566 0.159893 2
8 441 0.146902 0.007066 0.141905 0.151899 2
9 440 0.146569 0.011306 0.138574 0.154564 2
10 440 0.146569 0.005653 0.142572 0.150566 2
11 434 0.144570 0.016959 0.132578 0.156562 2
12 433 0.144237 0.012719 0.135243 0.153231 2
13 433 0.144237 0.013662 0.134577 0.153897 2
14 432 0.143904 0.004711 0.140573 0.147235 2
15 428 0.142572 0.009422 0.135909 0.149234 2
16 427 0.142239 0.005182 0.138574 0.145903 2
17 420 0.139907 0.003769 0.137242 0.142572 2
18 419 0.139574 0.001413 0.138574 0.140573 2
19 416 0.138574 0.004711 0.135243 0.141905 2
20 407 0.135576 0.002355 0.133911 0.137242 2
21 395 0.131579 0.008009 0.125916 0.137242 2
22 294 0.097935 0.003769 0.095270 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100139 0.009481 0.000001 0.291520 0.070481 1.000 2
length{all}[2] 0.100295 0.010365 0.000011 0.294512 0.068588 1.000 2
length{all}[3] 0.095624 0.008975 0.000010 0.283752 0.066180 1.000 2
length{all}[4] 0.098030 0.009929 0.000033 0.289761 0.066086 1.000 2
length{all}[5] 0.097748 0.009711 0.000083 0.304177 0.068097 1.000 2
length{all}[6] 0.099321 0.009988 0.000023 0.290213 0.067463 1.000 2
length{all}[7] 0.096084 0.008137 0.000214 0.266220 0.069915 1.003 2
length{all}[8] 0.097612 0.010439 0.000402 0.269271 0.066071 1.002 2
length{all}[9] 0.107887 0.010720 0.000043 0.322043 0.076067 0.998 2
length{all}[10] 0.091627 0.007874 0.000630 0.271232 0.064783 0.998 2
length{all}[11] 0.091111 0.007887 0.000080 0.281490 0.065811 0.998 2
length{all}[12] 0.094069 0.008141 0.000027 0.271357 0.068073 1.001 2
length{all}[13] 0.099520 0.010327 0.000049 0.298936 0.069494 0.999 2
length{all}[14] 0.101264 0.009329 0.000642 0.282697 0.073276 0.998 2
length{all}[15] 0.106219 0.011019 0.000029 0.298518 0.073280 0.998 2
length{all}[16] 0.101133 0.009730 0.000137 0.305710 0.071246 0.998 2
length{all}[17] 0.096084 0.008933 0.000212 0.289028 0.068820 0.999 2
length{all}[18] 0.103038 0.011328 0.000212 0.308942 0.069244 1.000 2
length{all}[19] 0.100001 0.008965 0.000032 0.297701 0.071723 0.998 2
length{all}[20] 0.100157 0.010316 0.000072 0.295687 0.072518 1.001 2
length{all}[21] 0.100836 0.008500 0.000438 0.295543 0.080141 0.998 2
length{all}[22] 0.095505 0.011310 0.000448 0.302436 0.061100 1.008 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007331
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 642
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 214 / 214 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 214 / 214 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018679 0.055362 0.096577 0.010833 0.042775 0.023287 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -910.987050
Iterating by ming2
Initial: fx= 910.987050
x= 0.01868 0.05536 0.09658 0.01083 0.04277 0.02329 0.30000 1.30000
1 h-m-p 0.0000 0.0001 514.8245 ++ 897.387777 m 0.0001 13 | 1/8
2 h-m-p 0.0010 0.0148 23.9955 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 470.3357 ++ 889.155325 m 0.0000 44 | 2/8
4 h-m-p 0.0008 0.0200 19.0804 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 420.7257 ++ 885.284673 m 0.0000 75 | 3/8
6 h-m-p 0.0005 0.0241 16.0776 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 364.0036 ++ 872.976146 m 0.0001 106 | 4/8
8 h-m-p 0.0023 0.0341 12.1519 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 297.6222 ++ 867.653180 m 0.0001 138 | 5/8
10 h-m-p 0.0017 0.0637 7.5953 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 210.1641 +++ 858.880284 m 0.0002 170 | 6/8
12 h-m-p 0.4433 8.0000 0.0000 +++ 858.880284 m 8.0000 182 | 6/8
13 h-m-p 0.1460 8.0000 0.0003 +++ 858.880284 m 8.0000 196 | 6/8
14 h-m-p 0.0073 3.6297 0.3831 +++Y 858.880283 0 0.9280 212 | 6/8
15 h-m-p 1.6000 8.0000 0.0512 Y 858.880283 0 0.7305 225 | 6/8
16 h-m-p 1.6000 8.0000 0.0007 Y 858.880283 0 0.8767 238 | 6/8
17 h-m-p 0.0244 8.0000 0.0234 C 858.880283 0 0.0052 251 | 6/8
18 h-m-p 1.6000 8.0000 0.0000 ---------Y 858.880283 0 0.0000 273 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 -----------Y 858.880283 0 0.0000 297
Out..
lnL = -858.880283
298 lfun, 298 eigenQcodon, 1788 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018341 0.101020 0.096956 0.100135 0.043107 0.069579 0.442424 0.805888 0.333015
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.145853
np = 9
lnL0 = -946.406049
Iterating by ming2
Initial: fx= 946.406049
x= 0.01834 0.10102 0.09696 0.10013 0.04311 0.06958 0.44242 0.80589 0.33301
1 h-m-p 0.0000 0.0001 484.4571 ++ 924.690380 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 583.4279 ++ 899.358823 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0001 832.1028 ++ 878.386792 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0007 190.1684 ++ 860.336668 m 0.0007 50 | 4/9
5 h-m-p 0.0000 0.0001 552.3480 ++ 859.049550 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0001 297.5595 ++ 858.880279 m 0.0001 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0009 ++ 858.880278 m 8.0000 86 | 6/9
8 h-m-p 0.1117 8.0000 0.0642 ---------C 858.880278 0 0.0000 110 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 858.880278 m 8.0000 128 | 6/9
10 h-m-p 0.0160 8.0000 0.2241 -----------C 858.880278 0 0.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.0012 -----------N 858.880278 0 0.0000 180 | 6/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 858.880278 m 8.0000 198 | 6/9
13 h-m-p 0.0003 0.0545 1.1266 ++++ 858.880276 m 0.0545 215 | 7/9
14 h-m-p 0.1849 1.8914 0.2783 ++ 858.880272 m 1.8914 227 | 8/9
15 h-m-p 0.1289 0.6443 0.9330 ++ 858.880200 m 0.6443 241 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 N 858.880200 0 0.0160 254 | 9/9
17 h-m-p 0.0160 8.0000 0.0000 N 858.880200 0 0.0160 266
Out..
lnL = -858.880200
267 lfun, 801 eigenQcodon, 3204 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.028632 0.086722 0.094284 0.102505 0.108210 0.074310 0.000100 1.299923 0.186216 0.378825 2.982735
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.637546
np = 11
lnL0 = -948.075049
Iterating by ming2
Initial: fx= 948.075049
x= 0.02863 0.08672 0.09428 0.10250 0.10821 0.07431 0.00011 1.29992 0.18622 0.37883 2.98274
1 h-m-p 0.0000 0.0000 387.1344 ++ 947.815952 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 277.3628 +++ 916.049494 m 0.0006 31 | 2/11
3 h-m-p 0.0001 0.0005 251.0093 ++ 878.601881 m 0.0005 45 | 3/11
4 h-m-p 0.0007 0.0034 50.2317 ++ 866.409539 m 0.0034 59 | 4/11
5 h-m-p 0.0000 0.0000 996.5923 ++ 865.543934 m 0.0000 73 | 5/11
6 h-m-p 0.0033 0.0202 5.3508 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 344.9960 ++ 862.488250 m 0.0000 111 | 6/11
8 h-m-p 0.0160 8.0000 3.6245 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 288.9272 ++ 859.824195 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 1.7301 -------------.. | 7/11
11 h-m-p 0.0000 0.0000 209.1020 ++ 858.880274 m 0.0000 189 | 8/11
12 h-m-p 0.0183 8.0000 0.0000 +++++ 858.880274 m 8.0000 206 | 8/11
13 h-m-p 0.0160 8.0000 0.0129 +++++ 858.880273 m 8.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 9.8446 -----------N 858.880273 0 0.0000 254 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 ---N 858.880273 0 0.0001 271 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 858.880273 m 8.0000 291 | 8/11
17 h-m-p 0.0160 8.0000 0.5792 --------Y 858.880273 0 0.0000 316 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 858.880273 m 8.0000 336 | 8/11
19 h-m-p 0.0012 0.5983 4.2341 +++++ 858.880257 m 0.5983 356 | 9/11
20 h-m-p 0.0816 5.0578 20.5925 C 858.880257 0 0.0225 370 | 9/11
21 h-m-p 1.6000 8.0000 0.0355 --------C 858.880257 0 0.0000 392 | 9/11
22 h-m-p 1.6000 8.0000 0.0000 --N 858.880257 0 0.0250 410
Out..
lnL = -858.880257
411 lfun, 1644 eigenQcodon, 7398 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -858.900440 S = -858.877856 -0.008667
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065186 0.074568 0.077490 0.106514 0.021880 0.074006 0.000100 0.834235 1.963321
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.366202
np = 9
lnL0 = -942.502617
Iterating by ming2
Initial: fx= 942.502617
x= 0.06519 0.07457 0.07749 0.10651 0.02188 0.07401 0.00011 0.83423 1.96332
1 h-m-p 0.0000 0.0000 463.8614 ++ 942.188955 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0152 53.1747 +++++ 913.105629 m 0.0152 29 | 2/9
3 h-m-p 0.0000 0.0000 1008.4340 ++ 910.915112 m 0.0000 41 | 3/9
4 h-m-p 0.0000 0.0001 711.8564 ++ 874.885732 m 0.0001 53 | 4/9
5 h-m-p 0.0001 0.0003 88.1258 ++ 872.196715 m 0.0003 65 | 5/9
6 h-m-p 0.0000 0.0002 170.3502 ++ 865.699482 m 0.0002 77 | 6/9
7 h-m-p 0.0044 0.3953 4.8839 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 289.3233 ++ 863.932614 m 0.0000 111 | 7/9
9 h-m-p 0.0160 8.0000 0.9513 -------------.. | 7/9
10 h-m-p 0.0000 0.0001 202.8587 ++ 858.880200 m 0.0001 148 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 858.880200 0 1.6000 160 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 N 858.880200 0 0.0160 173
Out..
lnL = -858.880200
174 lfun, 1914 eigenQcodon, 10440 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.072042 0.014530 0.024204 0.098677 0.015267 0.100028 0.000100 0.900000 0.413421 1.771828 2.403857
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.683375
np = 11
lnL0 = -915.968375
Iterating by ming2
Initial: fx= 915.968375
x= 0.07204 0.01453 0.02420 0.09868 0.01527 0.10003 0.00011 0.90000 0.41342 1.77183 2.40386
1 h-m-p 0.0000 0.0000 374.9753 ++ 915.777623 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 386.0046 +++ 901.602132 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 228.0044 ++ 901.004619 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0021 80.8104 ++++ 889.252079 m 0.0021 61 | 4/11
5 h-m-p 0.0000 0.0001 1682.0202 ++ 865.285597 m 0.0001 75 | 5/11
6 h-m-p 0.0000 0.0001 216.7126 ++ 864.612388 m 0.0001 89 | 6/11
7 h-m-p 0.0035 0.0678 3.0993 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 279.4155 ++ 859.038478 m 0.0001 127 | 7/11
9 h-m-p 0.0005 0.0023 10.6843 ++ 858.880267 m 0.0023 141 | 8/11
10 h-m-p 1.6000 8.0000 0.0008 ++ 858.880266 m 8.0000 155 | 8/11
11 h-m-p 0.0489 6.0866 0.1354 ------------C 858.880266 0 0.0000 184 | 8/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 858.880266 m 8.0000 204 | 8/11
13 h-m-p 0.0124 6.2003 0.1980 -------------.. | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 858.880265 m 8.0000 252 | 8/11
15 h-m-p 0.0122 6.0836 0.1359 ------------Y 858.880265 0 0.0000 281 | 8/11
16 h-m-p 0.0052 2.6222 0.0669 +++++ 858.880200 m 2.6222 301 | 9/11
17 h-m-p 1.6000 8.0000 0.0000 N 858.880200 0 0.2000 318 | 9/11
18 h-m-p 0.0833 8.0000 0.0000 Y 858.880200 0 0.0833 334 | 9/11
19 h-m-p 0.0160 8.0000 0.0970 ++++
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
+ 858.880200 m 8.0000 353
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.131310e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36140) = 1.093077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36115) = 1.093221e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36127) = 1.093149e-160 2000 rounds
| 9/11
20 h-m-p 0.2173 1.0867 1.1784
QuantileBeta(0.15, 0.00500, 2.52860) = 1.004849e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03056) = 8.084547e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
+ 858.880200 m 1.0867 369
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.854188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589245e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589250e-161 2000 rounds
| 9/11
21 h-m-p 0.7787 3.8934 1.2552
QuantileBeta(0.15, 0.00500, 2.55931) = 9.901544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03824) = 8.060415e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.15798) = 7.701829e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.18791) = 7.617087e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19539) = 7.596190e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19726) = 7.590984e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19773) = 7.589684e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19785) = 7.589359e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19788) = 7.589277e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19788) = 7.589257e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589252e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
N 858.880200 0 0.0000 393
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.854189e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589246e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
| 10/11
22 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
Y 858.880200 0 0.0016 411
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.854189e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19803) = 7.588844e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19774) = 7.589657e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
| 10/11
23 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
N 858.880200 0 0.0001 432
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
Out..
lnL = -858.880200
433 lfun, 5196 eigenQcodon, 28578 P(t)
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -858.947831 S = -858.881258 -0.029637
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:14
did 20 / 56 patterns 0:15
did 30 / 56 patterns 0:15
did 40 / 56 patterns 0:15
did 50 / 56 patterns 0:15
did 56 / 56 patterns 0:15
QuantileBeta(0.15, 0.00500, 3.19789) = 7.589251e-161 2000 rounds
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=214
NC_011896_1_WP_010907497_1_63_MLBR_RS00315 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
NC_002677_1_NP_301172_1_44_ML0064 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
**************************************************
NC_011896_1_WP_010907497_1_63_MLBR_RS00315 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
NC_002677_1_NP_301172_1_44_ML0064 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
**************************************************
NC_011896_1_WP_010907497_1_63_MLBR_RS00315 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
NC_002677_1_NP_301172_1_44_ML0064 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
**************************************************
NC_011896_1_WP_010907497_1_63_MLBR_RS00315 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
NC_002677_1_NP_301172_1_44_ML0064 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
**************************************************
NC_011896_1_WP_010907497_1_63_MLBR_RS00315 LVHIWVSSIYNEIR
NC_002677_1_NP_301172_1_44_ML0064 LVHIWVSSIYNEIR
NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 LVHIWVSSIYNEIR
NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 LVHIWVSSIYNEIR
NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 LVHIWVSSIYNEIR
NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 LVHIWVSSIYNEIR
**************
>NC_011896_1_WP_010907497_1_63_MLBR_RS00315 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC >NC_002677_1_NP_301172_1_44_ML0064 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC >NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC >NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC >NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC >NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>NC_011896_1_WP_010907497_1_63_MLBR_RS00315 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT LVHIWVSSIYNEIR >NC_002677_1_NP_301172_1_44_ML0064 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT LVHIWVSSIYNEIR >NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT LVHIWVSSIYNEIR >NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT LVHIWVSSIYNEIR >NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT LVHIWVSSIYNEIR >NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335 VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT LVHIWVSSIYNEIR
#NEXUS
[ID: 0279925210]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907497_1_63_MLBR_RS00315
NC_002677_1_NP_301172_1_44_ML0064
NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080
NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265
NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320
NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907497_1_63_MLBR_RS00315,
2 NC_002677_1_NP_301172_1_44_ML0064,
3 NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080,
4 NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265,
5 NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320,
6 NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07048084,2:0.06858833,3:0.0661802,4:0.06608629,5:0.0680974,6:0.06746284);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07048084,2:0.06858833,3:0.0661802,4:0.06608629,5:0.0680974,6:0.06746284);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -883.98 -887.14
2 -883.95 -887.22
--------------------------------------
TOTAL -883.96 -887.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888945 0.087025 0.356496 1.464892 0.860317 1445.11 1455.77 1.000
r(A<->C){all} 0.164478 0.018648 0.000079 0.436268 0.128533 260.52 266.04 1.001
r(A<->G){all} 0.164810 0.021372 0.000001 0.464455 0.121613 143.05 198.47 1.000
r(A<->T){all} 0.179915 0.023207 0.000018 0.478323 0.138602 218.06 280.13 1.000
r(C<->G){all} 0.159010 0.019396 0.000003 0.445173 0.118329 274.61 331.25 1.003
r(C<->T){all} 0.160575 0.018806 0.000018 0.451679 0.122849 302.79 339.51 1.002
r(G<->T){all} 0.171212 0.020471 0.000030 0.455576 0.135109 219.50 220.93 1.004
pi(A){all} 0.245032 0.000288 0.211775 0.277298 0.244632 1152.71 1326.86 1.000
pi(C){all} 0.302260 0.000333 0.267852 0.339272 0.301641 1238.57 1277.35 1.003
pi(G){all} 0.257634 0.000300 0.225195 0.291175 0.257504 1054.39 1155.16 1.000
pi(T){all} 0.195075 0.000241 0.165000 0.225355 0.195202 1250.91 1352.48 1.001
alpha{1,2} 0.419986 0.225627 0.000116 1.367610 0.250957 1134.80 1200.03 1.002
alpha{3} 0.463984 0.235642 0.000313 1.449328 0.299544 1175.47 1338.23 1.001
pinvar{all} 0.997597 0.000008 0.992304 1.000000 0.998482 1280.09 1314.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0064/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 214
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 8 8 8 8 8 8 | TCC 6 6 6 6 6 6 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 4 4 4 4 4 4 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 8 8 8 8 8 8
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 4 4 4 4 4 4 | CGA 3 3 3 3 3 3
CTG 8 8 8 8 8 8 | CCG 3 3 3 3 3 3 | CAG 2 2 2 2 2 2 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 4 4 4 4 4 4 | Ser AGT 3 3 3 3 3 3
ATC 6 6 6 6 6 6 | ACC 14 14 14 14 14 14 | AAC 7 7 7 7 7 7 | AGC 3 3 3 3 3 3
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 5 5 5 5 5 5 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 11 11 11 11 11 11 | GAC 7 7 7 7 7 7 | GGC 2 2 2 2 2 2
GTA 2 2 2 2 2 2 | GCA 3 3 3 3 3 3 | Glu GAA 8 8 8 8 8 8 | GGA 2 2 2 2 2 2
GTG 9 9 9 9 9 9 | GCG 4 4 4 4 4 4 | GAG 6 6 6 6 6 6 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907497_1_63_MLBR_RS00315
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
#2: NC_002677_1_NP_301172_1_44_ML0064
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
#3: NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
#4: NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
#5: NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
#6: NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 48 | TCC 36 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 6
CTC 24 | CCC 6 | CAC 12 | CGC 48
CTA 6 | CCA 12 | Gln Q CAA 24 | CGA 18
CTG 48 | CCG 18 | CAG 12 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 24 | Ser S AGT 18
ATC 36 | ACC 84 | AAC 42 | AGC 18
ATA 12 | ACA 18 | Lys K AAA 30 | Arg R AGA 6
Met M ATG 12 | ACG 0 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 30 | Asp D GAT 18 | Gly G GGT 6
GTC 12 | GCC 66 | GAC 42 | GGC 12
GTA 12 | GCA 18 | Glu E GAA 48 | GGA 12
GTG 54 | GCG 24 | GAG 36 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16355 C:0.22897 A:0.28505 G:0.32243
position 2: T:0.26636 C:0.28505 A:0.27570 G:0.17290
position 3: T:0.15421 C:0.39720 A:0.17290 G:0.27570
Average T:0.19470 C:0.30374 A:0.24455 G:0.25701
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -858.880283 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.442424 0.930435
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907497_1_63_MLBR_RS00315: 0.000004, NC_002677_1_NP_301172_1_44_ML0064: 0.000004, NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080: 0.000004, NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265: 0.000004, NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320: 0.000004, NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.44242
omega (dN/dS) = 0.93044
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 507.1 134.9 0.9304 0.0000 0.0000 0.0 0.0
7..2 0.000 507.1 134.9 0.9304 0.0000 0.0000 0.0 0.0
7..3 0.000 507.1 134.9 0.9304 0.0000 0.0000 0.0 0.0
7..4 0.000 507.1 134.9 0.9304 0.0000 0.0000 0.0 0.0
7..5 0.000 507.1 134.9 0.9304 0.0000 0.0000 0.0 0.0
7..6 0.000 507.1 134.9 0.9304 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -858.880200 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907497_1_63_MLBR_RS00315: 0.000004, NC_002677_1_NP_301172_1_44_ML0064: 0.000004, NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080: 0.000004, NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265: 0.000004, NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320: 0.000004, NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -858.880257 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.690971 0.082704 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907497_1_63_MLBR_RS00315: 0.000004, NC_002677_1_NP_301172_1_44_ML0064: 0.000004, NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080: 0.000004, NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265: 0.000004, NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320: 0.000004, NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.69097 0.08270 0.22633
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.4 124.6 0.3090 0.0000 0.0000 0.0 0.0
7..2 0.000 517.4 124.6 0.3090 0.0000 0.0000 0.0 0.0
7..3 0.000 517.4 124.6 0.3090 0.0000 0.0000 0.0 0.0
7..4 0.000 517.4 124.6 0.3090 0.0000 0.0000 0.0 0.0
7..5 0.000 517.4 124.6 0.3090 0.0000 0.0000 0.0 0.0
7..6 0.000 517.4 124.6 0.3090 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907497_1_63_MLBR_RS00315)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907497_1_63_MLBR_RS00315)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -858.880200 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.867555
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907497_1_63_MLBR_RS00315: 0.000004, NC_002677_1_NP_301172_1_44_ML0064: 0.000004, NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080: 0.000004, NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265: 0.000004, NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320: 0.000004, NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.86755
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -858.880200 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 3.197886 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907497_1_63_MLBR_RS00315: 0.000004, NC_002677_1_NP_301172_1_44_ML0064: 0.000004, NZ_LVXE01000014_1_WP_010907497_1_515_A3216_RS06080: 0.000004, NZ_LYPH01000018_1_WP_010907497_1_692_A8144_RS03265: 0.000004, NZ_CP029543_1_WP_010907497_1_61_DIJ64_RS00320: 0.000004, NZ_AP014567_1_WP_010907497_1_64_JK2ML_RS00335: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 3.19789
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 517.4 124.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907497_1_63_MLBR_RS00315)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095
Time used: 0:15
Model 1: NearlyNeutral -858.8802 Model 2: PositiveSelection -858.880257 Model 0: one-ratio -858.880283 Model 7: beta -858.8802 Model 8: beta&w>1 -858.8802 Model 0 vs 1 1.6600000003563764E-4 Model 2 vs 1 1.1400000016692502E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
