--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:32:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0064/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -883.98          -887.14
2       -883.95          -887.22
--------------------------------------
TOTAL     -883.96          -887.18
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888945    0.087025    0.356496    1.464892    0.860317   1445.11   1455.77    1.000
r(A<->C){all}   0.164478    0.018648    0.000079    0.436268    0.128533    260.52    266.04    1.001
r(A<->G){all}   0.164810    0.021372    0.000001    0.464455    0.121613    143.05    198.47    1.000
r(A<->T){all}   0.179915    0.023207    0.000018    0.478323    0.138602    218.06    280.13    1.000
r(C<->G){all}   0.159010    0.019396    0.000003    0.445173    0.118329    274.61    331.25    1.003
r(C<->T){all}   0.160575    0.018806    0.000018    0.451679    0.122849    302.79    339.51    1.002
r(G<->T){all}   0.171212    0.020471    0.000030    0.455576    0.135109    219.50    220.93    1.004
pi(A){all}      0.245032    0.000288    0.211775    0.277298    0.244632   1152.71   1326.86    1.000
pi(C){all}      0.302260    0.000333    0.267852    0.339272    0.301641   1238.57   1277.35    1.003
pi(G){all}      0.257634    0.000300    0.225195    0.291175    0.257504   1054.39   1155.16    1.000
pi(T){all}      0.195075    0.000241    0.165000    0.225355    0.195202   1250.91   1352.48    1.001
alpha{1,2}      0.419986    0.225627    0.000116    1.367610    0.250957   1134.80   1200.03    1.002
alpha{3}        0.463984    0.235642    0.000313    1.449328    0.299544   1175.47   1338.23    1.001
pinvar{all}     0.997597    0.000008    0.992304    1.000000    0.998482   1280.09   1314.52    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-858.8802
Model 2: PositiveSelection	-858.880257
Model 0: one-ratio	-858.880283
Model 7: beta	-858.8802
Model 8: beta&w>1	-858.8802


Model 0 vs 1	1.6600000003563764E-4

Model 2 vs 1	1.1400000016692502E-4

Model 8 vs 7	0.0
>C1
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C2
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C3
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C4
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C5
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C6
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=214 

C1              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C2              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C3              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C4              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C5              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C6              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
                **************************************************

C1              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C2              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C3              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C4              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C5              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C6              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
                **************************************************

C1              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C2              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C3              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C4              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C5              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C6              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
                **************************************************

C1              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C2              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C3              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C4              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C5              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C6              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
                **************************************************

C1              LVHIWVSSIYNEIR
C2              LVHIWVSSIYNEIR
C3              LVHIWVSSIYNEIR
C4              LVHIWVSSIYNEIR
C5              LVHIWVSSIYNEIR
C6              LVHIWVSSIYNEIR
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6420]--->[6420]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.750 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C2              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C3              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C4              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C5              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
C6              VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
                **************************************************

C1              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C2              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C3              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C4              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C5              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
C6              AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
                **************************************************

C1              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C2              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C3              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C4              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C5              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
C6              KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
                **************************************************

C1              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C2              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C3              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C4              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C5              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
C6              IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
                **************************************************

C1              LVHIWVSSIYNEIR
C2              LVHIWVSSIYNEIR
C3              LVHIWVSSIYNEIR
C4              LVHIWVSSIYNEIR
C5              LVHIWVSSIYNEIR
C6              LVHIWVSSIYNEIR
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C2              GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C3              GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C4              GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C5              GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
C6              GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
                **************************************************

C1              CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C2              CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C3              CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C4              CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C5              CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
C6              CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
                **************************************************

C1              AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C2              AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C3              AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C4              AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C5              AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
C6              AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
                **************************************************

C1              GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C2              GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C3              GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C4              GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C5              GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
C6              GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
                **************************************************

C1              CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C2              CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C3              CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C4              CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C5              CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
C6              CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
                **************************************************

C1              ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C2              ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C3              ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C4              ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C5              ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
C6              ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
                **************************************************

C1              AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C2              AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C3              AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C4              AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C5              AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
C6              AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
                **************************************************

C1              AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C2              AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C3              AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C4              AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C5              AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
C6              AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
                **************************************************

C1              AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C2              AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C3              AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C4              AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C5              AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
C6              AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
                **************************************************

C1              ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C2              ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C3              ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C4              ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C5              ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
C6              ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
                **************************************************

C1              AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C2              AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C3              AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C4              AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C5              AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
C6              AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
                **************************************************

C1              CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C2              CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C3              CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C4              CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C5              CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
C6              CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
                **************************************************

C1              CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C2              CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C3              CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C4              CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C5              CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
C6              CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
                ******************************************



>C1
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C2
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C3
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C4
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C5
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C6
GTGATAAATTCCACTGCCGGACAAACTTCGCAAAGCCGGAGTCGACGCAG
CACACGCCCGTCCGGCGACGACCGTGAACTGGCAATCCTGGCCACCGCTG
AGCAACTTCTTGAGGACCGACCGCTTACCGAGATCTCGGTAGATTACTTG
GCCAAAAGTGCCGGGATTTCGCGGCCAACTTTCTACTTCTATTTCGCTTC
CAAGGAAGCTGTGCTATTGACACTGCTGGACCGCGTGTTCAACAAGGCGA
ACGCTGCCCTCGAAACCCTCATTAAGAATCGAGATAACAAACGCGGCAAT
AAGTGGCGCACCGGGATCAACGTATTCTTCGAAACCTTTGGATCCCATAA
AGCAGTGACCTGTGCGGGGCAAGTCACCAGAGACAATACCGAGGTTCGGA
AATTGTGGTCGACCTTCATGCAGAAGTGGATCTCCTACACCGCCGCTGTG
ATCGATGCCGAACGCAAACGCGGTGTGGCACCAGACACCCTGCCCGCCAC
AGAATTGGCCACCGCGCTCAACCTGATGAACGAGCGGGCGCTGTTTGCCT
CATTCACCGCCGAACAGCCTCACGTCCCGGAGTCCCGGGTGCTCGACACC
CTGGTGCACATCTGGGTGAGCAGTATATACAACGAAATTCGC
>C1
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C2
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C3
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C4
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C5
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR
>C6
VINSTAGQTSQSRSRRSTRPSGDDRELAILATAEQLLEDRPLTEISVDYL
AKSAGISRPTFYFYFASKEAVLLTLLDRVFNKANAALETLIKNRDNKRGN
KWRTGINVFFETFGSHKAVTCAGQVTRDNTEVRKLWSTFMQKWISYTAAV
IDAERKRGVAPDTLPATELATALNLMNERALFASFTAEQPHVPESRVLDT
LVHIWVSSIYNEIR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 642 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789878
      Setting output file names to "/data/3res/ML0064/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1058309914
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0279925210
      Seed = 1367075013
      Swapseed = 1579789878
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1436.826701 -- -24.965149
         Chain 2 -- -1436.826783 -- -24.965149
         Chain 3 -- -1436.826783 -- -24.965149
         Chain 4 -- -1436.826783 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1436.826783 -- -24.965149
         Chain 2 -- -1436.826563 -- -24.965149
         Chain 3 -- -1436.826701 -- -24.965149
         Chain 4 -- -1436.826783 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1436.827] (-1436.827) (-1436.827) (-1436.827) * [-1436.827] (-1436.827) (-1436.827) (-1436.827) 
        500 -- (-893.825) (-897.894) [-889.753] (-900.935) * (-902.582) (-897.908) [-891.057] (-896.730) -- 0:00:00
       1000 -- (-893.462) (-903.704) [-896.892] (-894.544) * (-899.240) (-903.507) (-893.459) [-890.947] -- 0:00:00
       1500 -- (-897.607) (-890.608) [-894.317] (-893.015) * [-892.208] (-896.762) (-899.912) (-896.236) -- 0:00:00
       2000 -- [-892.877] (-892.530) (-891.331) (-886.456) * (-899.144) [-889.783] (-901.134) (-891.637) -- 0:00:00
       2500 -- (-895.326) (-891.532) (-894.308) [-887.269] * (-891.857) [-887.141] (-891.877) (-896.473) -- 0:00:00
       3000 -- [-889.291] (-897.600) (-889.592) (-893.368) * (-892.051) (-893.443) [-894.771] (-892.217) -- 0:00:00
       3500 -- (-896.818) (-893.965) (-896.179) [-889.869] * (-894.579) (-896.028) (-890.325) [-887.801] -- 0:00:00
       4000 -- (-893.747) [-891.794] (-894.556) (-894.750) * (-891.717) [-889.679] (-898.203) (-896.626) -- 0:00:00
       4500 -- (-890.577) [-892.455] (-893.599) (-887.014) * (-902.289) [-897.188] (-894.061) (-891.535) -- 0:03:41
       5000 -- (-892.372) (-894.612) (-892.174) [-893.715] * (-894.188) [-889.017] (-890.579) (-890.312) -- 0:03:19

      Average standard deviation of split frequencies: 0.071425

       5500 -- (-897.261) [-890.078] (-892.924) (-890.946) * (-896.581) (-895.959) (-900.142) [-888.955] -- 0:03:00
       6000 -- (-890.974) (-900.018) (-897.536) [-898.945] * (-892.861) (-892.477) [-891.839] (-902.055) -- 0:02:45
       6500 -- (-894.849) (-905.677) [-890.294] (-898.572) * [-893.687] (-891.464) (-894.171) (-895.836) -- 0:02:32
       7000 -- [-899.513] (-893.881) (-900.337) (-902.217) * (-894.467) [-891.676] (-891.519) (-899.600) -- 0:02:21
       7500 -- (-890.210) [-893.979] (-896.403) (-898.175) * (-900.992) [-895.797] (-889.401) (-894.457) -- 0:02:12
       8000 -- (-885.628) [-890.571] (-893.118) (-899.631) * (-896.670) [-894.475] (-891.330) (-901.508) -- 0:02:04
       8500 -- (-896.439) (-896.331) (-896.165) [-898.262] * (-888.188) (-898.986) [-887.855] (-892.409) -- 0:01:56
       9000 -- (-897.791) (-896.242) [-893.845] (-890.927) * [-885.264] (-896.087) (-891.938) (-896.578) -- 0:01:50
       9500 -- [-893.237] (-893.463) (-889.926) (-892.903) * (-885.728) (-893.024) (-900.737) [-891.537] -- 0:01:44
      10000 -- (-894.903) (-895.544) (-890.900) [-889.748] * (-884.604) (-903.914) [-894.598] (-899.095) -- 0:01:39

      Average standard deviation of split frequencies: 0.054717

      10500 -- (-901.468) [-891.316] (-891.740) (-895.312) * [-883.537] (-898.813) (-890.778) (-889.954) -- 0:01:34
      11000 -- [-887.107] (-895.636) (-899.534) (-890.925) * (-883.356) (-891.797) (-902.365) [-891.147] -- 0:01:29
      11500 -- (-893.008) (-893.819) (-896.809) [-888.907] * (-884.101) (-889.738) [-896.961] (-897.664) -- 0:01:25
      12000 -- (-899.114) (-896.381) (-889.717) [-893.606] * (-882.621) [-890.710] (-897.542) (-891.601) -- 0:01:22
      12500 -- [-891.497] (-900.684) (-896.523) (-899.411) * (-882.621) (-893.160) (-893.147) [-892.086] -- 0:01:19
      13000 -- [-891.775] (-897.246) (-892.481) (-895.684) * (-883.721) (-902.410) (-892.264) [-893.874] -- 0:01:15
      13500 -- (-897.999) (-904.105) [-891.434] (-887.065) * (-884.200) (-895.099) (-891.886) [-887.489] -- 0:01:13
      14000 -- (-912.350) (-890.928) (-888.211) [-889.387] * (-884.471) (-900.368) (-889.623) [-883.313] -- 0:01:10
      14500 -- (-893.295) (-890.145) [-889.988] (-889.908) * (-883.497) [-891.067] (-897.433) (-883.201) -- 0:01:07
      15000 -- (-895.694) (-894.146) (-900.650) [-897.837] * (-885.487) (-887.344) [-896.589] (-883.406) -- 0:01:05

      Average standard deviation of split frequencies: 0.073657

      15500 -- (-883.216) (-896.524) [-890.078] (-893.299) * (-884.326) [-890.253] (-894.872) (-883.698) -- 0:01:03
      16000 -- (-882.684) [-887.655] (-889.743) (-892.629) * (-882.594) (-897.893) (-893.414) [-883.170] -- 0:01:01
      16500 -- (-884.665) (-894.436) [-891.235] (-892.449) * (-883.503) [-890.191] (-894.790) (-883.500) -- 0:00:59
      17000 -- (-887.221) (-891.460) (-896.186) [-894.277] * (-883.196) (-898.857) [-890.344] (-885.312) -- 0:00:57
      17500 -- (-884.455) (-901.004) (-893.034) [-897.760] * (-883.035) [-901.179] (-891.404) (-884.766) -- 0:00:56
      18000 -- (-885.095) (-896.264) (-895.347) [-896.293] * (-883.961) [-894.236] (-893.912) (-882.733) -- 0:00:54
      18500 -- (-883.763) (-897.556) [-890.778] (-891.392) * (-883.021) (-901.029) [-891.853] (-883.148) -- 0:00:53
      19000 -- (-887.830) (-894.790) [-890.932] (-895.310) * (-883.707) [-890.961] (-892.049) (-883.360) -- 0:01:43
      19500 -- [-883.135] (-896.418) (-894.697) (-899.833) * (-883.027) [-899.977] (-905.860) (-883.532) -- 0:01:40
      20000 -- [-882.860] (-890.253) (-899.948) (-905.216) * (-886.021) (-892.472) [-890.954] (-884.049) -- 0:01:38

      Average standard deviation of split frequencies: 0.061913

      20500 -- (-884.161) [-891.664] (-888.933) (-902.934) * (-884.937) [-883.179] (-891.814) (-883.229) -- 0:01:35
      21000 -- [-883.979] (-889.530) (-894.288) (-883.189) * (-884.135) [-883.301] (-891.906) (-883.911) -- 0:01:33
      21500 -- (-884.118) (-890.833) [-900.880] (-883.426) * [-884.424] (-883.324) (-891.769) (-883.210) -- 0:01:31
      22000 -- [-885.985] (-893.367) (-897.682) (-887.365) * [-888.784] (-884.420) (-896.916) (-885.052) -- 0:01:28
      22500 -- [-885.389] (-891.034) (-892.645) (-885.220) * (-883.886) (-883.312) (-901.033) [-885.288] -- 0:01:26
      23000 -- (-885.467) (-909.786) [-892.201] (-884.072) * (-885.813) [-884.936] (-893.896) (-884.093) -- 0:01:24
      23500 -- (-885.976) (-895.211) [-887.895] (-887.245) * (-884.052) (-884.430) [-896.899] (-885.061) -- 0:01:23
      24000 -- (-884.795) (-892.047) (-896.152) [-887.873] * [-884.227] (-885.938) (-894.910) (-884.088) -- 0:01:21
      24500 -- (-887.395) (-889.733) (-893.593) [-887.440] * (-886.587) [-884.333] (-894.967) (-885.452) -- 0:01:19
      25000 -- (-893.124) (-896.459) [-889.713] (-887.393) * (-887.468) [-884.435] (-904.403) (-883.580) -- 0:01:18

      Average standard deviation of split frequencies: 0.050939

      25500 -- (-891.416) [-894.935] (-894.895) (-886.713) * (-886.268) [-884.354] (-897.010) (-885.012) -- 0:01:16
      26000 -- [-884.553] (-890.373) (-892.289) (-885.623) * [-884.243] (-885.602) (-890.119) (-885.067) -- 0:01:14
      26500 -- (-885.113) (-888.530) (-891.051) [-884.252] * (-884.317) (-888.855) [-892.611] (-884.913) -- 0:01:13
      27000 -- [-888.434] (-900.189) (-895.008) (-885.053) * (-884.331) (-893.441) [-889.082] (-886.448) -- 0:01:12
      27500 -- (-883.710) (-894.928) [-890.417] (-884.255) * (-884.202) (-884.881) [-888.803] (-885.416) -- 0:01:10
      28000 -- (-883.957) (-900.094) [-893.725] (-885.770) * (-884.853) (-883.754) (-902.964) [-884.964] -- 0:01:09
      28500 -- (-883.557) [-888.870] (-901.903) (-886.023) * [-885.534] (-885.026) (-895.708) (-888.169) -- 0:01:08
      29000 -- (-887.611) [-897.401] (-894.398) (-885.561) * [-883.074] (-884.371) (-889.356) (-885.042) -- 0:01:06
      29500 -- (-883.888) (-895.961) (-896.285) [-882.674] * (-884.058) (-885.581) (-898.542) [-883.339] -- 0:01:05
      30000 -- (-885.057) (-892.784) [-895.079] (-885.043) * (-884.053) (-883.539) (-889.629) [-883.581] -- 0:01:04

      Average standard deviation of split frequencies: 0.037216

      30500 -- [-886.150] (-895.100) (-895.438) (-885.233) * (-884.214) (-883.316) [-898.211] (-887.976) -- 0:01:03
      31000 -- [-885.327] (-889.146) (-896.364) (-883.244) * [-885.977] (-885.603) (-893.612) (-887.207) -- 0:01:02
      31500 -- (-884.949) (-899.327) [-900.405] (-883.718) * (-885.378) (-886.480) [-890.581] (-889.239) -- 0:01:01
      32000 -- (-885.048) [-893.216] (-897.520) (-887.697) * (-884.438) (-885.628) (-892.603) [-884.148] -- 0:01:00
      32500 -- [-885.270] (-893.489) (-888.945) (-887.204) * [-886.096] (-882.452) (-894.645) (-884.547) -- 0:00:59
      33000 -- (-886.867) (-894.741) [-898.256] (-884.535) * [-884.604] (-883.235) (-892.553) (-884.819) -- 0:00:58
      33500 -- [-885.351] (-889.753) (-896.957) (-885.456) * (-893.335) (-885.194) (-895.467) [-882.933] -- 0:00:57
      34000 -- (-885.051) (-888.307) [-890.862] (-889.166) * (-884.439) (-885.154) (-894.653) [-883.159] -- 0:00:56
      34500 -- (-888.182) (-894.375) (-895.015) [-883.417] * (-885.355) [-885.128] (-892.569) (-884.197) -- 0:00:55
      35000 -- (-888.253) (-893.467) (-891.533) [-884.024] * (-885.847) (-883.493) (-895.508) [-885.681] -- 0:01:22

      Average standard deviation of split frequencies: 0.034191

      35500 -- (-887.809) [-899.177] (-894.466) (-884.782) * (-883.553) [-884.593] (-896.336) (-883.920) -- 0:01:21
      36000 -- (-885.712) [-892.016] (-894.466) (-886.920) * (-888.073) [-883.480] (-892.670) (-885.240) -- 0:01:20
      36500 -- [-884.369] (-890.685) (-893.446) (-885.161) * (-886.262) (-884.769) [-892.879] (-888.212) -- 0:01:19
      37000 -- [-882.385] (-896.831) (-890.238) (-884.710) * (-885.213) (-887.546) (-899.606) [-886.292] -- 0:01:18
      37500 -- (-884.474) (-895.768) [-888.593] (-883.498) * (-889.516) (-884.890) [-894.992] (-886.938) -- 0:01:17
      38000 -- (-889.058) (-899.842) (-895.134) [-883.793] * [-886.384] (-887.275) (-896.832) (-887.494) -- 0:01:15
      38500 -- [-886.827] (-906.536) (-893.422) (-884.362) * (-887.164) [-886.437] (-893.787) (-888.549) -- 0:01:14
      39000 -- (-883.607) [-892.004] (-894.741) (-887.287) * [-886.178] (-886.734) (-897.114) (-885.104) -- 0:01:13
      39500 -- (-883.699) [-894.163] (-892.876) (-886.265) * (-883.763) (-885.157) [-893.798] (-883.678) -- 0:01:12
      40000 -- [-890.389] (-898.920) (-893.054) (-886.258) * (-883.998) (-883.687) [-898.018] (-885.850) -- 0:01:12

      Average standard deviation of split frequencies: 0.037674

      40500 -- (-885.593) (-890.802) [-887.998] (-887.308) * [-886.261] (-884.632) (-890.094) (-884.853) -- 0:01:11
      41000 -- (-883.686) (-896.987) (-902.033) [-883.623] * (-885.436) (-888.583) (-892.980) [-884.108] -- 0:01:10
      41500 -- (-889.219) (-893.737) (-905.078) [-883.009] * (-884.697) (-884.729) [-894.330] (-883.400) -- 0:01:09
      42000 -- (-887.954) (-892.845) [-889.958] (-885.771) * (-884.464) [-883.068] (-890.157) (-883.058) -- 0:01:08
      42500 -- (-885.014) (-896.034) (-897.404) [-882.861] * (-886.230) (-882.431) (-885.031) [-883.472] -- 0:01:07
      43000 -- (-884.639) (-896.951) (-893.881) [-883.242] * (-888.773) [-882.896] (-885.092) (-886.257) -- 0:01:06
      43500 -- (-884.985) [-898.104] (-898.856) (-884.707) * (-885.012) (-889.447) [-884.453] (-883.781) -- 0:01:05
      44000 -- (-885.724) [-893.810] (-899.103) (-883.313) * [-883.396] (-888.442) (-884.441) (-884.474) -- 0:01:05
      44500 -- [-886.829] (-889.678) (-897.440) (-883.343) * (-885.012) [-883.850] (-886.176) (-883.705) -- 0:01:04
      45000 -- [-884.100] (-895.727) (-887.061) (-883.505) * (-883.956) [-884.622] (-885.796) (-882.858) -- 0:01:03

      Average standard deviation of split frequencies: 0.032362

      45500 -- (-884.239) (-896.924) [-887.698] (-884.219) * (-884.466) [-887.901] (-890.922) (-884.056) -- 0:01:02
      46000 -- (-884.809) [-889.637] (-884.233) (-886.086) * (-884.416) (-883.886) (-885.344) [-886.326] -- 0:01:02
      46500 -- [-885.117] (-896.097) (-888.161) (-884.888) * (-883.824) (-883.761) [-883.660] (-884.724) -- 0:01:01
      47000 -- (-886.473) [-898.047] (-883.683) (-882.925) * (-884.687) [-883.754] (-883.517) (-884.932) -- 0:01:00
      47500 -- (-889.097) [-891.286] (-884.584) (-887.290) * (-884.151) (-883.729) (-882.880) [-884.446] -- 0:01:00
      48000 -- (-885.360) (-900.114) (-885.290) [-883.641] * (-885.972) (-885.431) (-884.766) [-884.351] -- 0:00:59
      48500 -- [-883.038] (-898.946) (-885.153) (-884.992) * (-886.539) (-885.166) [-885.333] (-885.153) -- 0:00:58
      49000 -- (-883.574) (-893.347) (-884.783) [-883.984] * (-884.337) [-883.266] (-885.597) (-885.730) -- 0:00:58
      49500 -- (-886.377) [-893.129] (-882.521) (-883.637) * (-885.238) (-883.787) (-884.886) [-884.807] -- 0:00:57
      50000 -- (-885.850) (-900.181) (-884.094) [-884.010] * (-895.708) (-885.399) (-886.202) [-885.396] -- 0:00:57

      Average standard deviation of split frequencies: 0.026583

      50500 -- (-882.928) (-889.259) (-883.864) [-884.190] * (-884.870) (-883.520) (-885.323) [-882.882] -- 0:01:15
      51000 -- (-883.465) (-895.535) [-887.506] (-886.766) * (-883.230) [-884.384] (-885.828) (-882.730) -- 0:01:14
      51500 -- (-884.219) (-895.712) (-886.058) [-890.681] * (-883.826) (-885.669) (-886.168) [-884.111] -- 0:01:13
      52000 -- (-883.422) [-891.152] (-885.642) (-885.750) * (-884.715) (-885.907) (-887.707) [-882.781] -- 0:01:12
      52500 -- (-882.586) [-892.863] (-890.406) (-884.596) * (-884.674) [-884.169] (-883.855) (-883.134) -- 0:01:12
      53000 -- (-883.559) (-894.626) [-886.818] (-885.701) * (-884.275) (-888.235) [-884.899] (-882.762) -- 0:01:11
      53500 -- (-882.786) (-894.495) (-886.993) [-883.753] * [-883.895] (-885.342) (-883.835) (-882.695) -- 0:01:10
      54000 -- [-885.799] (-892.164) (-883.717) (-885.980) * (-885.681) [-885.801] (-886.270) (-883.280) -- 0:01:10
      54500 -- (-882.968) [-892.107] (-884.839) (-885.791) * (-884.350) [-885.262] (-885.060) (-884.450) -- 0:01:09
      55000 -- (-883.498) (-891.558) [-883.782] (-884.865) * (-884.988) (-883.884) [-885.534] (-889.408) -- 0:01:08

      Average standard deviation of split frequencies: 0.031457

      55500 -- (-884.039) (-898.042) [-884.771] (-886.233) * (-885.661) (-885.967) [-885.839] (-890.282) -- 0:01:08
      56000 -- (-883.310) (-890.289) [-883.344] (-888.602) * (-884.301) (-884.685) (-884.521) [-886.987] -- 0:01:07
      56500 -- (-884.123) (-900.284) [-885.507] (-889.417) * (-884.604) [-884.302] (-885.072) (-886.746) -- 0:01:06
      57000 -- (-885.779) (-899.975) [-886.812] (-886.004) * (-884.141) [-885.661] (-885.172) (-886.494) -- 0:01:06
      57500 -- [-886.951] (-894.814) (-885.235) (-883.996) * [-884.352] (-883.537) (-888.243) (-885.402) -- 0:01:05
      58000 -- (-883.639) (-888.577) (-883.655) [-883.505] * (-884.177) (-883.773) [-884.331] (-888.729) -- 0:01:04
      58500 -- [-883.596] (-891.283) (-885.375) (-884.562) * [-882.746] (-884.618) (-886.578) (-888.270) -- 0:01:04
      59000 -- (-883.991) (-885.417) (-886.062) [-887.725] * (-885.229) (-886.250) (-884.941) [-884.485] -- 0:01:03
      59500 -- [-884.701] (-885.292) (-885.304) (-883.486) * [-882.734] (-884.979) (-884.660) (-889.032) -- 0:01:03
      60000 -- (-882.877) [-885.974] (-884.006) (-888.409) * (-882.788) (-884.539) (-885.074) [-886.810] -- 0:01:02

      Average standard deviation of split frequencies: 0.032717

      60500 -- (-883.275) (-884.326) (-885.971) [-883.914] * [-883.922] (-887.844) (-889.285) (-885.476) -- 0:01:02
      61000 -- (-885.516) (-886.415) (-885.473) [-884.343] * (-882.585) (-887.224) (-889.214) [-888.680] -- 0:01:01
      61500 -- (-884.075) (-886.427) [-884.445] (-885.253) * (-882.721) (-884.603) [-884.628] (-888.396) -- 0:01:01
      62000 -- (-884.174) (-888.303) [-883.152] (-883.580) * (-884.942) [-884.074] (-884.746) (-885.060) -- 0:01:00
      62500 -- (-882.800) [-883.737] (-883.527) (-883.499) * (-886.223) [-883.631] (-883.813) (-884.818) -- 0:01:00
      63000 -- (-883.328) (-884.842) [-882.459] (-884.102) * [-886.195] (-887.414) (-883.402) (-886.787) -- 0:00:59
      63500 -- (-887.384) (-884.533) [-882.662] (-885.503) * [-883.323] (-883.936) (-885.985) (-893.349) -- 0:00:58
      64000 -- (-888.943) (-884.876) [-882.957] (-884.049) * (-883.562) [-884.900] (-884.618) (-884.916) -- 0:00:58
      64500 -- [-885.594] (-884.193) (-884.013) (-884.065) * (-884.108) (-885.451) (-883.798) [-885.242] -- 0:00:58
      65000 -- (-883.231) [-884.131] (-884.147) (-886.651) * (-883.962) (-887.191) (-883.677) [-882.874] -- 0:00:57

      Average standard deviation of split frequencies: 0.026784

      65500 -- [-883.040] (-884.335) (-883.364) (-884.137) * (-885.800) [-888.898] (-884.746) (-886.249) -- 0:01:11
      66000 -- [-884.690] (-883.820) (-884.546) (-886.565) * [-886.740] (-883.114) (-884.285) (-882.959) -- 0:01:10
      66500 -- (-884.511) (-883.905) [-883.127] (-885.146) * (-883.441) [-884.393] (-885.816) (-882.772) -- 0:01:10
      67000 -- (-885.566) [-887.326] (-887.682) (-882.803) * [-884.492] (-882.886) (-884.249) (-882.685) -- 0:01:09
      67500 -- (-884.130) (-886.333) (-888.123) [-886.051] * (-889.883) (-884.244) [-882.822] (-883.482) -- 0:01:09
      68000 -- [-885.334] (-884.162) (-883.858) (-887.014) * (-886.710) (-884.182) [-886.800] (-886.084) -- 0:01:08
      68500 -- [-883.665] (-882.777) (-888.901) (-884.598) * (-889.315) (-884.295) (-889.137) [-883.952] -- 0:01:07
      69000 -- (-882.603) (-885.115) [-886.558] (-886.327) * (-886.673) [-883.539] (-884.608) (-884.237) -- 0:01:07
      69500 -- (-883.909) (-885.895) [-885.041] (-884.588) * (-885.626) [-884.266] (-884.807) (-887.045) -- 0:01:06
      70000 -- (-883.273) (-883.610) [-883.751] (-888.281) * (-883.886) (-887.027) [-883.790] (-886.948) -- 0:01:06

      Average standard deviation of split frequencies: 0.022681

      70500 -- (-883.360) [-885.674] (-884.863) (-888.026) * (-884.055) (-886.103) (-886.789) [-886.038] -- 0:01:05
      71000 -- (-883.939) [-887.463] (-884.316) (-890.318) * (-883.794) [-884.459] (-883.848) (-886.820) -- 0:01:05
      71500 -- (-888.199) (-883.270) [-884.713] (-886.693) * (-884.155) (-886.281) (-883.216) [-885.881] -- 0:01:04
      72000 -- (-887.628) [-883.159] (-886.417) (-886.590) * (-885.194) [-883.318] (-887.075) (-884.721) -- 0:01:04
      72500 -- [-883.537] (-882.994) (-885.772) (-885.800) * (-884.541) (-883.176) (-883.790) [-884.380] -- 0:01:03
      73000 -- (-883.132) (-883.071) (-884.464) [-882.444] * [-885.385] (-885.059) (-883.326) (-885.233) -- 0:01:03
      73500 -- [-885.833] (-888.695) (-887.074) (-882.968) * (-883.833) (-885.081) (-883.493) [-884.123] -- 0:01:03
      74000 -- (-886.566) (-888.504) (-884.572) [-882.688] * (-887.350) (-884.004) (-886.491) [-884.005] -- 0:01:02
      74500 -- [-885.400] (-887.884) (-883.031) (-883.652) * (-884.919) (-889.044) (-889.900) [-885.630] -- 0:01:02
      75000 -- [-883.908] (-883.913) (-887.591) (-883.822) * (-882.435) (-887.270) (-886.700) [-883.956] -- 0:01:01

      Average standard deviation of split frequencies: 0.021709

      75500 -- (-886.574) (-883.675) [-888.690] (-884.899) * [-884.033] (-890.528) (-883.748) (-883.231) -- 0:01:01
      76000 -- (-887.377) (-883.744) [-883.643] (-883.220) * (-883.706) (-887.879) [-884.469] (-885.984) -- 0:01:00
      76500 -- (-886.262) [-883.529] (-884.583) (-883.653) * (-883.073) (-884.290) [-883.963] (-886.233) -- 0:01:00
      77000 -- (-885.794) [-885.218] (-882.783) (-883.779) * [-882.393] (-884.319) (-885.855) (-884.357) -- 0:00:59
      77500 -- (-883.732) (-882.742) [-883.818] (-883.721) * (-882.663) (-885.365) [-885.723] (-888.312) -- 0:00:59
      78000 -- (-884.798) (-886.533) (-885.491) [-884.246] * (-882.755) [-883.112] (-883.147) (-885.951) -- 0:00:59
      78500 -- (-885.001) (-882.387) [-884.724] (-887.585) * (-883.422) (-884.274) [-885.508] (-887.294) -- 0:00:58
      79000 -- (-889.512) [-883.475] (-883.637) (-884.400) * (-887.364) (-885.889) [-883.873] (-889.153) -- 0:00:58
      79500 -- (-889.348) (-883.778) (-883.427) [-882.864] * (-885.179) (-885.230) [-884.308] (-889.135) -- 0:00:57
      80000 -- (-884.716) [-883.330] (-882.339) (-885.024) * (-884.573) (-883.966) (-883.161) [-885.120] -- 0:00:57

      Average standard deviation of split frequencies: 0.024836

      80500 -- (-883.515) (-885.543) (-882.928) [-883.777] * (-884.245) (-885.459) (-885.603) [-883.961] -- 0:00:57
      81000 -- (-886.831) (-883.664) (-886.281) [-884.514] * [-886.776] (-886.420) (-884.065) (-883.566) -- 0:01:08
      81500 -- (-888.230) [-883.233] (-884.738) (-885.070) * [-884.782] (-884.957) (-886.874) (-887.620) -- 0:01:07
      82000 -- (-885.582) [-882.595] (-883.257) (-886.310) * [-885.298] (-887.326) (-883.483) (-883.928) -- 0:01:07
      82500 -- [-882.863] (-882.732) (-882.906) (-883.547) * (-884.028) [-885.283] (-884.398) (-884.035) -- 0:01:06
      83000 -- [-884.266] (-886.253) (-884.995) (-885.737) * (-884.200) (-884.807) [-886.931] (-884.419) -- 0:01:06
      83500 -- (-888.643) (-886.856) (-884.688) [-884.206] * (-886.866) (-891.436) (-888.053) [-885.058] -- 0:01:05
      84000 -- (-885.141) (-886.118) [-883.939] (-886.234) * [-884.028] (-883.226) (-883.810) (-882.270) -- 0:01:05
      84500 -- [-883.513] (-883.100) (-885.497) (-884.412) * [-883.399] (-883.671) (-885.004) (-884.534) -- 0:01:05
      85000 -- (-884.769) (-884.588) [-883.491] (-884.639) * [-884.876] (-885.037) (-885.158) (-884.161) -- 0:01:04

      Average standard deviation of split frequencies: 0.028973

      85500 -- (-885.200) [-884.680] (-885.134) (-883.326) * [-885.008] (-884.291) (-883.235) (-885.623) -- 0:01:04
      86000 -- (-885.303) [-883.809] (-884.581) (-884.575) * (-884.325) [-884.535] (-883.233) (-884.252) -- 0:01:03
      86500 -- (-887.269) (-883.472) (-885.864) [-884.446] * (-885.023) [-883.690] (-886.850) (-884.651) -- 0:01:03
      87000 -- (-885.366) (-884.454) (-883.777) [-885.203] * (-883.956) [-883.251] (-885.450) (-884.034) -- 0:01:02
      87500 -- [-884.699] (-883.589) (-885.919) (-885.068) * (-888.807) (-884.056) (-884.584) [-886.247] -- 0:01:02
      88000 -- (-884.911) (-884.864) [-884.630] (-885.581) * (-884.852) [-883.950] (-884.850) (-884.137) -- 0:01:02
      88500 -- (-887.514) (-883.310) [-884.781] (-885.226) * (-885.002) [-884.527] (-885.703) (-884.133) -- 0:01:01
      89000 -- (-885.286) (-887.312) (-884.048) [-886.311] * [-884.404] (-885.239) (-889.353) (-884.756) -- 0:01:01
      89500 -- (-884.192) (-884.422) (-886.288) [-884.141] * (-883.346) [-883.320] (-888.205) (-883.636) -- 0:01:01
      90000 -- (-883.014) [-888.138] (-890.042) (-884.275) * (-882.752) [-883.109] (-885.319) (-883.285) -- 0:01:00

      Average standard deviation of split frequencies: 0.025501

      90500 -- (-885.586) (-885.245) (-883.441) [-883.887] * (-883.729) (-885.407) [-886.006] (-884.092) -- 0:01:00
      91000 -- (-887.736) (-885.428) (-883.367) [-887.038] * (-882.725) (-884.581) [-886.065] (-883.096) -- 0:00:59
      91500 -- (-884.800) (-884.768) (-883.158) [-885.395] * (-883.516) (-885.022) (-883.357) [-883.272] -- 0:00:59
      92000 -- (-885.464) [-882.927] (-884.089) (-883.606) * (-884.043) [-883.754] (-886.806) (-884.808) -- 0:00:59
      92500 -- (-892.664) (-883.301) (-883.851) [-883.548] * (-887.092) [-883.749] (-886.478) (-883.537) -- 0:00:58
      93000 -- (-887.033) (-886.441) (-883.201) [-883.775] * [-884.419] (-883.422) (-884.948) (-886.535) -- 0:00:58
      93500 -- (-887.201) (-886.274) (-884.013) [-882.999] * (-888.003) (-884.174) (-884.678) [-882.970] -- 0:00:58
      94000 -- (-885.960) (-885.193) (-885.300) [-883.364] * (-888.373) (-883.687) [-885.740] (-885.584) -- 0:00:57
      94500 -- (-887.281) (-884.124) [-883.597] (-884.072) * (-885.709) [-886.012] (-884.104) (-884.404) -- 0:00:57
      95000 -- [-884.328] (-886.335) (-889.173) (-883.601) * (-883.422) (-885.391) [-883.431] (-883.763) -- 0:00:57

      Average standard deviation of split frequencies: 0.025668

      95500 -- [-884.165] (-886.700) (-888.265) (-883.864) * (-885.450) (-886.431) (-886.689) [-883.479] -- 0:00:56
      96000 -- (-883.424) (-886.424) [-883.416] (-883.730) * (-885.645) [-883.932] (-885.566) (-883.816) -- 0:00:56
      96500 -- (-885.970) (-885.753) (-884.583) [-883.576] * (-883.363) (-885.584) (-883.667) [-885.748] -- 0:00:56
      97000 -- (-887.431) [-885.416] (-884.574) (-885.806) * (-884.394) (-884.626) [-883.840] (-885.269) -- 0:01:05
      97500 -- (-882.775) (-883.587) [-883.325] (-883.758) * [-884.162] (-884.827) (-884.502) (-889.933) -- 0:01:04
      98000 -- (-882.631) [-883.660] (-883.721) (-883.908) * (-884.354) (-886.087) (-883.486) [-885.771] -- 0:01:04
      98500 -- [-882.930] (-882.859) (-884.616) (-883.038) * (-886.753) (-884.378) [-885.276] (-885.226) -- 0:01:04
      99000 -- (-884.946) (-887.865) (-882.344) [-883.171] * (-884.582) (-886.023) (-883.033) [-883.212] -- 0:01:03
      99500 -- [-887.566] (-884.325) (-884.122) (-884.943) * [-883.267] (-883.179) (-883.587) (-885.668) -- 0:01:03
      100000 -- (-884.893) (-884.666) [-885.807] (-882.894) * (-884.949) [-885.254] (-885.568) (-887.827) -- 0:01:02

      Average standard deviation of split frequencies: 0.025386

      100500 -- (-884.591) [-883.102] (-885.008) (-883.475) * (-884.727) (-886.088) (-883.224) [-884.547] -- 0:01:02
      101000 -- (-887.213) [-884.677] (-889.677) (-888.766) * (-886.603) (-884.608) [-883.491] (-884.626) -- 0:01:02
      101500 -- (-884.267) (-882.936) (-890.834) [-884.239] * (-890.641) [-885.975] (-886.376) (-883.815) -- 0:01:01
      102000 -- (-886.972) (-886.199) (-888.753) [-882.970] * (-895.013) (-883.247) [-884.457] (-886.120) -- 0:01:01
      102500 -- (-885.745) (-883.112) (-883.995) [-885.288] * [-893.084] (-885.386) (-884.793) (-883.822) -- 0:01:01
      103000 -- (-886.218) [-884.128] (-883.354) (-884.983) * (-890.520) (-884.610) (-884.217) [-882.423] -- 0:01:00
      103500 -- (-884.451) [-882.841] (-885.301) (-882.557) * [-887.030] (-885.467) (-883.973) (-885.554) -- 0:01:00
      104000 -- (-885.270) (-883.608) (-882.701) [-884.853] * (-884.051) (-888.027) (-883.885) [-884.299] -- 0:01:00
      104500 -- (-883.830) (-884.335) (-883.768) [-884.117] * (-886.182) [-883.385] (-884.068) (-885.816) -- 0:00:59
      105000 -- (-883.422) (-885.864) [-883.273] (-882.981) * (-885.619) (-883.935) (-882.802) [-883.821] -- 0:00:59

      Average standard deviation of split frequencies: 0.024055

      105500 -- (-883.960) (-886.887) [-882.991] (-885.976) * (-887.869) [-883.370] (-884.991) (-882.428) -- 0:00:59
      106000 -- (-884.649) (-884.425) [-882.781] (-882.734) * (-886.413) (-885.498) (-885.481) [-886.366] -- 0:00:59
      106500 -- (-886.423) [-886.091] (-882.550) (-882.874) * (-885.438) [-885.811] (-884.011) (-883.151) -- 0:00:58
      107000 -- (-887.607) (-885.344) [-883.846] (-884.593) * (-883.565) (-888.622) (-885.561) [-884.511] -- 0:00:58
      107500 -- [-884.535] (-889.617) (-883.519) (-885.161) * (-884.213) (-884.293) (-882.612) [-885.395] -- 0:00:58
      108000 -- (-888.909) [-892.008] (-884.171) (-883.643) * [-885.189] (-884.224) (-883.739) (-883.375) -- 0:00:57
      108500 -- (-886.366) [-887.075] (-886.334) (-883.285) * (-887.131) (-887.094) (-884.712) [-883.861] -- 0:00:57
      109000 -- (-888.303) (-884.891) [-882.421] (-884.256) * (-891.728) (-884.306) [-884.927] (-883.151) -- 0:00:57
      109500 -- (-884.372) (-884.671) (-884.925) [-884.398] * (-886.762) (-882.853) (-882.635) [-883.513] -- 0:00:56
      110000 -- [-883.217] (-884.202) (-883.133) (-884.300) * (-886.220) (-886.567) [-886.783] (-888.351) -- 0:00:56

      Average standard deviation of split frequencies: 0.023732

      110500 -- (-886.239) [-883.646] (-883.608) (-884.972) * (-887.371) [-883.341] (-885.288) (-886.130) -- 0:00:56
      111000 -- (-883.129) (-885.400) (-882.570) [-882.878] * (-886.872) [-883.412] (-885.139) (-885.479) -- 0:00:56
      111500 -- (-884.895) [-883.794] (-884.254) (-882.679) * (-884.518) [-884.082] (-885.867) (-884.106) -- 0:00:55
      112000 -- [-883.462] (-884.428) (-884.686) (-882.680) * (-885.304) (-885.268) [-885.368] (-885.809) -- 0:00:55
      112500 -- (-884.480) (-884.143) (-883.387) [-884.926] * (-885.211) (-883.414) (-886.311) [-884.429] -- 0:00:55
      113000 -- [-884.731] (-887.648) (-884.757) (-883.161) * [-883.110] (-884.500) (-884.662) (-882.654) -- 0:00:54
      113500 -- [-884.132] (-884.319) (-883.640) (-885.389) * (-884.051) (-886.358) (-886.244) [-883.541] -- 0:01:02
      114000 -- (-883.061) (-882.967) (-886.176) [-883.594] * (-884.335) [-885.292] (-885.396) (-889.728) -- 0:01:02
      114500 -- (-884.261) (-885.179) [-885.604] (-883.004) * [-885.684] (-884.717) (-887.533) (-888.034) -- 0:01:01
      115000 -- (-883.402) (-886.204) [-884.213] (-883.214) * [-886.821] (-884.266) (-883.635) (-887.220) -- 0:01:01

      Average standard deviation of split frequencies: 0.023415

      115500 -- (-883.175) (-884.594) [-886.548] (-885.018) * (-884.991) (-884.011) (-888.692) [-887.471] -- 0:01:01
      116000 -- (-884.374) [-885.668] (-883.578) (-889.462) * (-886.671) (-883.608) (-883.223) [-884.911] -- 0:01:00
      116500 -- (-884.241) (-885.851) (-886.547) [-885.908] * [-883.319] (-883.317) (-884.207) (-889.071) -- 0:01:00
      117000 -- (-884.325) (-884.653) (-886.088) [-883.728] * [-884.196] (-884.910) (-883.419) (-885.143) -- 0:01:00
      117500 -- [-886.854] (-884.297) (-883.138) (-884.953) * (-884.941) (-882.343) [-883.593] (-889.369) -- 0:01:00
      118000 -- (-885.640) [-883.386] (-885.750) (-891.041) * [-884.393] (-883.883) (-884.537) (-887.945) -- 0:00:59
      118500 -- (-883.813) (-885.447) (-886.228) [-886.342] * [-883.670] (-885.483) (-884.736) (-884.490) -- 0:00:59
      119000 -- (-884.112) [-884.589] (-885.091) (-884.372) * [-883.665] (-886.329) (-886.992) (-883.756) -- 0:00:59
      119500 -- (-887.541) [-886.958] (-886.729) (-886.079) * (-883.366) (-883.945) [-885.606] (-883.272) -- 0:00:58
      120000 -- (-887.153) (-885.094) (-883.318) [-882.688] * (-887.602) (-882.796) (-885.438) [-883.379] -- 0:00:58

      Average standard deviation of split frequencies: 0.022324

      120500 -- (-882.310) (-883.814) [-883.103] (-884.248) * (-884.065) (-885.624) (-886.050) [-883.844] -- 0:00:58
      121000 -- (-893.557) (-886.114) (-885.959) [-882.807] * (-884.130) (-884.466) [-885.344] (-885.907) -- 0:00:58
      121500 -- [-886.396] (-883.571) (-886.954) (-882.963) * (-886.196) [-883.218] (-884.446) (-886.135) -- 0:00:57
      122000 -- (-884.154) [-885.224] (-886.263) (-882.965) * [-884.343] (-884.315) (-883.581) (-883.902) -- 0:00:57
      122500 -- (-884.235) (-883.580) (-885.197) [-883.776] * (-883.864) [-883.766] (-883.136) (-889.807) -- 0:00:57
      123000 -- (-886.730) (-885.576) [-884.987] (-884.264) * (-882.866) (-884.702) (-883.101) [-885.605] -- 0:00:57
      123500 -- (-885.896) (-883.835) [-883.666] (-886.314) * (-885.423) (-891.065) (-882.959) [-885.702] -- 0:00:56
      124000 -- (-888.689) (-885.577) [-883.907] (-883.305) * (-885.067) (-884.886) (-885.369) [-882.427] -- 0:00:56
      124500 -- [-883.335] (-883.048) (-883.160) (-882.311) * [-886.115] (-885.774) (-886.452) (-882.721) -- 0:00:56
      125000 -- [-884.392] (-885.306) (-886.380) (-890.925) * (-883.543) (-886.139) [-883.914] (-885.382) -- 0:00:56

      Average standard deviation of split frequencies: 0.021427

      125500 -- (-884.605) (-884.117) (-887.618) [-884.189] * (-884.645) (-882.942) [-883.148] (-883.137) -- 0:00:55
      126000 -- (-886.935) [-889.097] (-885.425) (-884.170) * (-884.025) (-883.179) (-885.519) [-886.529] -- 0:00:55
      126500 -- (-883.603) (-884.518) [-887.484] (-887.691) * (-883.420) (-882.894) [-882.636] (-890.060) -- 0:00:55
      127000 -- [-887.557] (-885.991) (-884.884) (-883.654) * (-885.396) (-882.891) (-886.546) [-887.347] -- 0:00:54
      127500 -- [-883.109] (-884.954) (-883.413) (-883.429) * (-884.334) [-884.974] (-884.177) (-886.908) -- 0:00:54
      128000 -- (-883.973) (-887.481) [-883.540] (-884.957) * (-886.057) (-884.833) [-885.610] (-887.341) -- 0:00:54
      128500 -- (-884.669) (-884.162) (-883.341) [-887.297] * [-884.492] (-886.062) (-883.186) (-883.179) -- 0:00:54
      129000 -- (-888.217) (-887.696) (-887.450) [-886.142] * [-884.554] (-884.373) (-887.913) (-886.110) -- 0:00:54
      129500 -- (-886.998) [-885.456] (-884.012) (-889.087) * [-884.995] (-886.954) (-893.019) (-888.070) -- 0:00:53
      130000 -- [-888.112] (-885.561) (-883.703) (-889.725) * [-887.241] (-884.356) (-884.880) (-884.374) -- 0:00:53

      Average standard deviation of split frequencies: 0.021646

      130500 -- (-883.080) (-883.794) [-890.597] (-889.580) * [-887.959] (-885.755) (-883.035) (-883.884) -- 0:00:59
      131000 -- (-884.566) (-884.893) [-889.950] (-883.835) * (-884.276) [-886.108] (-884.546) (-884.468) -- 0:00:59
      131500 -- [-885.936] (-887.149) (-884.577) (-885.844) * (-887.828) (-889.476) (-883.434) [-883.484] -- 0:00:59
      132000 -- (-884.557) (-884.005) [-884.213] (-882.624) * (-886.296) [-887.173] (-889.112) (-883.007) -- 0:00:59
      132500 -- (-884.028) [-884.502] (-883.759) (-885.792) * (-882.609) [-885.571] (-889.442) (-884.947) -- 0:00:58
      133000 -- (-884.632) (-884.223) (-885.019) [-883.493] * (-882.375) (-884.879) [-889.197] (-884.305) -- 0:00:58
      133500 -- (-886.446) (-889.581) [-884.503] (-884.266) * [-882.975] (-886.806) (-888.281) (-883.937) -- 0:00:58
      134000 -- (-884.433) (-892.786) [-885.619] (-887.270) * (-882.738) [-890.085] (-885.285) (-883.586) -- 0:00:58
      134500 -- (-883.715) (-885.713) (-888.499) [-885.160] * [-884.878] (-887.800) (-885.394) (-884.237) -- 0:00:57
      135000 -- [-885.751] (-888.815) (-883.930) (-884.180) * [-886.860] (-887.971) (-886.527) (-887.725) -- 0:00:57

      Average standard deviation of split frequencies: 0.019064

      135500 -- [-890.062] (-883.968) (-885.401) (-884.430) * (-887.954) (-887.571) (-884.470) [-883.652] -- 0:00:57
      136000 -- [-883.842] (-885.629) (-883.384) (-885.990) * [-885.164] (-886.497) (-889.287) (-883.672) -- 0:00:57
      136500 -- [-884.455] (-882.993) (-883.775) (-885.130) * (-885.967) [-884.665] (-884.140) (-883.774) -- 0:00:56
      137000 -- (-883.408) [-882.288] (-884.596) (-884.948) * [-883.421] (-885.232) (-882.923) (-886.256) -- 0:00:56
      137500 -- [-882.759] (-883.338) (-889.367) (-884.136) * (-884.184) (-886.582) (-884.864) [-886.543] -- 0:00:56
      138000 -- (-882.380) [-883.705] (-893.031) (-884.756) * (-884.004) (-885.188) [-886.733] (-885.888) -- 0:00:56
      138500 -- (-883.207) [-883.910] (-886.415) (-887.784) * (-882.604) [-887.300] (-886.183) (-885.803) -- 0:00:55
      139000 -- (-883.495) (-883.825) [-886.430] (-884.562) * (-883.889) (-884.261) [-886.247] (-886.268) -- 0:00:55
      139500 -- (-883.348) (-888.815) [-883.479] (-883.784) * [-883.261] (-884.295) (-889.643) (-886.050) -- 0:00:55
      140000 -- [-886.299] (-885.926) (-884.561) (-883.502) * [-883.746] (-884.602) (-883.097) (-887.180) -- 0:00:55

      Average standard deviation of split frequencies: 0.019225

      140500 -- [-883.671] (-885.816) (-884.405) (-884.388) * (-883.527) [-884.906] (-883.612) (-885.132) -- 0:00:55
      141000 -- (-883.201) [-883.404] (-884.626) (-882.763) * (-883.626) (-885.563) [-883.183] (-884.732) -- 0:00:54
      141500 -- [-884.611] (-882.562) (-884.045) (-883.566) * (-884.941) (-884.062) (-882.900) [-884.168] -- 0:00:54
      142000 -- (-884.036) [-884.471] (-886.407) (-886.254) * (-884.793) (-882.796) (-883.532) [-884.571] -- 0:00:54
      142500 -- (-885.117) [-884.648] (-886.874) (-887.046) * (-886.441) (-884.074) (-883.705) [-882.869] -- 0:00:54
      143000 -- (-883.841) [-887.133] (-886.327) (-888.918) * (-884.424) (-884.258) [-884.134] (-884.786) -- 0:00:53
      143500 -- (-883.672) (-884.199) [-888.333] (-886.546) * (-882.821) (-882.555) [-884.744] (-885.303) -- 0:00:53
      144000 -- [-883.911] (-886.529) (-890.220) (-886.422) * [-884.053] (-882.519) (-884.230) (-886.429) -- 0:00:53
      144500 -- [-883.484] (-886.048) (-886.478) (-885.680) * (-884.567) (-886.757) (-887.272) [-883.328] -- 0:00:53
      145000 -- (-883.609) [-884.934] (-885.467) (-884.439) * (-885.763) [-884.686] (-886.319) (-883.113) -- 0:00:53

      Average standard deviation of split frequencies: 0.018052

      145500 -- (-885.789) (-884.543) [-885.654] (-885.027) * [-884.097] (-883.436) (-886.115) (-885.239) -- 0:00:52
      146000 -- [-885.028] (-885.182) (-884.028) (-882.953) * (-887.779) (-883.892) [-886.505] (-884.415) -- 0:00:52
      146500 -- (-883.661) (-885.799) (-884.066) [-886.497] * (-882.520) [-888.791] (-888.138) (-886.174) -- 0:00:52
      147000 -- (-886.504) (-885.059) (-887.329) [-883.554] * [-885.661] (-887.570) (-889.373) (-884.685) -- 0:00:58
      147500 -- (-883.691) (-882.616) [-884.340] (-886.661) * [-884.735] (-885.899) (-891.371) (-885.145) -- 0:00:57
      148000 -- (-885.822) [-884.704] (-888.879) (-886.966) * (-892.342) [-885.920] (-889.905) (-886.740) -- 0:00:57
      148500 -- (-884.026) (-883.993) [-884.096] (-885.609) * (-886.136) [-884.505] (-885.577) (-885.039) -- 0:00:57
      149000 -- (-883.583) (-885.566) [-883.188] (-888.436) * (-883.543) (-885.406) (-886.121) [-886.286] -- 0:00:57
      149500 -- (-883.388) (-887.629) (-883.208) [-889.215] * (-883.845) [-885.524] (-883.422) (-891.378) -- 0:00:56
      150000 -- (-884.131) [-884.505] (-883.618) (-883.503) * (-883.843) [-884.374] (-883.693) (-884.458) -- 0:00:56

      Average standard deviation of split frequencies: 0.018028

      150500 -- [-883.558] (-882.943) (-883.579) (-884.670) * [-884.827] (-884.109) (-883.173) (-884.366) -- 0:00:56
      151000 -- (-883.411) (-889.802) (-884.236) [-883.474] * (-891.637) [-884.339] (-882.870) (-884.370) -- 0:00:56
      151500 -- [-882.865] (-887.180) (-882.853) (-883.701) * [-889.166] (-884.287) (-885.324) (-885.578) -- 0:00:56
      152000 -- (-883.149) [-884.948] (-883.153) (-886.072) * (-886.253) [-885.890] (-884.863) (-885.190) -- 0:00:55
      152500 -- [-883.439] (-882.805) (-884.074) (-883.762) * (-884.339) (-884.203) (-884.608) [-886.200] -- 0:00:55
      153000 -- [-884.438] (-884.121) (-884.786) (-883.557) * (-885.825) [-882.774] (-885.214) (-883.521) -- 0:00:55
      153500 -- (-885.227) (-886.683) [-884.588] (-884.518) * (-884.064) (-884.215) (-884.902) [-883.028] -- 0:00:55
      154000 -- [-886.467] (-888.628) (-883.021) (-884.926) * [-884.861] (-885.120) (-883.638) (-883.635) -- 0:00:54
      154500 -- (-886.363) (-886.610) [-885.667] (-890.716) * [-886.115] (-883.148) (-888.805) (-888.345) -- 0:00:54
      155000 -- (-886.168) [-884.381] (-887.443) (-889.932) * (-884.980) [-882.323] (-893.371) (-884.777) -- 0:00:54

      Average standard deviation of split frequencies: 0.016318

      155500 -- (-888.570) (-883.891) (-882.755) [-886.709] * (-889.528) (-883.243) (-885.977) [-884.842] -- 0:00:54
      156000 -- (-886.494) [-889.149] (-883.158) (-890.199) * [-885.750] (-882.733) (-884.459) (-883.663) -- 0:00:54
      156500 -- (-883.406) [-884.323] (-883.517) (-884.419) * (-884.063) (-888.450) (-884.748) [-883.272] -- 0:00:53
      157000 -- (-887.965) [-885.336] (-884.945) (-883.246) * (-883.931) (-888.540) [-883.387] (-884.814) -- 0:00:53
      157500 -- (-884.665) [-882.780] (-884.928) (-884.769) * (-882.765) [-887.145] (-884.764) (-884.837) -- 0:00:53
      158000 -- (-884.029) (-885.829) (-883.435) [-885.589] * (-882.647) (-885.408) [-884.031] (-883.175) -- 0:00:53
      158500 -- (-885.655) (-889.913) [-883.739] (-886.282) * (-883.897) (-883.117) [-884.881] (-890.089) -- 0:00:53
      159000 -- (-886.406) (-894.867) [-883.003] (-882.606) * [-886.699] (-882.626) (-886.484) (-889.396) -- 0:00:52
      159500 -- (-886.857) (-888.172) [-884.448] (-882.835) * [-886.265] (-882.273) (-883.005) (-888.596) -- 0:00:52
      160000 -- (-887.271) (-886.050) [-883.763] (-882.837) * (-887.211) [-885.838] (-888.190) (-888.989) -- 0:00:52

      Average standard deviation of split frequencies: 0.017767

      160500 -- (-886.226) (-884.132) (-886.600) [-883.357] * (-883.319) [-883.569] (-884.563) (-885.684) -- 0:00:52
      161000 -- (-883.892) (-883.539) (-884.306) [-883.712] * (-883.709) [-883.631] (-883.054) (-888.219) -- 0:00:52
      161500 -- (-882.697) (-886.200) (-889.393) [-884.655] * (-884.003) [-884.595] (-883.300) (-886.118) -- 0:00:51
      162000 -- (-884.446) (-888.484) (-887.949) [-883.970] * (-884.529) (-884.204) [-883.319] (-886.194) -- 0:00:51
      162500 -- (-885.699) (-884.151) (-886.581) [-884.980] * [-884.944] (-883.870) (-885.051) (-885.922) -- 0:00:51
      163000 -- (-885.763) [-884.198] (-883.801) (-884.970) * (-884.947) (-883.533) [-883.642] (-888.544) -- 0:00:51
      163500 -- (-885.580) [-884.137] (-885.672) (-886.032) * [-884.666] (-883.468) (-884.609) (-888.701) -- 0:00:56
      164000 -- (-886.216) (-882.630) [-884.987] (-885.409) * [-883.994] (-884.738) (-885.387) (-886.473) -- 0:00:56
      164500 -- (-891.038) (-887.321) (-884.526) [-885.978] * [-884.808] (-882.961) (-884.245) (-882.546) -- 0:00:55
      165000 -- [-886.823] (-884.851) (-883.078) (-884.618) * [-884.083] (-885.591) (-887.749) (-884.033) -- 0:00:55

      Average standard deviation of split frequencies: 0.017181

      165500 -- (-883.092) [-886.954] (-888.112) (-884.081) * (-884.805) (-888.167) (-887.888) [-886.529] -- 0:00:55
      166000 -- [-885.034] (-884.114) (-889.711) (-886.747) * [-883.845] (-886.557) (-887.254) (-884.791) -- 0:00:55
      166500 -- (-887.631) (-884.962) (-886.400) [-884.464] * (-884.508) [-883.227] (-890.344) (-882.733) -- 0:00:55
      167000 -- (-887.516) [-884.475] (-888.244) (-885.750) * [-885.455] (-884.514) (-885.031) (-885.024) -- 0:00:54
      167500 -- (-885.247) (-884.623) (-887.302) [-886.838] * (-883.131) [-887.145] (-885.734) (-885.818) -- 0:00:54
      168000 -- [-884.640] (-882.753) (-883.976) (-884.561) * (-886.456) [-883.714] (-886.880) (-889.894) -- 0:00:54
      168500 -- (-885.507) [-883.407] (-887.065) (-882.622) * (-884.195) (-887.073) [-885.454] (-888.528) -- 0:00:54
      169000 -- (-889.683) (-883.646) [-883.198] (-884.118) * [-886.854] (-885.830) (-884.503) (-883.501) -- 0:00:54
      169500 -- (-884.047) [-883.441] (-885.251) (-884.490) * (-883.247) [-884.804] (-883.973) (-883.644) -- 0:00:53
      170000 -- (-884.742) [-884.111] (-887.176) (-884.268) * (-885.259) [-882.821] (-885.369) (-887.960) -- 0:00:53

      Average standard deviation of split frequencies: 0.018899

      170500 -- (-886.463) (-883.510) [-883.689] (-884.864) * (-885.641) (-884.004) (-884.014) [-883.271] -- 0:00:53
      171000 -- (-886.196) (-884.102) (-883.943) [-883.195] * (-888.863) [-882.684] (-885.204) (-885.389) -- 0:00:53
      171500 -- [-883.443] (-882.707) (-883.009) (-886.349) * (-888.057) [-885.405] (-883.460) (-884.841) -- 0:00:53
      172000 -- (-884.779) [-882.713] (-886.836) (-882.707) * (-884.583) (-886.938) (-883.936) [-883.406] -- 0:00:52
      172500 -- (-883.490) (-884.500) (-884.210) [-883.861] * [-883.933] (-887.498) (-884.168) (-885.697) -- 0:00:52
      173000 -- [-884.802] (-884.113) (-887.460) (-885.185) * (-884.447) (-885.471) [-886.135] (-887.509) -- 0:00:52
      173500 -- [-883.978] (-884.240) (-883.022) (-885.558) * [-883.014] (-883.850) (-882.923) (-888.969) -- 0:00:52
      174000 -- (-887.608) (-884.605) [-887.891] (-888.061) * (-884.620) [-883.865] (-884.427) (-886.047) -- 0:00:52
      174500 -- [-884.851] (-886.250) (-889.683) (-883.982) * [-883.862] (-885.750) (-884.719) (-884.559) -- 0:00:52
      175000 -- [-883.984] (-884.746) (-886.363) (-884.439) * (-883.603) (-887.722) [-883.650] (-885.555) -- 0:00:51

      Average standard deviation of split frequencies: 0.018185

      175500 -- (-882.914) (-885.695) [-885.314] (-885.778) * (-884.790) [-884.935] (-887.636) (-886.661) -- 0:00:51
      176000 -- (-885.008) (-885.660) (-884.599) [-885.850] * (-886.111) [-884.202] (-885.942) (-885.726) -- 0:00:51
      176500 -- [-886.820] (-885.772) (-885.863) (-887.386) * [-885.188] (-883.366) (-882.794) (-888.271) -- 0:00:51
      177000 -- (-883.713) (-882.704) [-887.691] (-885.831) * (-883.141) (-882.615) [-883.155] (-883.282) -- 0:00:51
      177500 -- (-890.241) [-885.250] (-884.398) (-885.808) * (-884.873) (-883.638) [-883.162] (-885.370) -- 0:00:50
      178000 -- [-887.747] (-884.183) (-884.720) (-882.872) * (-885.700) [-883.494] (-883.157) (-889.928) -- 0:00:50
      178500 -- (-884.756) (-882.808) [-883.537] (-883.767) * [-886.463] (-884.159) (-884.326) (-886.494) -- 0:00:50
      179000 -- [-882.754] (-883.822) (-885.991) (-884.500) * (-883.133) (-885.628) [-883.086] (-883.376) -- 0:00:50
      179500 -- (-884.169) [-884.958] (-886.942) (-883.371) * (-884.220) (-884.883) (-884.812) [-883.760] -- 0:00:50
      180000 -- (-884.638) (-884.254) [-884.226] (-892.134) * (-882.644) (-882.708) (-884.011) [-883.982] -- 0:00:54

      Average standard deviation of split frequencies: 0.015930

      180500 -- (-886.350) (-886.123) [-883.063] (-889.184) * (-885.853) (-889.786) (-884.915) [-883.840] -- 0:00:54
      181000 -- [-883.249] (-885.611) (-883.926) (-885.175) * [-886.169] (-886.180) (-886.784) (-883.228) -- 0:00:54
      181500 -- [-887.062] (-884.490) (-884.951) (-888.501) * [-884.238] (-885.304) (-884.408) (-892.016) -- 0:00:54
      182000 -- (-884.560) [-883.724] (-886.023) (-883.912) * [-883.121] (-885.014) (-883.375) (-887.091) -- 0:00:53
      182500 -- (-886.470) (-885.222) (-882.691) [-883.941] * [-887.782] (-882.862) (-884.201) (-883.649) -- 0:00:53
      183000 -- (-884.255) [-885.774] (-883.493) (-883.401) * (-886.790) (-882.897) [-884.028] (-885.047) -- 0:00:53
      183500 -- [-882.969] (-885.791) (-883.653) (-883.148) * (-884.719) (-882.850) [-884.381] (-889.221) -- 0:00:53
      184000 -- (-883.583) (-884.482) (-885.601) [-884.997] * (-883.258) (-884.629) [-885.751] (-884.724) -- 0:00:53
      184500 -- (-884.419) [-883.331] (-885.373) (-885.195) * (-884.835) [-883.956] (-884.114) (-885.837) -- 0:00:53
      185000 -- (-883.919) (-884.829) (-884.055) [-883.432] * [-883.277] (-884.643) (-885.180) (-885.495) -- 0:00:52

      Average standard deviation of split frequencies: 0.015207

      185500 -- (-883.276) (-886.644) (-888.599) [-883.293] * (-887.033) (-885.035) [-883.739] (-883.517) -- 0:00:52
      186000 -- (-882.927) (-885.321) [-887.762] (-885.205) * (-886.216) (-884.957) (-882.443) [-886.080] -- 0:00:52
      186500 -- (-883.773) [-883.347] (-886.309) (-884.321) * (-885.634) [-884.124] (-884.369) (-887.333) -- 0:00:52
      187000 -- (-883.429) (-883.460) [-885.526] (-884.905) * [-884.315] (-884.359) (-884.073) (-884.574) -- 0:00:52
      187500 -- (-884.984) (-883.674) [-886.172] (-883.561) * (-886.034) (-885.694) (-883.909) [-885.133] -- 0:00:52
      188000 -- [-884.086] (-886.025) (-883.733) (-882.581) * (-888.696) (-885.334) [-884.317] (-884.318) -- 0:00:51
      188500 -- (-884.465) [-884.111] (-883.022) (-884.972) * (-885.494) [-885.564] (-884.004) (-886.144) -- 0:00:51
      189000 -- (-885.706) (-884.687) (-885.296) [-884.846] * (-884.779) (-886.039) [-882.732] (-884.579) -- 0:00:51
      189500 -- (-884.657) (-885.840) (-883.294) [-884.943] * [-882.997] (-886.698) (-882.959) (-882.601) -- 0:00:51
      190000 -- (-887.848) [-883.358] (-884.385) (-884.976) * (-885.267) (-883.145) [-884.488] (-884.334) -- 0:00:51

      Average standard deviation of split frequencies: 0.016483

      190500 -- (-886.871) (-884.034) (-885.350) [-883.539] * [-883.569] (-883.780) (-884.304) (-884.221) -- 0:00:50
      191000 -- [-887.351] (-884.411) (-886.630) (-883.942) * (-884.675) (-883.874) [-884.244] (-884.313) -- 0:00:50
      191500 -- (-887.961) [-884.702] (-885.931) (-886.156) * (-883.619) (-883.963) [-885.073] (-886.260) -- 0:00:50
      192000 -- (-886.157) [-887.577] (-884.395) (-887.044) * (-883.546) [-886.624] (-883.399) (-886.556) -- 0:00:50
      192500 -- [-884.408] (-889.704) (-885.710) (-883.123) * [-884.226] (-885.290) (-883.505) (-884.197) -- 0:00:50
      193000 -- (-883.786) (-883.811) [-883.486] (-884.415) * (-886.353) (-886.510) [-883.941] (-882.427) -- 0:00:50
      193500 -- (-886.067) (-884.038) (-884.892) [-882.885] * [-884.971] (-886.049) (-885.892) (-882.913) -- 0:00:50
      194000 -- (-882.746) (-883.571) (-886.299) [-883.021] * (-884.510) (-886.360) [-883.266] (-890.493) -- 0:00:49
      194500 -- (-885.413) (-886.369) [-885.536] (-883.157) * (-884.341) (-886.017) [-883.505] (-884.278) -- 0:00:49
      195000 -- (-885.770) (-886.263) (-885.977) [-886.434] * (-883.174) (-887.070) (-883.278) [-883.040] -- 0:00:49

      Average standard deviation of split frequencies: 0.014811

      195500 -- (-883.424) (-884.856) (-884.679) [-883.593] * (-884.244) (-885.981) [-883.177] (-886.793) -- 0:00:49
      196000 -- (-883.296) (-882.865) [-886.522] (-884.049) * (-882.638) (-885.407) [-885.738] (-884.397) -- 0:00:49
      196500 -- (-883.107) (-884.144) [-886.220] (-886.103) * (-884.759) [-885.070] (-888.191) (-884.348) -- 0:00:49
      197000 -- (-888.840) [-885.154] (-887.668) (-884.987) * (-884.143) (-884.316) (-884.197) [-884.031] -- 0:00:52
      197500 -- (-887.349) (-885.837) [-888.071] (-887.605) * [-882.521] (-886.249) (-885.707) (-884.738) -- 0:00:52
      198000 -- (-885.949) (-884.984) (-885.288) [-882.881] * [-882.799] (-885.676) (-887.343) (-883.671) -- 0:00:52
      198500 -- (-883.748) [-883.487] (-883.662) (-884.279) * (-882.820) (-884.937) (-888.686) [-883.709] -- 0:00:52
      199000 -- (-883.322) [-883.689] (-886.226) (-884.822) * [-884.403] (-887.315) (-887.886) (-885.641) -- 0:00:52
      199500 -- [-884.262] (-883.617) (-885.563) (-883.707) * (-885.561) (-885.040) (-884.694) [-885.675] -- 0:00:52
      200000 -- [-884.279] (-885.509) (-883.711) (-883.929) * (-887.180) [-884.397] (-884.698) (-882.520) -- 0:00:51

      Average standard deviation of split frequencies: 0.014219

      200500 -- (-883.677) [-884.745] (-887.266) (-883.636) * (-885.983) (-884.240) (-886.288) [-883.750] -- 0:00:51
      201000 -- [-882.392] (-887.863) (-886.192) (-887.952) * [-886.247] (-883.498) (-886.084) (-883.593) -- 0:00:51
      201500 -- (-882.569) (-889.856) (-886.615) [-883.307] * (-883.356) (-883.299) (-885.694) [-883.369] -- 0:00:51
      202000 -- (-884.612) [-887.669] (-885.133) (-883.780) * (-885.671) (-882.896) [-886.313] (-886.492) -- 0:00:51
      202500 -- (-885.046) [-883.837] (-883.019) (-883.439) * (-884.558) [-882.646] (-885.759) (-884.360) -- 0:00:51
      203000 -- (-884.229) (-886.454) [-883.975] (-883.677) * (-882.813) (-883.358) (-883.893) [-885.407] -- 0:00:51
      203500 -- (-884.112) (-885.839) (-888.323) [-884.624] * [-883.095] (-883.233) (-883.514) (-885.420) -- 0:00:50
      204000 -- (-883.195) (-885.674) (-882.686) [-884.987] * [-884.415] (-883.929) (-883.984) (-883.953) -- 0:00:50
      204500 -- [-883.248] (-886.521) (-883.803) (-885.857) * (-883.780) (-883.290) [-884.019] (-883.746) -- 0:00:50
      205000 -- [-885.843] (-883.719) (-886.810) (-890.070) * (-883.720) (-884.803) [-883.647] (-883.924) -- 0:00:50

      Average standard deviation of split frequencies: 0.014989

      205500 -- (-884.324) [-883.785] (-888.144) (-889.087) * (-890.597) (-884.268) [-884.914] (-888.160) -- 0:00:50
      206000 -- (-885.974) (-884.334) (-885.123) [-883.694] * (-888.423) (-883.215) (-884.840) [-887.445] -- 0:00:50
      206500 -- (-885.413) [-883.140] (-885.367) (-889.649) * [-886.033] (-884.624) (-883.816) (-890.015) -- 0:00:49
      207000 -- (-885.119) (-882.887) [-883.582] (-888.146) * [-885.916] (-890.485) (-883.590) (-886.277) -- 0:00:49
      207500 -- (-884.740) (-884.649) (-888.031) [-883.736] * [-884.781] (-892.244) (-885.904) (-883.764) -- 0:00:49
      208000 -- (-888.124) (-884.649) [-883.223] (-883.416) * (-885.918) (-889.049) (-887.514) [-886.750] -- 0:00:49
      208500 -- (-888.890) (-885.204) [-882.312] (-883.559) * (-883.034) (-888.238) (-886.649) [-884.140] -- 0:00:49
      209000 -- [-885.611] (-885.193) (-884.039) (-884.915) * [-884.235] (-886.713) (-887.848) (-882.643) -- 0:00:49
      209500 -- (-886.825) (-885.753) [-883.665] (-887.149) * (-882.690) (-884.327) (-884.254) [-884.000] -- 0:00:49
      210000 -- [-882.697] (-884.584) (-888.457) (-886.257) * (-883.532) (-882.567) [-883.833] (-883.442) -- 0:00:48

      Average standard deviation of split frequencies: 0.014918

      210500 -- (-884.265) (-884.602) [-882.993] (-886.317) * [-882.727] (-883.549) (-884.485) (-884.011) -- 0:00:48
      211000 -- (-884.184) (-883.074) (-885.676) [-885.422] * [-884.849] (-883.897) (-884.228) (-885.715) -- 0:00:48
      211500 -- (-883.800) (-883.020) [-884.643] (-883.647) * [-883.686] (-882.840) (-884.049) (-884.700) -- 0:00:48
      212000 -- (-883.040) [-887.859] (-882.738) (-883.303) * (-883.433) [-882.997] (-884.327) (-885.123) -- 0:00:48
      212500 -- [-884.155] (-886.513) (-889.980) (-884.659) * (-884.615) (-882.858) [-885.356] (-883.593) -- 0:00:48
      213000 -- (-884.036) (-885.112) (-885.842) [-883.935] * (-885.371) (-882.891) [-884.812] (-886.367) -- 0:00:48
      213500 -- (-883.857) (-885.713) (-884.252) [-883.803] * (-885.931) (-883.541) (-886.769) [-883.752] -- 0:00:47
      214000 -- (-883.295) (-885.997) (-885.009) [-882.610] * (-882.892) (-883.629) [-884.657] (-884.116) -- 0:00:51
      214500 -- (-884.474) (-885.537) [-883.691] (-883.868) * (-883.639) (-885.770) [-885.764] (-882.459) -- 0:00:51
      215000 -- (-883.544) [-884.362] (-884.730) (-883.124) * (-883.008) (-884.309) [-885.440] (-884.516) -- 0:00:51

      Average standard deviation of split frequencies: 0.015277

      215500 -- (-882.402) (-886.285) (-884.952) [-883.049] * (-889.353) [-882.348] (-884.131) (-883.741) -- 0:00:50
      216000 -- (-882.324) (-885.273) (-883.520) [-883.355] * (-887.250) (-883.010) (-884.154) [-885.535] -- 0:00:50
      216500 -- (-883.272) (-886.246) [-884.099] (-883.341) * (-891.298) (-884.505) (-884.639) [-883.889] -- 0:00:50
      217000 -- (-883.280) [-883.365] (-883.923) (-883.693) * (-891.917) (-884.217) [-883.749] (-885.820) -- 0:00:50
      217500 -- (-883.727) (-884.855) (-883.872) [-885.810] * (-888.229) [-883.938] (-883.701) (-885.812) -- 0:00:50
      218000 -- (-882.490) [-883.818] (-883.494) (-886.671) * (-885.570) (-884.180) (-883.970) [-887.041] -- 0:00:50
      218500 -- (-882.828) (-884.033) (-887.550) [-884.340] * (-884.398) [-886.371] (-884.556) (-885.127) -- 0:00:50
      219000 -- (-884.305) (-885.325) [-885.215] (-883.832) * (-891.927) [-884.673] (-884.697) (-883.775) -- 0:00:49
      219500 -- (-884.246) (-885.388) [-882.495] (-885.417) * (-887.720) [-884.789] (-883.864) (-886.105) -- 0:00:49
      220000 -- (-884.233) (-882.802) (-882.646) [-882.538] * (-887.019) (-887.748) [-884.291] (-884.194) -- 0:00:49

      Average standard deviation of split frequencies: 0.014954

      220500 -- [-887.311] (-882.302) (-882.749) (-883.721) * (-888.400) [-884.796] (-883.242) (-891.063) -- 0:00:49
      221000 -- (-885.848) (-887.029) [-883.904] (-884.836) * (-884.201) (-884.879) (-885.638) [-883.618] -- 0:00:49
      221500 -- (-885.699) (-884.999) (-886.057) [-886.599] * (-887.672) (-882.438) (-883.451) [-883.554] -- 0:00:49
      222000 -- (-885.254) (-885.409) (-888.022) [-885.354] * (-884.487) [-882.515] (-885.934) (-883.110) -- 0:00:49
      222500 -- [-883.777] (-885.703) (-886.403) (-886.922) * (-884.891) [-882.713] (-886.963) (-884.579) -- 0:00:48
      223000 -- (-886.193) (-885.050) (-883.599) [-886.064] * (-885.817) (-882.731) (-888.069) [-883.916] -- 0:00:48
      223500 -- (-883.863) (-885.107) (-884.232) [-884.699] * (-885.103) (-884.162) (-885.258) [-884.933] -- 0:00:48
      224000 -- [-886.691] (-883.070) (-885.811) (-891.961) * [-885.894] (-886.931) (-885.901) (-883.982) -- 0:00:48
      224500 -- (-889.641) [-882.841] (-884.460) (-884.712) * (-885.628) (-890.536) [-886.984] (-889.157) -- 0:00:48
      225000 -- (-886.012) (-888.556) [-884.303] (-884.400) * [-882.795] (-882.964) (-885.203) (-886.888) -- 0:00:48

      Average standard deviation of split frequencies: 0.014288

      225500 -- (-885.691) [-885.473] (-885.393) (-885.564) * (-882.511) (-885.266) [-888.341] (-884.694) -- 0:00:48
      226000 -- (-882.851) (-887.979) [-884.847] (-887.944) * (-882.420) (-882.957) (-884.272) [-885.171] -- 0:00:47
      226500 -- (-886.267) (-883.773) [-884.650] (-885.218) * (-882.408) (-884.660) [-884.575] (-884.213) -- 0:00:47
      227000 -- (-887.326) (-884.624) [-884.608] (-886.137) * (-885.846) [-884.187] (-884.379) (-885.782) -- 0:00:47
      227500 -- (-883.283) [-885.936] (-885.171) (-883.529) * (-884.238) [-883.796] (-884.448) (-884.977) -- 0:00:47
      228000 -- (-887.649) (-883.925) (-884.163) [-884.938] * [-883.524] (-882.630) (-884.421) (-885.026) -- 0:00:47
      228500 -- (-887.958) [-883.641] (-885.793) (-884.294) * (-883.902) (-885.081) [-885.718] (-883.836) -- 0:00:47
      229000 -- (-889.133) [-884.001] (-886.046) (-884.053) * (-884.235) [-885.138] (-884.039) (-888.457) -- 0:00:47
      229500 -- (-889.272) [-884.691] (-885.394) (-883.377) * [-887.384] (-887.771) (-883.204) (-884.627) -- 0:00:47
      230000 -- (-884.747) [-885.565] (-885.173) (-883.141) * (-885.537) [-886.306] (-882.729) (-883.854) -- 0:00:46

      Average standard deviation of split frequencies: 0.013015

      230500 -- [-888.966] (-884.007) (-884.484) (-883.361) * (-883.822) (-885.643) [-882.451] (-884.022) -- 0:00:46
      231000 -- (-883.802) [-884.836] (-884.102) (-884.887) * (-883.558) (-884.297) [-885.577] (-882.823) -- 0:00:49
      231500 -- (-888.170) (-887.034) [-884.172] (-884.469) * (-883.907) (-884.717) (-884.055) [-885.672] -- 0:00:49
      232000 -- (-886.666) (-884.394) [-884.048] (-884.109) * (-883.617) [-882.946] (-884.615) (-883.586) -- 0:00:49
      232500 -- [-883.472] (-883.555) (-885.628) (-883.458) * (-883.347) (-886.252) [-884.753] (-884.435) -- 0:00:49
      233000 -- [-883.498] (-883.447) (-883.687) (-885.261) * (-883.674) [-890.943] (-883.416) (-884.786) -- 0:00:49
      233500 -- (-883.137) (-884.021) (-884.882) [-884.314] * (-885.918) (-884.784) (-885.339) [-884.023] -- 0:00:49
      234000 -- (-885.763) (-886.297) (-883.695) [-885.853] * (-886.802) (-892.368) (-882.783) [-884.961] -- 0:00:49
      234500 -- [-883.763] (-886.137) (-884.130) (-888.766) * (-883.065) (-891.691) (-883.409) [-884.434] -- 0:00:48
      235000 -- [-885.790] (-884.539) (-884.823) (-887.913) * (-882.844) [-884.989] (-884.448) (-882.799) -- 0:00:48

      Average standard deviation of split frequencies: 0.011985

      235500 -- (-886.113) [-886.448] (-885.886) (-883.173) * (-882.975) (-885.742) [-887.103] (-883.105) -- 0:00:48
      236000 -- (-887.415) (-885.627) [-883.226] (-885.898) * (-884.065) (-885.342) (-885.141) [-883.482] -- 0:00:48
      236500 -- (-887.089) [-886.534] (-883.057) (-883.895) * (-884.148) (-885.532) [-883.567] (-890.099) -- 0:00:48
      237000 -- (-882.734) (-886.954) (-884.413) [-884.316] * (-884.240) [-882.583] (-884.440) (-889.892) -- 0:00:48
      237500 -- (-891.159) (-885.273) (-883.481) [-884.654] * [-883.304] (-882.685) (-883.082) (-884.920) -- 0:00:48
      238000 -- (-885.439) (-886.083) [-883.268] (-884.434) * (-884.179) (-883.088) (-885.044) [-884.976] -- 0:00:48
      238500 -- (-885.168) (-885.523) (-886.208) [-884.242] * (-885.787) [-885.803] (-882.396) (-887.784) -- 0:00:47
      239000 -- (-884.639) (-883.953) [-884.778] (-887.034) * (-885.170) (-887.564) [-882.697] (-884.561) -- 0:00:47
      239500 -- [-882.973] (-888.906) (-887.276) (-886.071) * [-883.416] (-887.773) (-884.369) (-883.948) -- 0:00:47
      240000 -- (-884.978) (-888.272) [-885.603] (-884.087) * (-882.988) (-889.317) [-884.207] (-883.838) -- 0:00:47

      Average standard deviation of split frequencies: 0.010991

      240500 -- [-885.531] (-885.045) (-882.953) (-884.242) * (-884.059) [-883.673] (-890.297) (-884.078) -- 0:00:47
      241000 -- (-887.306) [-883.788] (-886.069) (-888.940) * (-883.521) [-885.484] (-890.650) (-885.502) -- 0:00:47
      241500 -- (-883.400) [-884.790] (-885.614) (-884.100) * (-883.072) [-888.121] (-884.015) (-886.456) -- 0:00:47
      242000 -- (-883.168) (-883.481) (-888.146) [-885.122] * (-883.616) (-883.874) [-887.676] (-883.798) -- 0:00:46
      242500 -- [-883.549] (-884.847) (-885.395) (-883.592) * (-883.497) [-883.575] (-883.482) (-884.374) -- 0:00:46
      243000 -- (-884.389) (-885.179) (-884.199) [-883.147] * (-885.068) (-882.931) [-884.931] (-885.163) -- 0:00:46
      243500 -- (-885.320) (-883.978) [-885.333] (-882.779) * (-883.923) (-882.878) [-884.459] (-887.982) -- 0:00:46
      244000 -- (-884.796) [-884.460] (-886.190) (-883.684) * (-884.057) (-883.495) (-886.839) [-883.986] -- 0:00:46
      244500 -- (-883.296) (-884.113) [-885.547] (-886.159) * [-884.750] (-884.947) (-885.281) (-883.520) -- 0:00:46
      245000 -- (-886.492) (-885.137) [-886.838] (-885.122) * (-885.452) (-885.087) (-883.841) [-884.342] -- 0:00:46

      Average standard deviation of split frequencies: 0.010433

      245500 -- (-884.525) [-886.168] (-884.656) (-883.381) * (-883.343) (-885.724) [-886.118] (-885.676) -- 0:00:46
      246000 -- [-883.492] (-882.864) (-886.526) (-882.495) * (-886.681) (-885.245) (-884.054) [-884.938] -- 0:00:45
      246500 -- (-883.519) (-884.295) (-888.178) [-884.436] * (-885.988) (-882.733) [-882.768] (-885.855) -- 0:00:45
      247000 -- (-883.484) (-885.619) (-884.101) [-883.486] * (-884.254) (-883.273) (-883.417) [-886.175] -- 0:00:45
      247500 -- (-883.399) [-886.989] (-884.133) (-886.210) * (-885.635) (-885.019) (-883.514) [-886.068] -- 0:00:48
      248000 -- (-884.427) (-883.762) (-882.913) [-886.781] * (-885.047) [-883.356] (-885.823) (-885.533) -- 0:00:48
      248500 -- (-883.892) (-885.530) (-882.790) [-886.367] * [-883.597] (-884.243) (-885.055) (-886.029) -- 0:00:48
      249000 -- (-887.362) (-886.077) [-882.824] (-883.586) * (-885.980) (-886.481) (-882.882) [-885.211] -- 0:00:48
      249500 -- (-884.681) [-884.832] (-885.176) (-882.402) * (-884.520) (-886.732) [-883.338] (-885.092) -- 0:00:48
      250000 -- (-885.612) (-887.081) (-883.248) [-883.720] * (-883.482) (-883.997) [-883.931] (-886.820) -- 0:00:48

      Average standard deviation of split frequencies: 0.010448

      250500 -- [-885.898] (-885.761) (-884.723) (-883.784) * (-887.439) (-886.741) [-884.765] (-885.946) -- 0:00:47
      251000 -- [-885.257] (-884.735) (-883.993) (-884.135) * (-890.441) (-885.909) (-883.212) [-885.332] -- 0:00:47
      251500 -- (-882.753) [-882.998] (-887.132) (-882.946) * (-884.381) (-885.776) (-888.072) [-887.234] -- 0:00:47
      252000 -- [-885.404] (-884.319) (-886.230) (-883.181) * (-885.788) (-883.077) (-887.476) [-886.719] -- 0:00:47
      252500 -- (-883.340) (-883.636) (-886.088) [-883.371] * (-883.999) [-882.748] (-887.129) (-883.720) -- 0:00:47
      253000 -- (-885.473) (-883.244) (-883.392) [-884.009] * (-882.901) (-885.372) [-885.569] (-883.389) -- 0:00:47
      253500 -- (-885.369) (-884.381) (-884.731) [-884.039] * [-884.428] (-884.085) (-893.911) (-883.258) -- 0:00:47
      254000 -- (-884.286) (-883.937) [-884.138] (-884.018) * (-884.764) (-885.288) [-882.879] (-883.592) -- 0:00:46
      254500 -- (-884.249) [-883.515] (-883.449) (-884.585) * (-883.074) (-884.782) [-884.573] (-887.644) -- 0:00:46
      255000 -- (-885.802) (-883.394) [-883.584] (-883.652) * [-883.284] (-883.954) (-883.918) (-882.547) -- 0:00:46

      Average standard deviation of split frequencies: 0.012018

      255500 -- (-883.763) [-882.680] (-883.592) (-889.775) * [-883.167] (-883.985) (-882.297) (-883.787) -- 0:00:46
      256000 -- [-884.050] (-883.295) (-883.447) (-883.491) * (-884.214) (-885.010) (-882.302) [-883.069] -- 0:00:46
      256500 -- (-884.118) [-884.464] (-885.409) (-883.431) * (-884.990) (-884.645) [-882.490] (-887.175) -- 0:00:46
      257000 -- (-885.516) [-883.597] (-886.061) (-886.866) * (-885.475) (-884.986) (-883.218) [-887.866] -- 0:00:46
      257500 -- [-886.407] (-884.561) (-883.063) (-885.469) * [-883.897] (-888.248) (-882.554) (-887.192) -- 0:00:46
      258000 -- [-883.218] (-884.691) (-882.957) (-885.044) * (-883.727) [-884.422] (-882.875) (-885.136) -- 0:00:46
      258500 -- [-886.507] (-892.816) (-886.037) (-888.818) * (-884.645) (-884.979) [-882.719] (-886.625) -- 0:00:45
      259000 -- (-885.548) (-885.067) (-887.266) [-884.984] * [-883.861] (-883.551) (-889.526) (-885.063) -- 0:00:45
      259500 -- [-885.440] (-885.405) (-886.348) (-885.073) * (-885.000) (-883.713) (-888.444) [-885.050] -- 0:00:45
      260000 -- (-883.602) [-885.805] (-884.606) (-886.015) * (-882.869) (-882.752) [-886.781] (-884.112) -- 0:00:45

      Average standard deviation of split frequencies: 0.011808

      260500 -- [-884.295] (-883.375) (-889.305) (-883.854) * (-884.403) (-884.411) [-883.318] (-884.046) -- 0:00:45
      261000 -- (-886.024) [-884.583] (-885.477) (-883.633) * (-885.193) (-884.346) (-884.853) [-886.246] -- 0:00:45
      261500 -- (-886.997) (-885.313) (-886.182) [-887.351] * [-883.364] (-885.201) (-886.115) (-883.091) -- 0:00:45
      262000 -- (-887.356) (-884.174) [-886.217] (-882.852) * (-886.541) [-882.880] (-884.336) (-885.792) -- 0:00:45
      262500 -- (-884.992) [-886.194] (-886.720) (-888.738) * (-884.332) (-882.777) (-883.559) [-883.812] -- 0:00:44
      263000 -- (-885.865) (-884.429) (-883.690) [-882.841] * (-884.722) (-884.293) [-883.801] (-883.751) -- 0:00:44
      263500 -- (-883.419) [-884.615] (-884.982) (-882.934) * (-885.602) (-884.468) [-887.270] (-886.211) -- 0:00:44
      264000 -- (-883.014) (-888.411) [-883.458] (-883.563) * (-885.756) (-884.655) (-884.592) [-884.654] -- 0:00:44
      264500 -- [-883.100] (-885.884) (-887.096) (-883.435) * (-887.319) (-887.356) [-882.722] (-885.136) -- 0:00:47
      265000 -- (-886.959) (-885.235) (-885.745) [-884.094] * [-885.606] (-886.881) (-884.287) (-884.626) -- 0:00:47

      Average standard deviation of split frequencies: 0.012685

      265500 -- (-886.861) (-886.212) [-886.736] (-884.143) * (-884.281) (-886.413) (-883.430) [-883.446] -- 0:00:47
      266000 -- [-884.320] (-883.959) (-884.849) (-885.019) * [-886.720] (-885.427) (-885.893) (-883.316) -- 0:00:46
      266500 -- (-883.825) [-883.303] (-883.824) (-885.075) * (-885.777) (-885.177) (-886.653) [-883.771] -- 0:00:46
      267000 -- (-884.140) [-885.896] (-885.471) (-884.369) * (-888.092) [-886.034] (-884.992) (-884.283) -- 0:00:46
      267500 -- (-886.356) (-888.668) [-883.809] (-883.355) * (-888.236) [-884.778] (-884.409) (-886.843) -- 0:00:46
      268000 -- (-892.668) [-883.486] (-882.969) (-882.704) * (-884.697) [-885.643] (-887.099) (-886.402) -- 0:00:46
      268500 -- (-883.804) [-884.649] (-883.748) (-884.182) * (-887.518) [-882.862] (-886.797) (-885.827) -- 0:00:46
      269000 -- (-883.736) (-883.486) (-885.401) [-885.386] * (-883.307) (-887.678) [-886.235] (-883.412) -- 0:00:46
      269500 -- (-884.824) [-886.412] (-887.637) (-887.964) * (-885.452) (-888.868) (-883.031) [-883.823] -- 0:00:46
      270000 -- (-884.000) (-883.560) [-886.696] (-884.266) * [-886.459] (-884.374) (-883.953) (-887.068) -- 0:00:45

      Average standard deviation of split frequencies: 0.013159

      270500 -- (-886.764) (-886.921) (-882.756) [-884.015] * (-885.500) (-884.101) [-885.554] (-885.459) -- 0:00:45
      271000 -- [-885.126] (-889.726) (-884.839) (-883.722) * (-886.442) [-886.579] (-888.778) (-883.518) -- 0:00:45
      271500 -- (-884.473) [-885.327] (-884.085) (-885.852) * (-883.482) (-886.640) (-885.423) [-883.318] -- 0:00:45
      272000 -- (-885.562) (-883.478) (-883.588) [-882.755] * (-883.957) (-887.963) (-884.116) [-883.017] -- 0:00:45
      272500 -- (-883.600) [-883.241] (-883.238) (-883.786) * (-885.346) (-886.937) [-882.461] (-884.144) -- 0:00:45
      273000 -- (-885.229) (-883.513) (-882.845) [-882.654] * (-885.498) [-887.655] (-882.459) (-883.740) -- 0:00:45
      273500 -- (-883.054) (-883.611) (-882.590) [-883.126] * (-885.851) [-882.716] (-883.998) (-885.636) -- 0:00:45
      274000 -- (-884.280) [-883.819] (-883.741) (-883.143) * (-883.990) [-882.874] (-889.315) (-895.546) -- 0:00:45
      274500 -- (-885.175) (-884.443) [-883.288] (-883.030) * (-887.872) (-885.802) [-885.126] (-885.871) -- 0:00:44
      275000 -- (-885.582) (-885.123) (-883.259) [-886.373] * (-883.774) (-888.700) (-885.325) [-884.416] -- 0:00:44

      Average standard deviation of split frequencies: 0.012525

      275500 -- (-888.325) (-884.999) [-883.873] (-883.312) * (-883.406) (-885.924) [-885.203] (-884.137) -- 0:00:44
      276000 -- (-887.479) (-882.841) (-885.665) [-882.751] * (-883.197) (-885.448) [-883.315] (-885.057) -- 0:00:44
      276500 -- (-884.817) (-883.197) (-884.285) [-884.190] * (-887.154) [-882.560] (-883.989) (-883.015) -- 0:00:44
      277000 -- (-885.051) (-885.631) [-883.038] (-886.050) * (-889.163) (-883.586) [-886.196] (-885.310) -- 0:00:44
      277500 -- (-885.690) (-883.341) [-883.220] (-886.061) * (-891.182) (-884.930) (-884.753) [-883.064] -- 0:00:44
      278000 -- [-885.978] (-883.158) (-883.266) (-883.102) * [-885.933] (-883.592) (-883.721) (-882.892) -- 0:00:44
      278500 -- [-885.280] (-884.850) (-883.771) (-888.084) * (-885.190) (-883.985) (-884.157) [-885.064] -- 0:00:44
      279000 -- [-883.655] (-890.967) (-884.483) (-884.027) * (-886.574) (-885.698) [-883.005] (-884.222) -- 0:00:43
      279500 -- [-883.638] (-884.810) (-884.352) (-883.527) * (-885.701) (-885.946) [-885.170] (-884.860) -- 0:00:43
      280000 -- (-885.330) [-884.451] (-882.651) (-883.833) * (-884.912) (-884.663) (-882.993) [-882.694] -- 0:00:43

      Average standard deviation of split frequencies: 0.011362

      280500 -- (-884.505) (-883.477) (-883.353) [-884.266] * (-884.088) [-886.289] (-885.857) (-882.700) -- 0:00:46
      281000 -- (-887.306) [-883.664] (-885.005) (-883.861) * (-884.593) (-886.115) [-886.460] (-883.679) -- 0:00:46
      281500 -- [-883.753] (-883.036) (-884.743) (-883.894) * [-887.641] (-885.847) (-884.965) (-884.629) -- 0:00:45
      282000 -- [-885.009] (-883.392) (-885.715) (-889.545) * (-884.146) [-883.938] (-886.581) (-885.369) -- 0:00:45
      282500 -- [-884.550] (-884.801) (-884.035) (-885.829) * (-883.425) (-883.772) (-884.851) [-883.766] -- 0:00:45
      283000 -- (-886.724) (-883.508) (-883.986) [-884.555] * (-888.155) (-883.834) [-886.245] (-884.178) -- 0:00:45
      283500 -- (-887.772) (-887.110) (-885.578) [-883.856] * (-893.549) (-884.746) (-884.657) [-883.232] -- 0:00:45
      284000 -- (-884.523) [-884.738] (-884.771) (-883.842) * (-890.364) [-884.862] (-882.976) (-884.484) -- 0:00:45
      284500 -- [-888.509] (-884.153) (-885.178) (-883.622) * [-883.962] (-888.803) (-884.640) (-883.305) -- 0:00:45
      285000 -- (-884.139) (-883.828) (-888.846) [-882.783] * (-884.794) (-889.342) [-883.455] (-882.884) -- 0:00:45

      Average standard deviation of split frequencies: 0.010347

      285500 -- (-882.965) (-883.871) [-884.423] (-885.311) * [-885.118] (-884.223) (-883.619) (-883.018) -- 0:00:45
      286000 -- (-884.067) (-884.683) (-887.504) [-886.808] * (-883.354) [-886.709] (-885.884) (-882.970) -- 0:00:44
      286500 -- (-882.796) [-884.065] (-885.492) (-883.686) * (-884.244) [-884.586] (-890.582) (-885.160) -- 0:00:44
      287000 -- (-884.906) [-883.979] (-884.724) (-884.543) * [-886.971] (-884.220) (-885.222) (-883.424) -- 0:00:44
      287500 -- (-884.957) [-883.623] (-883.853) (-885.092) * [-889.456] (-888.492) (-882.851) (-882.756) -- 0:00:44
      288000 -- [-885.361] (-887.017) (-890.176) (-882.959) * [-884.678] (-887.308) (-883.215) (-883.992) -- 0:00:44
      288500 -- (-883.158) (-886.568) (-883.111) [-884.057] * (-883.923) (-888.540) [-883.235] (-886.995) -- 0:00:44
      289000 -- [-888.167] (-884.760) (-883.521) (-882.813) * (-885.447) [-885.703] (-884.252) (-885.089) -- 0:00:44
      289500 -- (-885.481) (-882.941) [-885.888] (-882.808) * (-882.791) (-887.075) [-884.895] (-886.424) -- 0:00:44
      290000 -- (-882.905) (-885.701) (-887.760) [-884.120] * [-884.236] (-885.462) (-884.539) (-887.381) -- 0:00:44

      Average standard deviation of split frequencies: 0.009911

      290500 -- (-884.871) (-882.822) (-884.912) [-885.350] * (-883.670) [-886.078] (-887.633) (-888.778) -- 0:00:43
      291000 -- (-888.389) (-884.394) (-884.884) [-882.845] * (-885.336) (-885.331) (-884.496) [-884.735] -- 0:00:43
      291500 -- (-883.632) [-885.530] (-886.592) (-889.387) * [-884.062] (-886.043) (-882.409) (-884.770) -- 0:00:43
      292000 -- (-886.326) (-883.726) (-884.213) [-884.670] * (-885.264) (-887.344) (-886.837) [-885.424] -- 0:00:43
      292500 -- (-883.973) (-883.534) [-883.079] (-885.131) * (-885.266) (-882.929) [-885.090] (-884.219) -- 0:00:43
      293000 -- (-884.545) (-883.582) (-883.607) [-882.752] * (-886.107) (-882.784) (-882.688) [-883.500] -- 0:00:43
      293500 -- (-888.590) (-884.334) [-883.363] (-888.597) * [-883.871] (-882.858) (-884.585) (-885.788) -- 0:00:43
      294000 -- (-887.238) (-885.428) (-883.505) [-888.529] * (-884.301) [-885.775] (-884.354) (-885.910) -- 0:00:43
      294500 -- (-884.184) [-885.145] (-888.422) (-889.653) * [-884.040] (-887.159) (-883.907) (-887.026) -- 0:00:43
      295000 -- (-888.475) [-887.062] (-883.985) (-893.350) * (-886.948) (-882.998) (-882.942) [-884.853] -- 0:00:43

      Average standard deviation of split frequencies: 0.010813

      295500 -- (-884.179) (-887.361) [-886.572] (-888.293) * (-883.814) [-882.998] (-882.753) (-884.818) -- 0:00:42
      296000 -- (-886.723) [-884.723] (-885.476) (-885.196) * (-882.511) (-883.573) [-884.300] (-883.289) -- 0:00:42
      296500 -- (-886.281) [-885.493] (-884.440) (-883.766) * (-883.949) (-883.552) [-882.676] (-885.959) -- 0:00:42
      297000 -- (-888.917) (-885.195) (-887.833) [-883.949] * (-883.318) (-883.843) [-882.416] (-887.561) -- 0:00:42
      297500 -- [-892.161] (-885.525) (-888.314) (-888.537) * (-883.342) (-883.505) (-887.300) [-884.669] -- 0:00:44
      298000 -- (-885.820) (-885.083) [-888.019] (-887.165) * [-884.373] (-889.899) (-883.294) (-883.878) -- 0:00:44
      298500 -- [-883.666] (-888.264) (-885.246) (-884.821) * (-884.890) (-885.015) (-882.665) [-885.736] -- 0:00:44
      299000 -- [-884.408] (-885.683) (-884.960) (-884.287) * (-883.094) (-892.790) (-883.909) [-887.662] -- 0:00:44
      299500 -- (-883.308) (-885.095) [-883.661] (-882.909) * (-884.786) (-885.499) (-884.353) [-886.727] -- 0:00:44
      300000 -- (-883.426) [-886.088] (-884.826) (-883.225) * (-885.519) [-885.793] (-886.557) (-884.622) -- 0:00:44

      Average standard deviation of split frequencies: 0.011058

      300500 -- (-884.529) [-887.055] (-885.723) (-884.984) * (-888.157) (-890.793) [-887.800] (-885.724) -- 0:00:44
      301000 -- (-883.963) (-883.837) [-887.837] (-884.536) * (-885.830) (-888.486) [-884.464] (-882.921) -- 0:00:44
      301500 -- (-884.678) (-884.973) [-887.224] (-883.917) * (-883.359) (-886.875) (-882.574) [-883.636] -- 0:00:44
      302000 -- (-884.316) [-885.846] (-888.368) (-883.757) * (-882.901) [-885.454] (-883.739) (-883.703) -- 0:00:43
      302500 -- (-886.531) (-883.647) [-884.909] (-882.842) * [-886.997] (-887.968) (-883.300) (-884.270) -- 0:00:43
      303000 -- (-887.369) (-883.398) (-886.660) [-882.477] * (-884.550) [-883.927] (-882.870) (-882.868) -- 0:00:43
      303500 -- (-890.839) (-884.267) (-884.875) [-884.912] * (-885.641) (-884.717) (-883.103) [-884.322] -- 0:00:43
      304000 -- (-883.825) (-883.185) (-883.486) [-885.895] * (-884.267) (-887.227) (-884.285) [-882.719] -- 0:00:43
      304500 -- (-885.245) [-884.707] (-883.664) (-889.262) * (-884.968) (-890.827) [-885.714] (-884.335) -- 0:00:43
      305000 -- (-883.363) (-884.961) (-887.833) [-884.431] * (-885.311) [-883.500] (-885.366) (-883.336) -- 0:00:43

      Average standard deviation of split frequencies: 0.011351

      305500 -- [-884.809] (-884.251) (-888.120) (-882.558) * (-887.529) (-885.263) [-887.792] (-885.003) -- 0:00:43
      306000 -- (-886.358) (-882.887) [-885.524] (-882.562) * (-884.093) (-884.338) (-886.663) [-884.231] -- 0:00:43
      306500 -- (-887.796) (-883.629) (-883.536) [-882.629] * (-886.211) (-883.452) (-882.962) [-884.092] -- 0:00:42
      307000 -- (-887.519) (-884.565) (-884.121) [-885.027] * (-884.089) [-883.500] (-884.744) (-884.120) -- 0:00:42
      307500 -- (-884.557) (-882.279) (-882.987) [-883.854] * (-882.883) [-882.951] (-884.340) (-883.175) -- 0:00:42
      308000 -- (-883.820) [-884.141] (-886.899) (-884.926) * (-883.336) [-884.819] (-884.883) (-884.466) -- 0:00:42
      308500 -- (-882.439) (-882.737) [-885.121] (-884.858) * (-883.202) [-885.692] (-886.758) (-884.859) -- 0:00:42
      309000 -- [-887.131] (-884.063) (-882.895) (-884.291) * [-885.532] (-887.171) (-886.777) (-886.869) -- 0:00:42
      309500 -- [-883.436] (-888.536) (-883.224) (-883.966) * (-886.294) (-886.482) (-886.738) [-884.966] -- 0:00:42
      310000 -- (-883.739) (-887.865) [-887.312] (-889.174) * (-883.973) (-883.363) (-884.493) [-882.867] -- 0:00:42

      Average standard deviation of split frequencies: 0.010941

      310500 -- (-883.301) [-886.351] (-887.262) (-887.865) * (-884.324) [-884.272] (-887.225) (-884.300) -- 0:00:42
      311000 -- (-886.066) (-887.831) (-885.345) [-884.403] * (-886.990) [-884.848] (-883.089) (-885.163) -- 0:00:42
      311500 -- (-885.902) (-886.726) [-886.349] (-885.467) * (-883.491) (-883.081) (-886.748) [-883.010] -- 0:00:41
      312000 -- (-886.869) (-884.687) (-883.905) [-884.346] * (-883.603) (-882.975) [-884.999] (-882.700) -- 0:00:41
      312500 -- (-885.895) [-885.838] (-883.527) (-883.432) * (-884.436) (-884.614) (-883.515) [-882.615] -- 0:00:41
      313000 -- (-884.157) [-884.324] (-882.953) (-884.577) * (-884.397) [-882.788] (-884.406) (-884.074) -- 0:00:41
      313500 -- (-883.810) (-889.091) (-884.065) [-884.373] * (-885.263) [-885.348] (-884.957) (-886.646) -- 0:00:41
      314000 -- (-883.202) (-883.216) [-882.475] (-884.692) * (-886.001) [-885.939] (-884.316) (-892.749) -- 0:00:43
      314500 -- (-883.388) (-885.539) (-883.674) [-885.143] * (-882.837) (-883.448) [-885.010] (-887.456) -- 0:00:43
      315000 -- (-883.539) [-884.194] (-885.140) (-884.566) * [-883.031] (-885.229) (-884.089) (-885.534) -- 0:00:43

      Average standard deviation of split frequencies: 0.008371

      315500 -- [-883.970] (-882.679) (-885.968) (-884.965) * [-883.013] (-882.436) (-883.662) (-887.295) -- 0:00:43
      316000 -- (-884.415) (-883.741) (-887.050) [-886.870] * [-883.010] (-882.507) (-883.355) (-884.043) -- 0:00:43
      316500 -- (-884.631) (-886.941) (-887.003) [-884.878] * (-887.362) (-887.201) (-884.429) [-883.929] -- 0:00:43
      317000 -- (-885.558) (-888.862) (-883.292) [-886.597] * (-883.671) (-883.595) [-884.496] (-883.751) -- 0:00:43
      317500 -- (-883.648) (-888.046) (-888.066) [-886.148] * (-884.704) (-883.322) [-883.738] (-884.780) -- 0:00:42
      318000 -- (-884.533) (-886.592) (-888.091) [-885.092] * [-885.215] (-884.768) (-884.032) (-882.394) -- 0:00:42
      318500 -- (-888.762) (-888.721) [-884.941] (-884.841) * (-883.955) [-885.306] (-884.275) (-884.959) -- 0:00:42
      319000 -- (-883.661) (-885.035) (-883.697) [-884.581] * (-890.556) [-887.258] (-892.603) (-885.684) -- 0:00:42
      319500 -- [-888.859] (-882.700) (-886.106) (-885.491) * (-885.137) (-885.748) (-885.848) [-884.381] -- 0:00:42
      320000 -- (-889.158) [-883.274] (-889.606) (-887.823) * (-885.719) (-884.426) (-884.071) [-884.455] -- 0:00:42

      Average standard deviation of split frequencies: 0.008648

      320500 -- (-887.126) (-883.951) (-882.591) [-888.138] * (-885.096) (-884.626) (-890.004) [-883.283] -- 0:00:42
      321000 -- (-883.263) (-883.130) [-882.583] (-892.399) * (-883.409) (-886.155) (-882.835) [-883.687] -- 0:00:42
      321500 -- (-885.883) [-882.856] (-883.638) (-884.985) * (-885.272) [-890.639] (-885.052) (-886.410) -- 0:00:42
      322000 -- (-883.748) (-882.923) [-882.429] (-887.718) * (-887.484) (-884.077) (-885.280) [-887.175] -- 0:00:42
      322500 -- (-884.620) (-887.549) (-882.703) [-883.143] * (-885.878) (-886.479) [-889.672] (-884.724) -- 0:00:42
      323000 -- (-887.765) (-885.600) (-883.231) [-884.311] * (-885.348) (-885.920) (-885.893) [-887.258] -- 0:00:41
      323500 -- (-886.893) (-885.782) (-887.595) [-883.761] * (-883.775) (-884.124) (-886.547) [-887.084] -- 0:00:41
      324000 -- [-883.500] (-883.433) (-882.791) (-887.830) * (-885.480) (-884.261) [-885.007] (-886.707) -- 0:00:41
      324500 -- (-884.876) (-883.195) (-883.384) [-883.677] * (-882.740) (-888.208) (-887.157) [-883.821] -- 0:00:41
      325000 -- [-882.809] (-883.866) (-886.795) (-886.300) * (-884.298) (-883.521) (-883.299) [-883.777] -- 0:00:41

      Average standard deviation of split frequencies: 0.008355

      325500 -- (-885.154) [-883.996] (-886.047) (-884.245) * (-886.453) (-883.958) [-883.050] (-886.213) -- 0:00:41
      326000 -- [-885.929] (-883.497) (-885.552) (-884.484) * (-885.170) [-884.270] (-883.066) (-884.332) -- 0:00:41
      326500 -- [-885.130] (-883.146) (-884.971) (-886.864) * (-885.764) [-882.722] (-885.613) (-884.102) -- 0:00:41
      327000 -- (-882.894) (-884.521) [-883.171] (-884.058) * (-882.561) [-883.444] (-883.950) (-887.181) -- 0:00:41
      327500 -- [-887.067] (-886.041) (-883.210) (-885.056) * (-885.177) (-888.133) [-885.070] (-884.558) -- 0:00:41
      328000 -- (-884.063) (-886.205) (-884.116) [-885.616] * (-886.393) (-889.123) [-884.707] (-885.552) -- 0:00:40
      328500 -- (-884.057) (-882.832) [-884.917] (-883.736) * (-885.779) (-889.841) [-883.112] (-885.307) -- 0:00:40
      329000 -- (-883.309) (-883.882) [-885.513] (-886.730) * (-885.465) (-889.863) [-884.389] (-885.041) -- 0:00:40
      329500 -- (-883.673) [-882.895] (-891.012) (-888.308) * (-883.653) (-886.138) (-882.761) [-883.765] -- 0:00:40
      330000 -- [-883.206] (-887.382) (-882.845) (-883.203) * (-883.913) (-885.073) [-884.039] (-883.523) -- 0:00:40

      Average standard deviation of split frequencies: 0.007380

      330500 -- (-891.116) (-887.761) [-882.801] (-883.967) * [-884.194] (-887.368) (-882.858) (-885.762) -- 0:00:40
      331000 -- (-884.190) (-886.461) [-883.209] (-886.376) * [-882.558] (-886.344) (-887.413) (-885.004) -- 0:00:42
      331500 -- [-884.575] (-888.538) (-884.943) (-886.693) * (-883.642) (-885.129) [-883.060] (-886.685) -- 0:00:42
      332000 -- (-888.922) (-889.161) (-884.494) [-884.200] * (-883.361) (-886.878) [-882.868] (-883.082) -- 0:00:42
      332500 -- (-884.145) (-886.220) [-884.494] (-889.532) * [-883.676] (-890.490) (-884.851) (-883.255) -- 0:00:42
      333000 -- (-883.614) [-885.585] (-884.756) (-885.826) * [-884.109] (-884.963) (-884.252) (-884.960) -- 0:00:42
      333500 -- (-884.209) [-886.658] (-884.277) (-886.804) * (-885.463) (-886.103) [-883.993] (-883.675) -- 0:00:41
      334000 -- (-884.348) (-885.163) [-885.263] (-885.441) * (-887.122) [-889.933] (-883.486) (-883.482) -- 0:00:41
      334500 -- (-886.987) (-883.418) (-887.446) [-884.806] * (-888.437) (-883.959) [-883.394] (-885.306) -- 0:00:41
      335000 -- (-885.357) (-883.204) [-884.696] (-886.720) * (-883.849) (-887.423) [-883.223] (-891.297) -- 0:00:41

      Average standard deviation of split frequencies: 0.007263

      335500 -- (-884.548) [-883.706] (-884.044) (-886.057) * (-883.736) (-884.560) [-883.862] (-888.396) -- 0:00:41
      336000 -- (-884.850) [-884.238] (-883.567) (-886.249) * (-884.104) (-886.167) (-884.377) [-886.872] -- 0:00:41
      336500 -- (-883.200) (-883.958) (-884.637) [-885.760] * (-882.688) (-886.565) [-885.336] (-885.577) -- 0:00:41
      337000 -- [-882.736] (-882.613) (-885.041) (-887.439) * (-884.646) [-883.720] (-883.269) (-883.841) -- 0:00:41
      337500 -- (-883.136) [-884.455] (-886.470) (-884.522) * [-883.279] (-887.956) (-882.476) (-883.039) -- 0:00:41
      338000 -- [-883.795] (-885.437) (-884.272) (-888.232) * (-884.596) [-885.062] (-884.324) (-883.446) -- 0:00:41
      338500 -- (-882.654) [-886.034] (-886.931) (-884.446) * (-883.907) (-884.299) [-882.687] (-885.448) -- 0:00:41
      339000 -- (-882.844) (-883.671) [-886.513] (-886.565) * (-886.901) [-882.648] (-884.870) (-883.920) -- 0:00:40
      339500 -- (-882.836) (-887.336) [-883.895] (-884.959) * (-884.964) (-888.134) (-885.199) [-883.701] -- 0:00:40
      340000 -- [-882.628] (-886.203) (-883.839) (-883.706) * (-886.369) (-885.014) (-883.918) [-885.550] -- 0:00:40

      Average standard deviation of split frequencies: 0.006837

      340500 -- (-883.109) [-882.587] (-883.556) (-883.735) * [-884.983] (-882.358) (-887.703) (-884.584) -- 0:00:40
      341000 -- (-883.077) (-882.878) [-883.202] (-882.524) * [-886.578] (-885.877) (-887.590) (-884.460) -- 0:00:40
      341500 -- (-883.148) (-883.299) [-883.985] (-884.869) * (-886.947) (-882.941) (-887.624) [-882.860] -- 0:00:40
      342000 -- [-885.255] (-883.638) (-886.073) (-885.015) * (-885.796) (-884.125) [-887.168] (-885.484) -- 0:00:40
      342500 -- (-885.689) (-882.829) [-884.158] (-883.879) * (-883.199) (-885.022) (-884.905) [-883.531] -- 0:00:40
      343000 -- (-882.788) (-884.390) [-883.644] (-882.669) * (-884.886) (-884.303) (-885.897) [-882.794] -- 0:00:40
      343500 -- (-883.051) [-883.749] (-884.514) (-883.444) * (-884.345) [-883.819] (-885.561) (-882.743) -- 0:00:40
      344000 -- (-884.946) (-886.946) (-883.870) [-884.768] * (-884.934) [-883.332] (-882.715) (-884.504) -- 0:00:40
      344500 -- (-886.310) [-885.204] (-886.321) (-882.937) * (-885.507) (-885.843) [-882.747] (-883.676) -- 0:00:39
      345000 -- (-884.204) (-884.729) [-884.409] (-882.661) * (-888.916) [-883.559] (-885.555) (-884.754) -- 0:00:41

      Average standard deviation of split frequencies: 0.006492

      345500 -- (-886.994) (-884.941) [-884.753] (-883.002) * (-884.784) (-885.653) (-884.276) [-882.658] -- 0:00:41
      346000 -- (-887.627) [-886.725] (-888.862) (-884.033) * [-883.217] (-884.173) (-887.352) (-883.028) -- 0:00:41
      346500 -- (-887.287) (-883.405) (-884.294) [-883.949] * (-883.295) [-883.174] (-883.617) (-883.552) -- 0:00:41
      347000 -- (-886.773) (-883.481) (-883.643) [-885.419] * [-886.055] (-885.426) (-885.047) (-883.706) -- 0:00:41
      347500 -- (-886.085) [-886.757] (-883.100) (-883.860) * (-885.990) (-885.421) [-882.951] (-882.834) -- 0:00:41
      348000 -- (-883.355) (-886.322) [-885.679] (-884.585) * (-886.201) [-887.518] (-889.300) (-887.822) -- 0:00:41
      348500 -- (-884.318) [-886.034] (-886.778) (-885.338) * (-890.628) [-885.767] (-888.517) (-885.727) -- 0:00:41
      349000 -- [-887.600] (-887.102) (-885.340) (-885.066) * (-888.352) (-882.807) [-886.367] (-883.625) -- 0:00:41
      349500 -- (-884.752) (-883.436) (-885.976) [-883.506] * (-892.257) (-883.022) (-885.399) [-883.998] -- 0:00:40
      350000 -- (-885.443) (-885.115) (-884.321) [-884.241] * (-886.204) (-883.154) [-886.628] (-883.341) -- 0:00:40

      Average standard deviation of split frequencies: 0.006049

      350500 -- (-884.521) (-883.927) (-883.566) [-884.209] * (-885.932) (-884.374) [-883.429] (-883.333) -- 0:00:40
      351000 -- (-885.555) [-883.974] (-883.807) (-889.044) * [-884.948] (-885.115) (-884.436) (-883.129) -- 0:00:40
      351500 -- (-883.824) (-885.825) (-883.744) [-885.498] * (-885.353) [-886.779] (-885.989) (-889.270) -- 0:00:40
      352000 -- (-885.781) [-883.800] (-883.117) (-883.311) * (-887.135) (-886.454) [-885.349] (-882.694) -- 0:00:40
      352500 -- (-888.165) (-884.683) [-883.406] (-884.100) * [-885.644] (-882.988) (-885.634) (-883.842) -- 0:00:40
      353000 -- (-884.250) [-886.732] (-884.966) (-885.110) * (-886.905) (-886.904) (-883.410) [-884.650] -- 0:00:40
      353500 -- [-886.516] (-883.150) (-885.379) (-886.440) * [-886.527] (-888.272) (-883.272) (-888.264) -- 0:00:40
      354000 -- (-888.559) [-883.674] (-884.739) (-888.135) * [-883.423] (-885.459) (-885.382) (-883.630) -- 0:00:40
      354500 -- (-883.826) [-884.013] (-884.447) (-884.270) * [-884.313] (-885.633) (-884.695) (-884.143) -- 0:00:40
      355000 -- (-883.855) [-883.620] (-883.025) (-884.316) * (-883.553) [-884.602] (-889.826) (-884.019) -- 0:00:39

      Average standard deviation of split frequencies: 0.006786

      355500 -- (-884.327) (-884.410) (-882.781) [-884.582] * (-883.479) (-885.158) (-885.866) [-884.470] -- 0:00:39
      356000 -- [-883.995] (-886.130) (-882.726) (-886.365) * (-883.943) [-883.552] (-888.826) (-888.372) -- 0:00:39
      356500 -- (-884.358) (-883.949) [-883.728] (-884.718) * (-887.705) (-884.988) (-884.528) [-883.604] -- 0:00:39
      357000 -- (-884.430) (-886.679) (-883.059) [-884.518] * (-886.662) [-884.200] (-883.978) (-883.569) -- 0:00:39
      357500 -- [-883.667] (-884.951) (-886.766) (-884.406) * (-883.975) [-882.602] (-883.979) (-884.357) -- 0:00:39
      358000 -- (-883.196) (-887.389) [-884.394] (-883.696) * (-887.633) (-884.112) (-886.142) [-884.886] -- 0:00:39
      358500 -- (-884.197) (-883.073) (-883.705) [-883.157] * (-888.029) (-884.449) (-890.500) [-888.451] -- 0:00:39
      359000 -- (-885.870) [-883.073] (-882.651) (-884.679) * (-885.824) [-884.032] (-885.151) (-885.549) -- 0:00:39
      359500 -- [-886.666] (-884.113) (-885.076) (-883.071) * (-885.098) (-884.928) (-883.372) [-884.637] -- 0:00:39
      360000 -- (-884.198) (-884.030) [-883.180] (-883.555) * [-883.492] (-887.370) (-883.527) (-884.544) -- 0:00:39

      Average standard deviation of split frequencies: 0.007679

      360500 -- (-886.182) (-886.744) (-887.061) [-884.456] * [-883.440] (-883.590) (-884.411) (-882.900) -- 0:00:40
      361000 -- (-889.326) (-884.930) (-884.342) [-886.211] * (-885.336) (-888.796) (-883.957) [-883.361] -- 0:00:40
      361500 -- (-886.893) (-885.342) [-888.762] (-884.574) * (-887.035) [-882.650] (-890.198) (-885.637) -- 0:00:40
      362000 -- (-884.295) [-884.652] (-884.584) (-888.068) * (-885.395) (-888.571) [-885.525] (-883.710) -- 0:00:40
      362500 -- (-887.706) [-884.128] (-887.860) (-883.605) * [-886.409] (-886.403) (-889.951) (-883.677) -- 0:00:40
      363000 -- (-889.673) [-885.478] (-886.702) (-884.458) * (-887.251) (-888.766) (-888.164) [-885.184] -- 0:00:40
      363500 -- (-887.357) [-886.150] (-886.066) (-885.923) * (-886.933) [-884.887] (-886.518) (-886.122) -- 0:00:40
      364000 -- [-885.375] (-883.575) (-885.537) (-888.752) * [-885.687] (-891.470) (-886.846) (-884.836) -- 0:00:40
      364500 -- (-886.361) [-883.621] (-892.587) (-882.330) * (-885.238) [-887.174] (-885.990) (-887.649) -- 0:00:40
      365000 -- (-884.994) (-884.762) [-885.655] (-885.304) * (-889.694) (-884.700) (-885.125) [-884.740] -- 0:00:40

      Average standard deviation of split frequencies: 0.007808

      365500 -- [-884.288] (-885.380) (-885.447) (-886.503) * (-889.382) (-884.789) [-884.555] (-885.195) -- 0:00:39
      366000 -- [-883.229] (-885.415) (-884.262) (-893.387) * (-886.689) (-883.744) (-883.673) [-886.757] -- 0:00:39
      366500 -- (-886.758) (-886.458) [-882.653] (-883.874) * (-888.973) (-884.744) [-884.133] (-884.201) -- 0:00:39
      367000 -- (-883.408) (-884.561) [-883.556] (-887.994) * (-885.145) [-886.137] (-884.362) (-886.675) -- 0:00:39
      367500 -- [-890.626] (-883.897) (-885.003) (-884.304) * (-884.926) (-887.851) [-888.347] (-889.160) -- 0:00:39
      368000 -- (-884.259) (-884.168) (-886.562) [-884.349] * [-882.559] (-885.321) (-886.724) (-886.909) -- 0:00:39
      368500 -- (-886.202) (-885.361) [-883.000] (-883.930) * (-883.345) (-883.636) [-887.548] (-886.082) -- 0:00:39
      369000 -- (-884.583) (-883.814) [-883.003] (-884.919) * (-883.097) [-882.905] (-885.367) (-891.752) -- 0:00:39
      369500 -- (-885.844) (-882.557) (-883.105) [-883.993] * (-882.644) (-885.389) (-884.718) [-885.295] -- 0:00:39
      370000 -- (-882.801) (-883.565) (-882.924) [-884.523] * (-882.602) (-886.839) [-883.978] (-885.326) -- 0:00:39

      Average standard deviation of split frequencies: 0.007869

      370500 -- (-882.394) (-889.339) (-887.731) [-889.249] * (-883.391) (-884.813) [-884.347] (-884.167) -- 0:00:39
      371000 -- [-884.691] (-883.669) (-884.938) (-886.550) * (-885.450) [-885.835] (-887.157) (-887.075) -- 0:00:38
      371500 -- (-885.018) [-885.236] (-889.510) (-887.329) * (-884.092) (-884.628) (-888.181) [-886.345] -- 0:00:38
      372000 -- [-882.879] (-884.988) (-895.107) (-887.474) * (-885.956) (-885.474) [-883.356] (-886.892) -- 0:00:38
      372500 -- (-882.834) [-885.821] (-883.388) (-889.535) * [-885.138] (-883.433) (-882.388) (-883.685) -- 0:00:38
      373000 -- [-882.834] (-885.023) (-884.157) (-887.176) * (-883.939) (-884.832) [-884.335] (-883.505) -- 0:00:38
      373500 -- (-885.872) (-884.930) [-883.561] (-887.175) * [-884.160] (-882.433) (-884.331) (-882.709) -- 0:00:38
      374000 -- [-884.073] (-891.783) (-886.045) (-886.156) * [-889.288] (-882.927) (-883.041) (-882.935) -- 0:00:38
      374500 -- (-882.636) (-885.532) (-883.378) [-884.424] * (-886.308) (-883.437) (-884.353) [-884.171] -- 0:00:38
      375000 -- [-884.948] (-883.848) (-886.878) (-885.335) * (-885.641) (-884.449) (-884.220) [-886.924] -- 0:00:38

      Average standard deviation of split frequencies: 0.008260

      375500 -- (-886.619) [-883.662] (-884.775) (-884.991) * [-884.045] (-884.591) (-884.437) (-882.750) -- 0:00:38
      376000 -- [-883.527] (-883.659) (-885.254) (-883.799) * (-884.727) (-883.053) (-887.371) [-886.475] -- 0:00:39
      376500 -- (-884.330) (-883.692) (-883.645) [-883.231] * [-884.441] (-885.458) (-887.864) (-885.474) -- 0:00:39
      377000 -- [-885.781] (-883.433) (-883.171) (-885.736) * [-884.467] (-884.522) (-890.102) (-882.945) -- 0:00:39
      377500 -- (-883.335) (-883.674) (-884.399) [-884.303] * [-884.547] (-884.005) (-884.873) (-883.533) -- 0:00:39
      378000 -- [-883.961] (-883.562) (-884.462) (-884.956) * (-884.445) (-883.895) [-884.755] (-885.567) -- 0:00:39
      378500 -- [-884.046] (-884.339) (-884.291) (-886.008) * (-886.084) (-883.327) [-886.880] (-887.430) -- 0:00:39
      379000 -- (-883.715) (-883.893) [-888.442] (-885.168) * (-887.994) (-885.200) [-885.963] (-883.368) -- 0:00:39
      379500 -- [-883.918] (-886.988) (-884.937) (-884.586) * [-884.479] (-882.486) (-884.900) (-883.815) -- 0:00:39
      380000 -- (-886.988) [-884.164] (-888.565) (-886.603) * (-883.213) (-885.244) [-887.585] (-883.941) -- 0:00:39

      Average standard deviation of split frequencies: 0.008304

      380500 -- [-884.916] (-885.055) (-883.883) (-882.489) * [-884.657] (-884.164) (-883.937) (-885.622) -- 0:00:39
      381000 -- [-883.358] (-883.862) (-882.850) (-883.690) * (-883.423) (-884.192) [-883.070] (-889.722) -- 0:00:38
      381500 -- (-884.152) (-882.431) (-884.863) [-888.522] * (-884.551) (-884.403) [-887.241] (-887.583) -- 0:00:38
      382000 -- [-882.335] (-887.347) (-885.348) (-886.318) * (-882.861) (-884.087) (-886.328) [-884.670] -- 0:00:38
      382500 -- [-886.502] (-883.014) (-885.922) (-884.742) * (-885.501) (-884.531) (-885.231) [-884.449] -- 0:00:38
      383000 -- (-885.362) (-883.559) (-883.250) [-883.614] * (-887.964) (-884.026) (-887.147) [-883.462] -- 0:00:38
      383500 -- (-887.959) (-884.508) (-883.029) [-883.928] * [-882.895] (-884.162) (-884.875) (-885.692) -- 0:00:38
      384000 -- [-882.770] (-884.158) (-883.112) (-887.504) * [-887.750] (-887.049) (-884.904) (-885.732) -- 0:00:38
      384500 -- (-884.603) (-886.200) [-882.824] (-885.618) * (-888.274) [-883.275] (-884.349) (-883.116) -- 0:00:38
      385000 -- [-885.765] (-883.476) (-885.195) (-885.325) * (-889.696) [-887.339] (-883.154) (-884.052) -- 0:00:38

      Average standard deviation of split frequencies: 0.008333

      385500 -- (-884.592) (-884.537) [-884.197] (-884.265) * [-888.029] (-883.365) (-882.773) (-884.853) -- 0:00:38
      386000 -- (-883.081) (-884.822) [-885.909] (-887.314) * (-886.116) (-884.916) (-885.488) [-885.831] -- 0:00:38
      386500 -- (-886.053) [-883.545] (-883.193) (-886.264) * (-884.719) (-883.662) [-885.432] (-884.825) -- 0:00:38
      387000 -- [-883.416] (-884.556) (-884.211) (-883.996) * (-883.451) [-884.519] (-886.482) (-884.226) -- 0:00:38
      387500 -- (-889.352) [-887.421] (-884.295) (-884.833) * (-885.253) (-885.265) [-883.546] (-882.419) -- 0:00:37
      388000 -- [-884.838] (-884.594) (-894.682) (-884.080) * [-883.757] (-884.748) (-887.305) (-882.794) -- 0:00:37
      388500 -- (-890.282) [-885.397] (-889.479) (-883.919) * [-883.831] (-885.038) (-886.015) (-882.921) -- 0:00:37
      389000 -- (-884.133) (-885.543) [-890.551] (-887.230) * (-888.987) [-884.377] (-882.872) (-885.974) -- 0:00:37
      389500 -- (-887.014) (-884.394) (-884.827) [-884.268] * (-882.441) [-884.414] (-883.415) (-887.354) -- 0:00:37
      390000 -- [-884.593] (-882.449) (-884.949) (-883.717) * (-887.785) (-884.895) [-885.784] (-884.155) -- 0:00:37

      Average standard deviation of split frequencies: 0.008660

      390500 -- (-888.753) (-883.920) [-884.769] (-889.001) * (-885.093) (-884.321) [-884.697] (-884.013) -- 0:00:37
      391000 -- (-885.458) (-887.853) [-883.432] (-886.049) * (-884.304) (-885.774) (-887.049) [-883.520] -- 0:00:37
      391500 -- (-884.358) (-884.810) (-882.617) [-883.565] * (-883.913) (-884.556) [-883.080] (-885.863) -- 0:00:38
      392000 -- (-888.982) (-883.802) [-883.357] (-886.645) * (-882.938) (-886.428) [-883.948] (-890.064) -- 0:00:38
      392500 -- (-884.028) (-884.585) [-885.300] (-890.579) * (-883.036) (-892.900) [-884.382] (-884.248) -- 0:00:38
      393000 -- [-884.402] (-886.316) (-885.452) (-883.106) * (-883.119) (-888.456) (-884.590) [-883.092] -- 0:00:38
      393500 -- (-883.882) (-888.020) [-883.059] (-883.265) * (-883.667) [-883.468] (-884.186) (-882.690) -- 0:00:38
      394000 -- (-884.023) (-883.430) [-882.652] (-883.583) * (-888.084) [-886.383] (-885.824) (-884.482) -- 0:00:38
      394500 -- (-883.946) [-884.530] (-883.125) (-884.845) * [-884.498] (-882.644) (-890.405) (-883.191) -- 0:00:38
      395000 -- (-883.080) (-884.818) [-884.533] (-884.722) * (-884.270) (-884.896) [-885.726] (-884.494) -- 0:00:38

      Average standard deviation of split frequencies: 0.007843

      395500 -- [-885.973] (-884.357) (-883.468) (-883.995) * (-886.066) (-883.957) (-884.247) [-883.480] -- 0:00:38
      396000 -- [-882.644] (-887.261) (-886.034) (-883.648) * (-885.225) (-883.563) [-883.154] (-886.860) -- 0:00:38
      396500 -- [-884.766] (-885.047) (-886.596) (-885.309) * (-884.765) [-884.199] (-884.255) (-886.668) -- 0:00:38
      397000 -- [-887.000] (-884.807) (-885.709) (-887.424) * [-883.703] (-884.473) (-888.190) (-883.443) -- 0:00:37
      397500 -- (-885.588) (-884.372) [-887.753] (-885.318) * (-885.528) (-884.720) (-889.175) [-886.585] -- 0:00:37
      398000 -- (-884.058) (-885.729) [-883.524] (-885.356) * (-884.719) (-883.901) (-886.886) [-888.918] -- 0:00:37
      398500 -- (-884.437) (-884.753) (-884.545) [-883.032] * (-883.665) (-885.016) [-884.634] (-886.102) -- 0:00:37
      399000 -- [-886.421] (-883.151) (-884.407) (-887.744) * [-882.900] (-886.301) (-884.228) (-884.731) -- 0:00:37
      399500 -- (-888.787) (-885.651) (-883.197) [-884.847] * (-883.410) (-883.667) [-886.033] (-884.573) -- 0:00:37
      400000 -- (-885.840) (-883.670) (-886.036) [-883.772] * (-882.778) (-883.619) (-884.474) [-886.384] -- 0:00:37

      Average standard deviation of split frequencies: 0.007821

      400500 -- (-886.822) [-886.902] (-886.912) (-883.401) * (-887.390) (-884.084) [-883.354] (-884.554) -- 0:00:37
      401000 -- [-888.130] (-885.312) (-882.549) (-885.836) * (-884.720) [-886.213] (-884.113) (-883.475) -- 0:00:37
      401500 -- (-887.856) (-884.256) (-887.204) [-884.099] * (-885.999) (-883.616) (-885.590) [-885.070] -- 0:00:37
      402000 -- [-885.250] (-885.672) (-886.651) (-882.458) * [-886.645] (-884.594) (-886.373) (-882.576) -- 0:00:37
      402500 -- (-882.875) (-884.839) [-885.504] (-883.686) * [-883.904] (-883.431) (-882.849) (-883.207) -- 0:00:37
      403000 -- (-884.327) (-889.774) [-884.157] (-886.108) * (-883.566) [-884.870] (-884.867) (-883.954) -- 0:00:37
      403500 -- [-884.475] (-885.050) (-883.083) (-885.945) * (-885.159) (-885.469) [-884.131] (-886.442) -- 0:00:36
      404000 -- [-883.978] (-885.540) (-884.683) (-883.389) * (-883.117) (-885.435) [-885.190] (-884.186) -- 0:00:36
      404500 -- (-887.833) [-884.057] (-885.032) (-883.446) * (-883.688) (-883.604) (-884.211) [-884.310] -- 0:00:36
      405000 -- [-889.296] (-886.012) (-885.337) (-885.023) * (-882.726) (-885.427) [-886.562] (-884.642) -- 0:00:36

      Average standard deviation of split frequencies: 0.007991

      405500 -- [-883.436] (-884.645) (-886.734) (-884.817) * (-885.327) (-884.337) (-886.451) [-884.124] -- 0:00:36
      406000 -- (-884.251) (-883.136) (-883.503) [-885.158] * (-887.239) (-883.644) [-883.024] (-884.225) -- 0:00:36
      406500 -- [-884.769] (-886.150) (-887.573) (-884.701) * (-885.371) [-885.204] (-883.294) (-884.438) -- 0:00:36
      407000 -- (-884.731) (-884.598) (-889.024) [-884.390] * (-885.487) (-884.596) (-884.233) [-883.677] -- 0:00:36
      407500 -- (-889.009) (-885.940) (-884.657) [-883.751] * (-882.882) [-884.736] (-883.497) (-884.726) -- 0:00:37
      408000 -- (-883.610) (-884.152) [-883.545] (-884.161) * (-885.521) (-885.512) [-883.772] (-887.307) -- 0:00:37
      408500 -- (-882.306) (-884.611) (-886.980) [-887.281] * (-884.487) (-886.397) (-884.829) [-883.504] -- 0:00:37
      409000 -- [-884.965] (-889.751) (-886.077) (-887.947) * [-885.631] (-884.609) (-884.647) (-883.093) -- 0:00:37
      409500 -- [-885.889] (-886.026) (-884.499) (-886.836) * (-888.238) (-884.181) [-885.881] (-885.371) -- 0:00:37
      410000 -- (-885.987) [-883.991] (-890.129) (-887.126) * [-883.519] (-888.264) (-884.207) (-887.036) -- 0:00:37

      Average standard deviation of split frequencies: 0.008466

      410500 -- [-884.174] (-885.978) (-884.873) (-882.796) * (-883.284) (-886.165) (-884.152) [-883.548] -- 0:00:37
      411000 -- [-883.425] (-884.796) (-886.440) (-882.789) * (-882.795) (-886.287) (-885.191) [-883.337] -- 0:00:37
      411500 -- [-884.686] (-890.813) (-885.388) (-884.699) * (-883.784) (-887.256) [-882.499] (-885.886) -- 0:00:37
      412000 -- (-884.520) (-884.642) (-886.572) [-884.652] * (-883.725) (-883.452) (-885.517) [-882.607] -- 0:00:37
      412500 -- (-888.381) (-883.582) (-886.799) [-883.306] * (-883.784) [-885.045] (-884.011) (-887.590) -- 0:00:37
      413000 -- (-889.212) [-882.751] (-885.671) (-886.272) * (-882.836) (-883.285) (-886.755) [-885.631] -- 0:00:36
      413500 -- (-888.282) (-883.426) (-884.267) [-883.624] * (-883.348) (-883.005) [-883.144] (-885.328) -- 0:00:36
      414000 -- (-886.504) (-885.089) (-883.687) [-883.777] * (-883.335) (-884.508) [-884.266] (-886.589) -- 0:00:36
      414500 -- (-886.019) (-892.441) [-885.096] (-884.065) * (-884.868) [-884.572] (-887.544) (-888.332) -- 0:00:36
      415000 -- (-883.668) (-886.267) (-884.402) [-884.571] * (-884.868) (-886.195) (-884.492) [-884.069] -- 0:00:36

      Average standard deviation of split frequencies: 0.009420

      415500 -- (-883.484) (-882.866) (-882.785) [-884.439] * (-883.803) (-886.253) [-883.405] (-886.495) -- 0:00:36
      416000 -- (-884.140) (-886.897) [-883.167] (-885.080) * (-882.714) (-884.038) (-886.661) [-884.211] -- 0:00:36
      416500 -- [-884.064] (-887.493) (-883.002) (-885.491) * (-885.528) (-883.248) (-884.208) [-885.048] -- 0:00:36
      417000 -- (-885.579) [-883.893] (-883.038) (-885.342) * [-889.808] (-887.042) (-884.849) (-884.441) -- 0:00:36
      417500 -- [-886.678] (-887.433) (-883.379) (-884.773) * (-884.471) [-887.805] (-885.323) (-883.887) -- 0:00:36
      418000 -- (-883.220) (-884.758) (-884.221) [-889.794] * (-886.500) (-889.467) (-888.508) [-885.215] -- 0:00:36
      418500 -- (-882.939) (-885.044) [-885.114] (-883.118) * [-884.045] (-886.768) (-887.434) (-883.591) -- 0:00:36
      419000 -- [-882.960] (-883.814) (-883.951) (-885.769) * [-886.684] (-885.089) (-887.944) (-884.234) -- 0:00:36
      419500 -- (-884.611) [-885.403] (-884.403) (-884.167) * (-883.996) (-883.325) (-884.457) [-883.641] -- 0:00:35
      420000 -- [-883.631] (-886.106) (-884.040) (-885.532) * (-885.747) (-883.351) [-884.124] (-886.916) -- 0:00:35

      Average standard deviation of split frequencies: 0.009385

      420500 -- (-882.735) (-886.202) [-885.861] (-884.044) * (-885.119) (-882.823) [-884.368] (-885.861) -- 0:00:35
      421000 -- (-883.768) [-885.057] (-883.986) (-887.694) * (-884.410) (-883.719) [-885.362] (-887.048) -- 0:00:35
      421500 -- (-882.998) (-883.739) [-884.743] (-887.858) * [-884.167] (-883.254) (-882.348) (-884.581) -- 0:00:35
      422000 -- (-882.563) (-886.384) (-884.817) [-886.983] * [-882.749] (-883.854) (-882.742) (-884.720) -- 0:00:35
      422500 -- [-883.499] (-885.162) (-885.778) (-884.453) * (-885.064) [-883.596] (-885.586) (-884.290) -- 0:00:35
      423000 -- (-883.141) (-886.944) [-883.203] (-886.135) * [-885.722] (-883.679) (-883.647) (-884.107) -- 0:00:35
      423500 -- [-882.840] (-882.808) (-882.694) (-886.271) * [-884.271] (-883.370) (-883.289) (-885.223) -- 0:00:35
      424000 -- (-884.702) (-883.948) [-884.513] (-882.588) * (-887.550) (-883.743) [-883.816] (-886.670) -- 0:00:35
      424500 -- (-883.694) [-884.196] (-884.954) (-884.862) * [-887.268] (-883.507) (-883.072) (-884.565) -- 0:00:36
      425000 -- (-884.137) (-882.881) [-884.428] (-883.748) * (-886.447) (-882.763) [-885.882] (-885.124) -- 0:00:36

      Average standard deviation of split frequencies: 0.009406

      425500 -- [-883.258] (-883.418) (-888.108) (-883.277) * (-885.871) (-883.683) [-884.929] (-885.038) -- 0:00:36
      426000 -- [-883.323] (-884.298) (-884.928) (-883.697) * [-886.275] (-883.408) (-884.130) (-886.602) -- 0:00:36
      426500 -- [-882.469] (-886.551) (-883.568) (-886.643) * (-883.867) [-884.041] (-883.521) (-885.750) -- 0:00:36
      427000 -- (-883.929) (-884.262) (-885.452) [-883.993] * (-888.138) (-887.978) [-883.302] (-884.387) -- 0:00:36
      427500 -- (-887.574) (-888.626) (-885.564) [-883.858] * (-886.268) (-886.062) (-883.483) [-883.042] -- 0:00:36
      428000 -- (-883.947) (-886.603) (-889.868) [-883.311] * (-883.373) (-885.824) [-883.566] (-884.958) -- 0:00:36
      428500 -- (-882.744) [-883.506] (-883.690) (-884.031) * (-882.943) [-887.747] (-885.655) (-885.196) -- 0:00:36
      429000 -- (-886.244) (-883.393) [-882.584] (-885.607) * (-887.175) (-885.580) [-883.070] (-890.894) -- 0:00:35
      429500 -- [-884.158] (-888.660) (-885.948) (-884.604) * (-882.678) [-887.718] (-883.881) (-884.186) -- 0:00:35
      430000 -- (-884.251) [-884.556] (-884.003) (-884.614) * (-882.754) (-886.128) (-882.922) [-885.417] -- 0:00:35

      Average standard deviation of split frequencies: 0.009920

      430500 -- [-885.156] (-884.838) (-883.845) (-884.587) * (-884.107) (-886.847) (-888.146) [-883.620] -- 0:00:35
      431000 -- (-882.770) [-883.849] (-883.139) (-886.272) * (-884.243) (-883.508) [-882.794] (-885.860) -- 0:00:35
      431500 -- [-883.285] (-883.900) (-883.002) (-886.337) * [-883.633] (-890.153) (-883.314) (-888.946) -- 0:00:35
      432000 -- (-883.571) (-883.305) (-883.761) [-885.305] * [-885.428] (-883.125) (-887.739) (-885.683) -- 0:00:35
      432500 -- [-886.475] (-883.482) (-885.504) (-884.297) * [-883.768] (-884.458) (-884.110) (-885.469) -- 0:00:35
      433000 -- (-888.922) (-882.972) [-885.510] (-883.955) * (-883.031) [-884.507] (-887.221) (-883.456) -- 0:00:35
      433500 -- [-885.687] (-887.319) (-883.579) (-885.828) * [-886.134] (-888.033) (-884.131) (-886.138) -- 0:00:35
      434000 -- (-882.660) (-885.895) (-883.695) [-885.000] * (-887.950) (-886.694) (-884.781) [-883.488] -- 0:00:35
      434500 -- (-883.721) (-884.616) [-882.872] (-885.999) * (-888.784) (-883.930) (-887.178) [-884.718] -- 0:00:35
      435000 -- (-885.428) [-885.320] (-889.156) (-887.873) * (-884.060) [-883.334] (-887.179) (-884.880) -- 0:00:35

      Average standard deviation of split frequencies: 0.010136

      435500 -- (-885.001) (-883.843) (-891.145) [-886.007] * (-883.409) (-883.378) (-883.613) [-887.364] -- 0:00:34
      436000 -- (-884.833) (-884.618) (-889.859) [-885.669] * [-883.061] (-884.933) (-884.981) (-883.823) -- 0:00:34
      436500 -- (-885.336) (-885.213) (-884.901) [-884.346] * (-884.001) (-887.457) [-883.109] (-884.844) -- 0:00:34
      437000 -- (-888.839) [-885.557] (-883.393) (-882.935) * (-887.165) (-891.223) (-885.437) [-882.791] -- 0:00:34
      437500 -- [-887.486] (-884.869) (-884.828) (-887.246) * (-885.864) [-887.763] (-889.708) (-882.558) -- 0:00:34
      438000 -- (-883.438) (-884.095) [-884.629] (-883.490) * (-885.479) (-885.380) (-886.175) [-883.436] -- 0:00:34
      438500 -- [-883.750] (-883.654) (-887.154) (-884.359) * (-883.496) [-886.357] (-888.724) (-884.910) -- 0:00:34
      439000 -- (-882.847) (-884.563) [-882.556] (-884.667) * (-884.369) (-884.599) (-885.494) [-883.523] -- 0:00:34
      439500 -- (-884.451) (-885.875) (-883.352) [-889.718] * [-884.027] (-884.322) (-883.376) (-884.099) -- 0:00:34
      440000 -- (-884.905) (-886.613) (-885.145) [-886.414] * (-885.199) [-883.323] (-886.692) (-887.652) -- 0:00:34

      Average standard deviation of split frequencies: 0.010430

      440500 -- [-885.025] (-886.455) (-885.333) (-883.619) * [-885.170] (-883.136) (-884.482) (-883.232) -- 0:00:34
      441000 -- (-888.053) (-884.311) (-882.816) [-882.523] * [-883.867] (-885.403) (-885.383) (-883.782) -- 0:00:34
      441500 -- (-883.603) [-885.345] (-886.516) (-883.781) * (-887.059) [-885.052] (-884.724) (-884.084) -- 0:00:35
      442000 -- (-884.090) (-884.494) (-884.073) [-884.802] * (-888.022) (-883.864) (-885.086) [-883.558] -- 0:00:35
      442500 -- (-884.879) (-884.127) [-886.732] (-885.474) * [-883.608] (-886.625) (-884.471) (-882.792) -- 0:00:35
      443000 -- (-885.745) (-885.828) [-883.636] (-888.136) * [-885.243] (-889.764) (-885.227) (-882.601) -- 0:00:35
      443500 -- (-884.804) (-883.543) (-884.317) [-885.394] * (-890.561) (-888.801) [-884.901] (-884.123) -- 0:00:35
      444000 -- (-886.198) (-883.470) (-884.986) [-882.748] * (-883.622) (-890.126) (-885.587) [-883.761] -- 0:00:35
      444500 -- [-886.401] (-884.481) (-887.013) (-885.047) * (-883.948) [-886.007] (-886.136) (-883.965) -- 0:00:34
      445000 -- (-883.304) (-882.636) [-883.544] (-884.264) * (-883.126) (-883.978) [-888.136] (-883.769) -- 0:00:34

      Average standard deviation of split frequencies: 0.010107

      445500 -- [-885.664] (-886.044) (-883.220) (-884.258) * (-886.610) (-883.941) (-884.213) [-883.840] -- 0:00:34
      446000 -- (-884.583) (-884.849) (-884.942) [-884.464] * (-884.916) (-886.459) (-885.263) [-884.571] -- 0:00:34
      446500 -- (-884.138) (-883.528) (-884.452) [-883.764] * (-884.372) (-884.373) (-890.342) [-886.339] -- 0:00:34
      447000 -- (-885.375) (-885.890) [-884.794] (-886.049) * (-885.296) (-883.115) [-884.881] (-882.547) -- 0:00:34
      447500 -- (-883.399) (-883.290) [-883.670] (-886.818) * [-883.470] (-883.082) (-888.519) (-883.673) -- 0:00:34
      448000 -- (-883.910) (-883.660) [-882.746] (-888.318) * [-883.276] (-883.353) (-884.642) (-882.988) -- 0:00:34
      448500 -- (-885.018) [-882.512] (-882.653) (-883.729) * (-883.314) (-885.440) [-886.084] (-883.705) -- 0:00:34
      449000 -- (-885.177) (-884.769) (-883.803) [-887.466] * (-884.705) (-885.093) [-887.184] (-886.126) -- 0:00:34
      449500 -- (-884.868) (-884.596) (-882.456) [-884.019] * (-885.509) (-884.080) [-885.377] (-885.259) -- 0:00:34
      450000 -- (-886.296) (-882.513) (-883.471) [-887.721] * [-882.740] (-882.572) (-883.672) (-885.665) -- 0:00:34

      Average standard deviation of split frequencies: 0.010133

      450500 -- (-886.063) [-883.846] (-883.441) (-883.189) * (-882.805) (-883.397) [-887.024] (-884.301) -- 0:00:34
      451000 -- [-885.050] (-882.502) (-882.998) (-884.281) * (-884.011) [-886.323] (-889.000) (-884.294) -- 0:00:34
      451500 -- (-883.982) [-885.896] (-883.188) (-883.999) * (-885.690) (-884.781) [-883.296] (-885.586) -- 0:00:34
      452000 -- (-883.632) (-889.814) (-883.100) [-883.499] * (-883.914) (-885.160) (-884.968) [-886.781] -- 0:00:33
      452500 -- [-883.687] (-886.444) (-883.149) (-884.743) * (-883.918) [-886.488] (-884.450) (-888.199) -- 0:00:33
      453000 -- [-885.237] (-884.940) (-885.162) (-883.894) * (-884.930) (-883.845) [-884.969] (-887.187) -- 0:00:33
      453500 -- (-888.377) (-886.083) (-883.456) [-884.705] * (-883.671) [-884.726] (-883.481) (-889.614) -- 0:00:33
      454000 -- (-885.167) (-884.438) (-886.211) [-885.153] * [-884.948] (-887.455) (-884.517) (-883.967) -- 0:00:33
      454500 -- (-884.627) [-885.158] (-884.707) (-883.011) * (-887.241) (-882.921) (-884.131) [-884.433] -- 0:00:33
      455000 -- (-888.423) [-883.570] (-882.819) (-883.542) * (-886.135) (-883.772) (-882.626) [-884.298] -- 0:00:33

      Average standard deviation of split frequencies: 0.010079

      455500 -- (-886.898) (-883.549) [-884.332] (-883.700) * (-888.141) [-885.785] (-885.793) (-884.917) -- 0:00:33
      456000 -- (-891.125) [-883.850] (-884.483) (-883.092) * (-885.463) (-888.546) [-886.992] (-884.569) -- 0:00:33
      456500 -- (-887.909) (-885.162) [-883.495] (-883.880) * (-885.358) (-883.605) [-886.641] (-883.288) -- 0:00:33
      457000 -- [-882.566] (-886.456) (-885.776) (-887.772) * (-883.424) [-883.352] (-883.640) (-882.849) -- 0:00:33
      457500 -- [-883.263] (-887.118) (-886.512) (-884.791) * (-884.032) [-883.383] (-884.597) (-885.742) -- 0:00:33
      458000 -- (-882.495) [-885.017] (-886.406) (-887.602) * (-883.303) (-885.368) [-882.470] (-883.681) -- 0:00:33
      458500 -- [-885.468] (-883.049) (-885.624) (-882.672) * (-884.058) (-883.383) (-882.470) [-883.681] -- 0:00:34
      459000 -- (-884.082) (-884.051) (-883.633) [-883.202] * [-884.349] (-883.532) (-884.312) (-887.695) -- 0:00:34
      459500 -- (-884.694) [-885.192] (-886.240) (-883.923) * (-886.075) (-882.923) (-883.114) [-888.129] -- 0:00:34
      460000 -- (-883.023) (-887.489) (-883.977) [-883.953] * (-883.564) [-883.549] (-886.096) (-885.533) -- 0:00:34

      Average standard deviation of split frequencies: 0.010301

      460500 -- (-884.961) [-886.713] (-883.666) (-883.568) * (-883.657) (-883.300) [-883.907] (-883.560) -- 0:00:33
      461000 -- [-887.984] (-885.228) (-885.773) (-883.551) * (-883.219) [-884.433] (-883.901) (-883.133) -- 0:00:33
      461500 -- (-887.769) [-883.575] (-886.528) (-884.091) * [-885.309] (-885.614) (-883.871) (-882.776) -- 0:00:33
      462000 -- [-883.577] (-883.007) (-885.027) (-884.924) * (-885.333) (-886.515) (-883.153) [-883.837] -- 0:00:33
      462500 -- (-883.179) (-885.401) [-887.490] (-885.157) * (-886.675) [-886.108] (-883.795) (-886.194) -- 0:00:33
      463000 -- (-884.758) (-885.045) [-886.840] (-883.770) * (-887.640) (-884.758) [-883.607] (-889.707) -- 0:00:33
      463500 -- [-885.020] (-885.061) (-890.341) (-887.886) * (-889.542) [-883.708] (-884.840) (-889.912) -- 0:00:33
      464000 -- (-887.563) (-883.248) [-883.095] (-886.002) * (-886.037) (-883.752) (-884.280) [-886.616] -- 0:00:33
      464500 -- [-884.533] (-886.383) (-887.443) (-884.075) * (-883.708) (-883.130) (-883.583) [-885.030] -- 0:00:33
      465000 -- (-884.717) (-884.490) [-883.734] (-886.171) * (-886.524) (-885.184) [-883.456] (-883.557) -- 0:00:33

      Average standard deviation of split frequencies: 0.010369

      465500 -- (-884.160) [-884.500] (-886.636) (-885.383) * (-883.520) (-884.269) (-883.145) [-883.413] -- 0:00:33
      466000 -- [-884.090] (-883.650) (-886.004) (-882.553) * (-884.095) [-884.044] (-887.809) (-883.009) -- 0:00:33
      466500 -- (-883.266) (-885.091) [-885.063] (-883.406) * (-884.611) (-885.670) [-884.559] (-883.204) -- 0:00:33
      467000 -- (-882.509) (-887.160) [-889.134] (-885.262) * (-883.820) (-883.200) [-885.584] (-885.706) -- 0:00:33
      467500 -- (-882.753) (-885.496) (-886.682) [-885.022] * (-883.558) (-882.497) (-883.795) [-885.217] -- 0:00:33
      468000 -- (-883.437) [-886.571] (-885.729) (-885.002) * (-884.970) (-884.569) [-884.327] (-885.470) -- 0:00:32
      468500 -- (-886.130) [-886.416] (-887.137) (-883.643) * (-883.625) (-886.429) [-882.871] (-888.322) -- 0:00:32
      469000 -- (-884.600) (-885.238) [-884.769] (-885.258) * (-884.328) (-888.116) [-889.433] (-890.792) -- 0:00:32
      469500 -- [-883.296] (-885.396) (-883.871) (-885.596) * (-884.000) (-887.649) [-885.563] (-885.349) -- 0:00:32
      470000 -- (-883.615) (-883.210) [-885.149] (-886.927) * (-885.298) (-883.206) (-887.305) [-883.467] -- 0:00:32

      Average standard deviation of split frequencies: 0.010149

      470500 -- (-883.502) (-883.954) [-890.319] (-882.704) * (-883.604) (-882.704) (-886.253) [-885.536] -- 0:00:32
      471000 -- (-886.042) (-883.788) (-893.356) [-883.884] * (-883.474) (-884.285) [-885.869] (-885.078) -- 0:00:32
      471500 -- (-888.407) (-883.945) [-884.595] (-884.723) * (-882.903) (-883.326) [-885.443] (-886.262) -- 0:00:32
      472000 -- (-887.080) (-885.045) (-888.473) [-883.921] * (-885.000) [-882.910] (-884.530) (-890.309) -- 0:00:32
      472500 -- [-885.529] (-885.756) (-883.739) (-882.779) * (-891.930) [-882.740] (-886.273) (-884.861) -- 0:00:32
      473000 -- (-888.714) (-884.469) (-882.922) [-883.383] * [-886.202] (-882.712) (-887.287) (-885.864) -- 0:00:32
      473500 -- (-886.326) (-887.161) [-885.645] (-885.774) * (-889.064) (-883.304) (-885.681) [-884.439] -- 0:00:32
      474000 -- (-883.928) [-883.853] (-888.225) (-882.638) * (-886.411) (-884.411) (-885.315) [-886.016] -- 0:00:32
      474500 -- (-882.574) (-883.536) [-883.803] (-883.767) * (-888.576) [-884.926] (-884.118) (-887.365) -- 0:00:32
      475000 -- [-886.271] (-884.430) (-882.938) (-883.397) * (-884.011) (-886.158) [-883.543] (-883.725) -- 0:00:33

      Average standard deviation of split frequencies: 0.009837

      475500 -- (-885.407) (-886.582) [-885.479] (-883.065) * (-886.017) (-884.601) [-883.133] (-883.696) -- 0:00:33
      476000 -- (-885.645) [-887.013] (-884.499) (-883.888) * (-883.520) [-883.408] (-885.245) (-883.940) -- 0:00:33
      476500 -- (-884.084) [-886.269] (-886.233) (-883.764) * (-883.337) [-883.156] (-887.307) (-886.878) -- 0:00:32
      477000 -- (-884.279) (-885.926) [-885.008] (-884.979) * (-884.294) [-884.251] (-884.178) (-887.656) -- 0:00:32
      477500 -- (-883.415) [-886.590] (-884.946) (-883.504) * (-885.610) (-883.074) (-885.349) [-883.730] -- 0:00:32
      478000 -- (-883.592) (-883.356) [-885.806] (-883.963) * (-886.306) (-883.936) [-883.209] (-886.346) -- 0:00:32
      478500 -- (-883.468) (-882.858) (-885.975) [-883.994] * (-886.489) (-884.415) (-883.233) [-883.211] -- 0:00:32
      479000 -- (-883.825) (-885.731) [-883.713] (-888.406) * (-887.251) (-883.640) [-885.353] (-882.751) -- 0:00:32
      479500 -- [-883.540] (-883.566) (-886.227) (-884.387) * (-884.477) (-885.031) (-883.982) [-884.502] -- 0:00:32
      480000 -- (-884.967) [-884.527] (-886.680) (-886.739) * (-884.027) [-884.146] (-883.819) (-889.709) -- 0:00:32

      Average standard deviation of split frequencies: 0.010003

      480500 -- (-886.231) (-886.622) (-886.908) [-882.775] * (-884.055) (-886.226) (-884.155) [-886.069] -- 0:00:32
      481000 -- [-890.335] (-884.833) (-884.805) (-885.761) * (-882.897) [-887.171] (-882.722) (-888.934) -- 0:00:32
      481500 -- (-885.322) (-890.032) (-883.212) [-883.855] * (-885.241) (-883.592) (-885.913) [-885.185] -- 0:00:32
      482000 -- (-883.580) [-888.724] (-883.887) (-884.871) * (-883.621) [-883.750] (-883.203) (-883.593) -- 0:00:32
      482500 -- (-882.672) [-883.273] (-883.757) (-883.961) * (-883.616) [-884.245] (-884.547) (-884.004) -- 0:00:32
      483000 -- (-889.763) (-882.928) (-885.650) [-885.900] * (-886.149) (-883.202) (-883.028) [-886.706] -- 0:00:32
      483500 -- (-888.642) (-885.010) (-887.250) [-884.320] * (-889.534) (-883.715) [-883.002] (-885.173) -- 0:00:32
      484000 -- (-890.859) [-884.278] (-885.184) (-883.107) * (-883.795) [-887.008] (-885.053) (-885.104) -- 0:00:31
      484500 -- (-883.041) (-884.272) (-882.923) [-883.329] * (-882.600) (-887.050) [-884.504] (-885.889) -- 0:00:31
      485000 -- (-883.351) [-883.227] (-884.723) (-887.137) * [-883.287] (-885.816) (-882.902) (-888.475) -- 0:00:31

      Average standard deviation of split frequencies: 0.010670

      485500 -- (-883.220) (-883.581) [-884.247] (-886.389) * [-882.892] (-886.501) (-883.890) (-887.159) -- 0:00:31
      486000 -- (-885.524) [-883.899] (-885.043) (-883.588) * (-883.783) (-883.488) (-887.490) [-884.911] -- 0:00:31
      486500 -- (-883.847) [-883.483] (-883.726) (-883.036) * [-883.325] (-887.196) (-889.174) (-885.103) -- 0:00:31
      487000 -- [-885.819] (-887.471) (-891.109) (-883.230) * (-883.753) (-884.810) (-886.804) [-884.999] -- 0:00:31
      487500 -- (-885.098) [-884.072] (-884.799) (-888.835) * (-884.670) (-883.324) (-884.050) [-883.975] -- 0:00:31
      488000 -- (-884.089) (-883.058) [-884.069] (-884.702) * [-884.951] (-886.597) (-883.078) (-884.823) -- 0:00:31
      488500 -- (-883.865) [-884.930] (-883.858) (-885.171) * (-883.989) (-886.356) [-886.112] (-884.374) -- 0:00:31
      489000 -- (-887.617) (-884.185) (-890.398) [-884.647] * (-887.553) (-885.924) (-887.909) [-882.949] -- 0:00:31
      489500 -- (-884.713) (-883.779) (-885.948) [-883.448] * (-886.944) (-884.691) [-885.182] (-884.760) -- 0:00:31
      490000 -- (-884.525) (-885.082) (-884.261) [-882.439] * (-884.670) [-884.065] (-885.103) (-884.937) -- 0:00:31

      Average standard deviation of split frequencies: 0.009890

      490500 -- [-883.813] (-886.449) (-887.477) (-884.743) * [-884.125] (-886.276) (-886.113) (-883.553) -- 0:00:31
      491000 -- (-889.214) [-883.887] (-885.509) (-884.212) * [-882.411] (-884.744) (-883.553) (-883.216) -- 0:00:31
      491500 -- [-885.518] (-882.852) (-890.300) (-883.217) * (-882.537) (-883.769) [-883.957] (-882.431) -- 0:00:32
      492000 -- [-885.708] (-884.632) (-886.719) (-885.116) * [-883.086] (-884.029) (-885.407) (-884.862) -- 0:00:32
      492500 -- (-886.113) [-885.814] (-884.715) (-888.357) * (-884.011) [-883.446] (-886.514) (-884.537) -- 0:00:31
      493000 -- (-884.219) (-883.654) [-882.626] (-883.857) * (-885.495) (-886.418) [-885.468] (-883.074) -- 0:00:31
      493500 -- (-888.276) (-884.639) (-882.457) [-883.001] * [-882.642] (-887.171) (-883.901) (-884.173) -- 0:00:31
      494000 -- (-889.361) [-883.644] (-882.438) (-884.504) * (-883.378) (-883.087) [-883.222] (-883.587) -- 0:00:31
      494500 -- (-885.093) (-883.091) [-884.552] (-882.873) * (-886.055) (-884.368) (-885.341) [-883.554] -- 0:00:31
      495000 -- (-884.093) (-883.125) (-886.657) [-883.378] * (-884.230) (-883.278) [-889.025] (-885.627) -- 0:00:31

      Average standard deviation of split frequencies: 0.009564

      495500 -- [-885.481] (-884.000) (-884.382) (-884.065) * (-886.342) (-884.859) [-885.066] (-885.330) -- 0:00:31
      496000 -- (-884.062) (-887.876) [-883.926] (-883.077) * (-884.800) (-886.572) (-885.236) [-884.799] -- 0:00:31
      496500 -- (-883.964) (-889.840) [-883.507] (-885.978) * (-885.289) (-885.199) [-884.488] (-888.719) -- 0:00:31
      497000 -- (-884.239) [-887.216] (-888.162) (-884.498) * (-883.079) (-884.111) (-883.237) [-885.836] -- 0:00:31
      497500 -- (-884.178) (-886.531) [-882.804] (-884.314) * (-884.094) (-884.214) [-883.548] (-885.079) -- 0:00:31
      498000 -- (-885.411) (-884.197) (-883.432) [-884.013] * (-884.084) (-884.840) [-883.205] (-884.777) -- 0:00:31
      498500 -- (-885.743) (-883.718) [-884.019] (-882.659) * [-884.557] (-886.970) (-885.209) (-883.947) -- 0:00:31
      499000 -- (-886.046) [-884.823] (-883.714) (-885.149) * (-883.782) [-884.858] (-883.469) (-885.409) -- 0:00:31
      499500 -- (-883.443) (-885.181) [-886.616] (-885.959) * [-883.172] (-888.322) (-883.968) (-885.472) -- 0:00:31
      500000 -- [-885.643] (-886.520) (-886.603) (-883.783) * (-883.006) (-883.731) (-885.504) [-883.063] -- 0:00:31

      Average standard deviation of split frequencies: 0.009667

      500500 -- [-883.204] (-884.357) (-887.092) (-883.569) * [-883.601] (-883.142) (-883.813) (-883.992) -- 0:00:30
      501000 -- (-884.127) [-883.680] (-886.494) (-891.204) * (-886.293) [-886.892] (-884.287) (-883.673) -- 0:00:30
      501500 -- (-888.416) (-888.106) (-887.680) [-885.163] * (-884.883) [-888.500] (-883.179) (-885.897) -- 0:00:30
      502000 -- (-887.143) (-886.341) (-888.983) [-886.884] * (-885.181) (-884.904) (-882.905) [-883.869] -- 0:00:30
      502500 -- [-885.582] (-883.474) (-884.961) (-885.945) * [-883.722] (-884.250) (-886.602) (-886.485) -- 0:00:30
      503000 -- (-884.156) [-889.160] (-884.434) (-888.199) * [-884.445] (-884.716) (-884.938) (-885.485) -- 0:00:30
      503500 -- (-889.261) (-887.368) [-884.691] (-885.749) * [-884.626] (-885.388) (-883.585) (-884.630) -- 0:00:30
      504000 -- [-884.483] (-889.824) (-884.248) (-884.948) * (-886.019) (-887.621) [-887.461] (-885.486) -- 0:00:30
      504500 -- (-882.384) [-883.062] (-883.383) (-883.671) * [-884.709] (-885.338) (-886.050) (-884.875) -- 0:00:30
      505000 -- (-886.190) (-885.669) (-883.814) [-884.569] * (-883.227) (-887.034) [-884.124] (-886.996) -- 0:00:30

      Average standard deviation of split frequencies: 0.009426

      505500 -- [-885.248] (-888.150) (-884.173) (-883.134) * [-885.598] (-887.476) (-884.394) (-887.395) -- 0:00:30
      506000 -- (-885.492) (-884.623) [-883.772] (-888.320) * (-887.607) [-886.398] (-885.422) (-886.539) -- 0:00:30
      506500 -- (-885.270) (-883.878) [-884.853] (-884.319) * (-885.982) (-884.778) [-883.627] (-885.750) -- 0:00:30
      507000 -- (-886.511) [-882.303] (-888.043) (-884.889) * [-885.662] (-886.807) (-883.864) (-891.625) -- 0:00:30
      507500 -- (-884.954) (-884.695) (-882.794) [-885.601] * (-884.289) (-887.729) (-885.316) [-883.402] -- 0:00:30
      508000 -- (-884.647) (-883.310) [-882.720] (-885.723) * (-884.820) (-884.779) [-883.329] (-885.466) -- 0:00:30
      508500 -- (-884.412) [-883.578] (-883.501) (-885.803) * (-885.879) (-884.896) (-885.384) [-886.359] -- 0:00:30
      509000 -- [-883.839] (-885.180) (-882.414) (-883.923) * (-885.481) (-885.532) (-882.958) [-886.501] -- 0:00:30
      509500 -- (-883.798) [-885.769] (-882.505) (-883.713) * [-887.868] (-885.390) (-886.183) (-886.862) -- 0:00:30
      510000 -- (-885.248) [-885.266] (-883.100) (-884.893) * (-888.391) (-886.641) (-883.592) [-885.327] -- 0:00:30

      Average standard deviation of split frequencies: 0.009937

      510500 -- (-885.369) [-883.822] (-884.774) (-885.335) * [-883.480] (-884.226) (-882.425) (-883.377) -- 0:00:30
      511000 -- (-887.982) (-884.891) (-885.222) [-887.393] * (-884.121) (-883.491) (-883.976) [-882.695] -- 0:00:30
      511500 -- (-887.373) (-884.627) (-885.959) [-883.962] * [-885.188] (-884.535) (-884.752) (-883.707) -- 0:00:30
      512000 -- [-886.217] (-886.311) (-883.820) (-884.664) * [-885.731] (-886.550) (-883.240) (-883.953) -- 0:00:30
      512500 -- [-884.711] (-884.390) (-884.643) (-889.319) * [-884.534] (-883.170) (-883.406) (-886.246) -- 0:00:30
      513000 -- (-887.308) (-885.664) (-884.065) [-883.064] * [-884.785] (-886.841) (-884.635) (-894.355) -- 0:00:30
      513500 -- [-885.392] (-883.778) (-884.211) (-884.257) * (-886.815) [-884.634] (-884.760) (-889.333) -- 0:00:30
      514000 -- (-883.987) (-883.684) [-889.003] (-885.141) * [-884.419] (-885.887) (-884.686) (-888.456) -- 0:00:30
      514500 -- (-884.703) [-883.661] (-885.053) (-884.134) * (-884.205) (-882.739) (-884.072) [-884.108] -- 0:00:30
      515000 -- (-884.783) [-886.964] (-882.710) (-883.252) * (-886.478) (-885.146) [-888.328] (-887.773) -- 0:00:30

      Average standard deviation of split frequencies: 0.010694

      515500 -- (-884.689) (-884.480) (-885.951) [-882.547] * (-884.157) (-883.768) (-885.170) [-884.001] -- 0:00:30
      516000 -- (-884.344) (-888.414) [-886.117] (-882.918) * (-885.892) [-884.431] (-887.767) (-884.842) -- 0:00:30
      516500 -- (-886.439) (-885.025) (-885.177) [-883.757] * (-890.876) [-885.372] (-883.455) (-883.411) -- 0:00:29
      517000 -- (-884.124) (-887.436) [-884.011] (-884.208) * (-885.232) (-883.596) [-884.052] (-885.562) -- 0:00:29
      517500 -- (-883.813) (-885.524) (-885.724) [-883.617] * (-883.789) (-884.851) (-883.669) [-886.579] -- 0:00:29
      518000 -- (-883.123) [-887.084] (-883.300) (-883.568) * (-884.473) (-884.322) [-883.597] (-886.731) -- 0:00:29
      518500 -- [-882.903] (-885.110) (-883.253) (-884.468) * [-883.576] (-885.379) (-885.827) (-886.958) -- 0:00:29
      519000 -- (-884.526) (-886.957) (-883.557) [-884.430] * [-884.314] (-885.793) (-886.573) (-886.149) -- 0:00:29
      519500 -- (-884.037) [-882.801] (-884.225) (-885.543) * (-885.752) (-884.311) (-886.600) [-892.767] -- 0:00:29
      520000 -- (-883.432) [-885.931] (-884.145) (-885.862) * (-884.828) [-884.991] (-883.925) (-887.468) -- 0:00:29

      Average standard deviation of split frequencies: 0.010978

      520500 -- (-885.391) (-889.640) [-884.950] (-885.271) * (-885.100) (-883.374) [-883.169] (-884.128) -- 0:00:29
      521000 -- [-883.502] (-884.006) (-883.353) (-885.184) * (-883.372) [-883.856] (-885.947) (-887.091) -- 0:00:29
      521500 -- (-886.173) [-883.976] (-882.532) (-884.397) * [-883.280] (-884.112) (-885.348) (-886.820) -- 0:00:29
      522000 -- (-886.934) [-883.740] (-884.537) (-883.776) * [-883.100] (-888.982) (-884.685) (-883.722) -- 0:00:29
      522500 -- (-886.136) [-883.269] (-887.672) (-884.535) * (-885.661) [-885.578] (-882.951) (-890.272) -- 0:00:29
      523000 -- [-887.395] (-882.452) (-884.720) (-886.244) * (-885.959) (-885.493) (-882.893) [-884.870] -- 0:00:29
      523500 -- (-887.794) [-884.571] (-882.448) (-884.008) * [-887.429] (-884.888) (-883.184) (-883.392) -- 0:00:29
      524000 -- (-894.038) (-883.205) [-883.686] (-884.479) * (-884.398) (-885.737) (-883.076) [-883.613] -- 0:00:29
      524500 -- (-885.216) [-884.421] (-883.914) (-884.411) * (-885.921) (-884.557) (-884.723) [-883.614] -- 0:00:29
      525000 -- (-885.745) (-886.698) (-884.165) [-885.349] * (-888.044) (-883.144) [-883.937] (-883.699) -- 0:00:29

      Average standard deviation of split frequencies: 0.010385

      525500 -- [-887.069] (-886.091) (-885.687) (-890.418) * (-885.166) (-887.371) [-886.178] (-885.748) -- 0:00:29
      526000 -- (-883.555) [-883.818] (-886.063) (-892.352) * (-886.907) (-883.714) [-883.791] (-888.492) -- 0:00:29
      526500 -- [-886.947] (-883.538) (-887.290) (-886.505) * (-885.555) [-882.842] (-882.821) (-892.576) -- 0:00:29
      527000 -- (-883.478) (-885.942) [-886.114] (-891.681) * (-884.826) (-882.855) [-884.190] (-885.260) -- 0:00:29
      527500 -- (-885.637) (-884.769) [-883.747] (-890.004) * [-885.031] (-884.703) (-884.956) (-884.965) -- 0:00:29
      528000 -- [-883.647] (-888.432) (-885.678) (-883.636) * (-886.489) (-883.776) [-885.885] (-884.873) -- 0:00:29
      528500 -- (-887.908) (-884.868) (-886.966) [-882.995] * (-886.262) (-883.275) [-883.291] (-883.733) -- 0:00:29
      529000 -- (-884.474) (-883.730) (-889.049) [-883.156] * (-886.821) (-888.622) (-885.265) [-883.608] -- 0:00:29
      529500 -- (-884.297) (-892.988) [-889.781] (-883.703) * (-885.309) [-888.473] (-884.133) (-882.926) -- 0:00:29
      530000 -- (-884.957) (-893.647) (-887.740) [-884.037] * (-883.835) (-884.405) (-884.869) [-883.296] -- 0:00:29

      Average standard deviation of split frequencies: 0.010271

      530500 -- (-882.708) (-886.842) [-882.852] (-884.826) * [-883.184] (-887.655) (-886.022) (-885.620) -- 0:00:29
      531000 -- (-882.829) [-884.734] (-885.546) (-886.183) * (-886.034) (-885.989) [-884.340] (-886.181) -- 0:00:29
      531500 -- (-894.142) [-884.043] (-885.997) (-882.898) * [-884.085] (-884.929) (-887.819) (-886.147) -- 0:00:29
      532000 -- (-883.521) (-883.878) (-892.065) [-883.928] * (-882.818) [-884.503] (-885.000) (-884.211) -- 0:00:29
      532500 -- (-882.734) [-885.459] (-885.619) (-883.906) * (-883.317) (-884.810) [-883.927] (-884.203) -- 0:00:28
      533000 -- (-882.957) [-884.802] (-885.965) (-883.678) * [-883.154] (-888.433) (-886.876) (-883.037) -- 0:00:28
      533500 -- [-885.945] (-888.852) (-887.355) (-886.690) * (-892.721) (-884.510) (-883.956) [-884.660] -- 0:00:28
      534000 -- (-884.654) (-884.681) (-882.725) [-887.628] * (-887.462) (-884.957) [-886.944] (-886.627) -- 0:00:28
      534500 -- [-884.022] (-883.119) (-886.132) (-887.441) * (-884.479) (-886.972) [-884.764] (-888.129) -- 0:00:28
      535000 -- (-884.441) [-883.916] (-885.416) (-885.924) * (-883.660) [-884.740] (-884.246) (-887.619) -- 0:00:28

      Average standard deviation of split frequencies: 0.010279

      535500 -- (-885.997) (-883.191) [-887.178] (-884.780) * (-887.842) [-883.911] (-884.383) (-883.649) -- 0:00:28
      536000 -- [-883.036] (-885.904) (-891.297) (-886.516) * [-887.769] (-884.245) (-887.581) (-883.453) -- 0:00:28
      536500 -- (-885.169) (-886.049) [-883.837] (-884.423) * (-885.271) (-884.437) [-883.878] (-887.988) -- 0:00:28
      537000 -- [-885.122] (-885.773) (-885.498) (-888.078) * (-888.411) (-885.725) [-884.078] (-882.856) -- 0:00:28
      537500 -- (-886.097) (-885.017) (-883.299) [-884.797] * [-888.169] (-882.805) (-882.809) (-883.920) -- 0:00:28
      538000 -- (-884.938) (-882.593) (-885.330) [-887.291] * (-887.410) (-883.134) [-882.914] (-885.126) -- 0:00:28
      538500 -- (-884.213) [-883.761] (-886.012) (-884.519) * (-884.369) (-886.022) (-883.303) [-885.089] -- 0:00:28
      539000 -- (-883.053) [-885.585] (-886.974) (-884.940) * (-885.167) (-889.858) (-883.361) [-883.471] -- 0:00:28
      539500 -- (-885.186) (-884.818) (-884.448) [-884.062] * (-886.192) (-884.326) (-883.350) [-883.735] -- 0:00:28
      540000 -- (-882.966) (-884.021) [-887.424] (-886.302) * (-886.501) (-885.840) [-884.563] (-885.323) -- 0:00:28

      Average standard deviation of split frequencies: 0.010081

      540500 -- (-883.679) (-886.638) [-884.889] (-883.706) * (-884.056) (-886.568) [-886.957] (-882.715) -- 0:00:28
      541000 -- (-885.129) (-886.171) [-883.200] (-885.727) * [-883.244] (-886.081) (-884.250) (-883.391) -- 0:00:27
      541500 -- [-883.678] (-885.916) (-882.690) (-884.091) * (-884.395) (-887.378) (-883.919) [-884.769] -- 0:00:27
      542000 -- (-884.508) (-885.922) (-882.628) [-883.257] * (-887.610) (-884.128) (-884.498) [-887.880] -- 0:00:28
      542500 -- (-884.453) (-883.850) (-883.091) [-884.450] * (-883.882) (-883.192) [-885.312] (-884.860) -- 0:00:28
      543000 -- (-887.680) [-883.885] (-888.165) (-883.134) * (-884.835) [-885.809] (-885.141) (-884.731) -- 0:00:28
      543500 -- (-888.447) (-883.131) [-888.017] (-883.920) * (-887.138) (-883.655) [-885.602] (-884.000) -- 0:00:28
      544000 -- (-884.367) [-884.648] (-883.699) (-883.953) * [-889.649] (-887.009) (-887.486) (-883.036) -- 0:00:28
      544500 -- [-884.027] (-884.463) (-885.924) (-885.900) * (-887.129) (-885.468) [-887.975] (-885.290) -- 0:00:28
      545000 -- (-883.590) [-883.085] (-883.391) (-887.714) * (-887.343) (-882.952) [-885.123] (-889.200) -- 0:00:28

      Average standard deviation of split frequencies: 0.010522

      545500 -- (-887.450) (-882.608) [-887.378] (-886.547) * (-886.873) [-883.020] (-887.101) (-886.327) -- 0:00:28
      546000 -- (-886.754) (-883.069) (-888.042) [-887.236] * (-884.334) [-886.846] (-883.944) (-884.269) -- 0:00:28
      546500 -- (-883.404) (-883.327) (-884.069) [-885.085] * [-883.639] (-884.854) (-888.690) (-883.523) -- 0:00:28
      547000 -- (-885.510) [-886.441] (-884.873) (-886.357) * (-883.677) (-884.757) (-896.037) [-884.578] -- 0:00:28
      547500 -- (-888.989) [-884.908] (-885.373) (-883.875) * (-883.485) (-884.413) [-884.759] (-883.390) -- 0:00:28
      548000 -- (-884.908) (-886.687) [-883.323] (-884.719) * [-882.770] (-885.554) (-882.689) (-883.345) -- 0:00:28
      548500 -- (-883.616) (-886.533) (-886.256) [-882.596] * (-883.311) (-885.428) (-888.274) [-885.592] -- 0:00:27
      549000 -- (-883.321) [-883.500] (-886.681) (-884.467) * [-884.958] (-882.891) (-885.474) (-885.816) -- 0:00:27
      549500 -- (-888.954) (-882.598) (-885.514) [-885.107] * (-890.668) [-882.930] (-884.005) (-884.580) -- 0:00:27
      550000 -- (-882.669) [-883.473] (-884.705) (-884.020) * (-886.180) (-882.420) [-884.217] (-885.536) -- 0:00:27

      Average standard deviation of split frequencies: 0.009738

      550500 -- (-883.388) [-883.645] (-883.902) (-887.472) * (-883.742) [-882.764] (-884.246) (-883.462) -- 0:00:27
      551000 -- (-883.880) [-884.568] (-891.108) (-883.678) * (-883.474) (-883.626) (-883.210) [-884.846] -- 0:00:27
      551500 -- (-882.749) [-884.053] (-891.153) (-885.113) * (-886.067) (-884.296) [-883.094] (-884.663) -- 0:00:27
      552000 -- (-883.972) (-884.838) (-884.270) [-884.752] * [-883.641] (-884.286) (-884.542) (-883.334) -- 0:00:27
      552500 -- (-886.028) [-885.921] (-882.992) (-884.639) * (-882.640) (-885.823) [-884.986] (-887.229) -- 0:00:27
      553000 -- [-884.124] (-892.792) (-883.467) (-887.403) * (-883.144) [-883.253] (-885.068) (-883.845) -- 0:00:27
      553500 -- (-883.029) (-884.492) (-887.099) [-883.435] * (-884.004) (-883.029) [-884.124] (-886.572) -- 0:00:27
      554000 -- (-883.701) (-883.508) (-886.116) [-883.143] * (-886.567) [-885.935] (-885.385) (-884.448) -- 0:00:27
      554500 -- (-885.189) [-883.680] (-883.714) (-882.960) * (-890.315) (-884.925) [-884.740] (-883.172) -- 0:00:27
      555000 -- [-883.537] (-884.115) (-885.186) (-884.860) * (-886.486) (-884.018) (-884.374) [-883.858] -- 0:00:27

      Average standard deviation of split frequencies: 0.009750

      555500 -- (-885.891) [-884.718] (-884.164) (-885.863) * [-883.735] (-884.980) (-884.118) (-885.876) -- 0:00:27
      556000 -- (-883.679) [-883.654] (-884.203) (-884.274) * (-885.235) (-882.909) (-884.556) [-883.462] -- 0:00:27
      556500 -- (-886.604) [-883.978] (-886.794) (-883.191) * (-886.255) (-886.730) (-883.632) [-885.966] -- 0:00:27
      557000 -- (-885.017) [-883.499] (-888.647) (-882.836) * (-889.030) (-887.574) (-884.911) [-887.487] -- 0:00:27
      557500 -- (-883.701) (-884.529) (-885.932) [-882.858] * (-883.793) (-883.415) (-883.633) [-883.911] -- 0:00:26
      558000 -- (-886.984) (-883.548) (-882.988) [-885.210] * (-883.748) (-883.569) [-883.875] (-884.781) -- 0:00:26
      558500 -- (-886.801) (-883.600) [-883.204] (-885.868) * (-892.621) (-885.381) (-883.575) [-883.726] -- 0:00:27
      559000 -- (-886.532) (-884.674) [-884.830] (-886.977) * (-884.279) (-885.168) [-885.062] (-884.826) -- 0:00:27
      559500 -- [-887.032] (-883.648) (-884.662) (-884.838) * (-884.848) (-888.006) (-883.000) [-884.777] -- 0:00:27
      560000 -- (-885.375) (-886.400) (-885.894) [-883.916] * (-890.305) [-883.405] (-884.708) (-885.203) -- 0:00:27

      Average standard deviation of split frequencies: 0.010300

      560500 -- (-882.990) [-884.370] (-884.464) (-883.834) * (-887.465) (-885.529) [-884.722] (-885.249) -- 0:00:27
      561000 -- (-882.838) (-886.124) [-884.213] (-883.774) * (-883.268) [-887.421] (-884.726) (-886.426) -- 0:00:27
      561500 -- (-884.400) (-885.070) (-885.268) [-884.106] * (-884.501) (-885.620) [-882.959] (-886.122) -- 0:00:27
      562000 -- [-885.366] (-887.403) (-882.880) (-882.658) * [-887.864] (-885.528) (-883.232) (-884.712) -- 0:00:27
      562500 -- (-883.866) [-885.845] (-883.602) (-884.740) * (-885.564) [-888.184] (-888.371) (-883.698) -- 0:00:27
      563000 -- [-882.387] (-883.780) (-882.948) (-882.437) * [-885.172] (-884.353) (-885.030) (-885.504) -- 0:00:27
      563500 -- (-884.744) (-885.052) (-883.196) [-888.252] * (-884.595) (-889.685) [-887.388] (-887.964) -- 0:00:27
      564000 -- [-884.728] (-884.521) (-882.525) (-882.880) * (-882.507) (-886.909) [-883.459] (-885.527) -- 0:00:27
      564500 -- [-884.906] (-884.723) (-885.199) (-883.061) * (-883.518) (-886.320) [-885.720] (-883.205) -- 0:00:27
      565000 -- (-888.713) (-884.737) (-884.493) [-883.503] * (-882.868) (-885.004) [-886.145] (-882.881) -- 0:00:26

      Average standard deviation of split frequencies: 0.009942

      565500 -- (-885.814) (-884.441) [-885.387] (-883.141) * (-882.606) (-885.325) [-884.973] (-883.358) -- 0:00:26
      566000 -- (-886.110) [-883.757] (-883.371) (-883.343) * [-883.871] (-887.054) (-884.657) (-885.745) -- 0:00:26
      566500 -- (-886.318) (-884.680) [-883.317] (-883.254) * (-884.101) (-885.397) (-882.683) [-885.062] -- 0:00:26
      567000 -- (-883.755) (-884.154) [-884.523] (-883.049) * [-884.531] (-885.690) (-883.930) (-885.457) -- 0:00:26
      567500 -- (-885.366) (-884.119) [-884.299] (-884.182) * (-884.291) (-884.673) (-884.751) [-883.580] -- 0:00:26
      568000 -- (-885.516) (-883.813) [-883.854] (-882.876) * (-886.086) [-884.266] (-884.653) (-883.794) -- 0:00:26
      568500 -- (-884.421) [-884.156] (-883.290) (-882.876) * (-885.034) (-884.197) [-886.030] (-886.436) -- 0:00:26
      569000 -- (-887.064) (-883.017) [-883.902] (-882.764) * (-883.873) (-885.220) (-883.831) [-888.768] -- 0:00:26
      569500 -- [-887.724] (-889.026) (-883.632) (-885.525) * (-884.657) [-886.972] (-883.723) (-886.773) -- 0:00:26
      570000 -- (-884.189) [-884.969] (-885.512) (-886.391) * (-884.933) [-885.167] (-883.111) (-885.388) -- 0:00:26

      Average standard deviation of split frequencies: 0.009500

      570500 -- (-886.071) (-885.611) [-887.792] (-884.467) * [-883.699] (-888.697) (-885.272) (-888.620) -- 0:00:26
      571000 -- (-887.210) [-885.969] (-885.746) (-882.973) * (-883.868) (-885.822) [-883.577] (-888.104) -- 0:00:26
      571500 -- (-887.388) (-887.250) (-886.511) [-883.807] * (-884.900) (-882.381) [-883.739] (-885.397) -- 0:00:26
      572000 -- (-886.566) (-883.848) (-888.379) [-883.161] * (-883.484) [-882.750] (-883.784) (-886.912) -- 0:00:26
      572500 -- (-885.913) (-884.162) [-884.910] (-883.161) * (-884.396) (-885.548) (-883.727) [-887.041] -- 0:00:26
      573000 -- (-886.368) [-883.806] (-885.913) (-883.386) * (-889.353) (-884.068) (-884.916) [-883.423] -- 0:00:26
      573500 -- (-883.381) (-883.665) [-884.216] (-888.756) * (-884.194) [-883.375] (-886.541) (-884.703) -- 0:00:26
      574000 -- [-884.126] (-883.547) (-887.180) (-888.465) * (-888.963) (-884.421) [-884.215] (-885.940) -- 0:00:25
      574500 -- [-884.655] (-884.707) (-888.473) (-886.398) * (-883.955) (-886.271) [-883.399] (-885.870) -- 0:00:25
      575000 -- (-883.615) (-884.603) (-884.221) [-884.979] * (-882.732) (-886.388) (-885.424) [-884.280] -- 0:00:25

      Average standard deviation of split frequencies: 0.008951

      575500 -- (-882.981) (-884.291) (-886.658) [-884.241] * [-882.492] (-884.619) (-888.474) (-883.664) -- 0:00:26
      576000 -- [-885.974] (-885.031) (-883.886) (-885.366) * [-883.304] (-882.912) (-883.782) (-883.706) -- 0:00:26
      576500 -- (-884.089) (-888.100) [-884.630] (-885.851) * (-886.721) [-883.325] (-883.145) (-885.300) -- 0:00:26
      577000 -- (-884.742) (-885.235) (-887.732) [-885.147] * (-886.454) [-885.495] (-883.374) (-883.014) -- 0:00:26
      577500 -- (-886.575) [-884.398] (-883.576) (-884.425) * (-888.399) [-884.681] (-884.604) (-884.298) -- 0:00:26
      578000 -- (-885.116) [-888.625] (-883.871) (-882.854) * (-886.329) [-890.841] (-882.577) (-884.478) -- 0:00:26
      578500 -- [-888.368] (-887.816) (-887.499) (-883.049) * [-884.331] (-889.153) (-883.125) (-884.593) -- 0:00:26
      579000 -- (-885.640) (-884.088) [-884.278] (-884.858) * (-883.147) [-883.782] (-891.157) (-885.915) -- 0:00:26
      579500 -- [-883.151] (-882.708) (-884.990) (-886.077) * [-884.069] (-883.283) (-887.445) (-883.587) -- 0:00:26
      580000 -- (-883.258) (-885.160) (-884.614) [-884.273] * (-885.449) [-884.374] (-886.284) (-883.746) -- 0:00:26

      Average standard deviation of split frequencies: 0.008575

      580500 -- (-885.017) (-885.973) (-886.025) [-884.683] * (-884.154) (-882.940) [-887.945] (-884.825) -- 0:00:26
      581000 -- [-885.965] (-885.470) (-884.832) (-884.032) * (-885.725) [-884.843] (-885.854) (-886.252) -- 0:00:25
      581500 -- (-886.851) (-884.535) [-886.451] (-884.713) * [-884.774] (-885.068) (-884.483) (-885.671) -- 0:00:25
      582000 -- (-884.296) (-883.603) (-886.554) [-883.123] * [-883.538] (-884.218) (-887.127) (-885.959) -- 0:00:25
      582500 -- (-883.912) (-883.794) (-886.546) [-884.005] * [-886.690] (-884.973) (-883.288) (-883.152) -- 0:00:25
      583000 -- (-884.893) [-883.925] (-887.438) (-884.163) * (-883.348) [-888.667] (-883.249) (-883.138) -- 0:00:25
      583500 -- (-884.425) [-884.859] (-883.431) (-884.522) * (-883.293) (-886.683) (-884.752) [-884.412] -- 0:00:25
      584000 -- [-885.271] (-884.797) (-887.747) (-885.718) * (-887.318) (-885.892) [-884.990] (-883.284) -- 0:00:25
      584500 -- (-885.838) (-887.015) [-883.446] (-888.027) * (-891.556) (-885.293) (-886.866) [-883.713] -- 0:00:25
      585000 -- (-883.100) (-885.817) [-885.239] (-883.167) * (-885.633) (-888.669) [-884.992] (-883.054) -- 0:00:25

      Average standard deviation of split frequencies: 0.008346

      585500 -- [-882.639] (-886.161) (-882.859) (-885.669) * (-884.652) [-886.128] (-884.204) (-882.543) -- 0:00:25
      586000 -- [-883.826] (-885.479) (-884.301) (-884.667) * (-883.424) (-885.243) (-884.205) [-885.446] -- 0:00:25
      586500 -- (-886.944) (-885.154) [-890.119] (-886.074) * (-883.420) (-887.433) (-883.960) [-885.514] -- 0:00:25
      587000 -- (-883.876) (-883.625) [-883.678] (-887.196) * (-883.945) (-883.571) (-882.421) [-884.662] -- 0:00:25
      587500 -- [-884.993] (-885.501) (-883.820) (-884.940) * (-886.792) [-883.396] (-883.151) (-882.994) -- 0:00:25
      588000 -- (-883.803) [-884.707] (-887.260) (-887.173) * (-886.415) (-883.351) [-884.956] (-884.156) -- 0:00:25
      588500 -- [-886.025] (-885.688) (-883.635) (-887.468) * (-884.247) [-885.199] (-884.181) (-884.126) -- 0:00:25
      589000 -- (-886.348) (-885.455) [-885.147] (-886.515) * [-885.935] (-885.698) (-884.054) (-883.936) -- 0:00:25
      589500 -- (-883.961) [-886.343] (-884.370) (-884.628) * [-885.773] (-882.857) (-885.026) (-884.156) -- 0:00:25
      590000 -- [-884.378] (-885.240) (-884.036) (-883.406) * (-883.715) [-886.369] (-886.801) (-886.321) -- 0:00:25

      Average standard deviation of split frequencies: 0.008979

      590500 -- (-884.953) (-889.365) (-893.914) [-886.276] * (-884.089) [-886.008] (-885.840) (-885.053) -- 0:00:24
      591000 -- (-884.273) [-883.837] (-883.882) (-887.510) * [-884.274] (-885.502) (-885.096) (-884.841) -- 0:00:24
      591500 -- (-886.013) (-885.626) [-884.182] (-884.174) * (-886.445) (-887.336) (-884.008) [-885.267] -- 0:00:24
      592000 -- (-882.560) (-883.860) (-882.905) [-885.963] * (-885.554) [-883.992] (-886.027) (-887.452) -- 0:00:25
      592500 -- [-882.577] (-885.994) (-891.086) (-884.830) * (-883.450) (-884.836) [-883.737] (-887.020) -- 0:00:25
      593000 -- (-885.596) (-886.104) [-882.562] (-891.336) * (-885.073) (-883.251) [-886.106] (-887.579) -- 0:00:25
      593500 -- (-887.315) [-884.661] (-884.014) (-890.672) * (-886.499) [-882.932] (-882.710) (-883.927) -- 0:00:25
      594000 -- (-885.365) (-884.245) (-884.267) [-883.927] * (-885.426) (-882.786) (-883.635) [-885.177] -- 0:00:25
      594500 -- (-882.837) (-883.418) [-883.963] (-883.034) * (-884.418) [-883.174] (-882.571) (-884.825) -- 0:00:25
      595000 -- (-889.698) [-884.736] (-891.038) (-892.821) * (-885.487) (-884.475) (-882.824) [-883.621] -- 0:00:25

      Average standard deviation of split frequencies: 0.008651

      595500 -- (-886.183) (-884.614) (-883.631) [-882.519] * (-888.248) (-885.408) [-882.808] (-884.496) -- 0:00:25
      596000 -- (-885.972) (-884.765) (-885.116) [-882.689] * (-884.112) (-885.432) (-883.447) [-888.025] -- 0:00:25
      596500 -- [-883.464] (-884.507) (-885.980) (-885.228) * [-883.914] (-887.419) (-884.053) (-886.432) -- 0:00:25
      597000 -- [-888.321] (-883.064) (-884.343) (-885.553) * [-882.984] (-886.440) (-884.084) (-884.663) -- 0:00:24
      597500 -- (-887.198) [-883.701] (-883.959) (-886.959) * (-883.295) (-887.339) (-884.891) [-885.345] -- 0:00:24
      598000 -- (-884.780) (-885.215) [-888.564] (-884.583) * [-886.031] (-884.532) (-886.022) (-883.923) -- 0:00:24
      598500 -- (-890.212) (-884.532) (-884.798) [-884.960] * [-885.442] (-884.998) (-886.545) (-883.984) -- 0:00:24
      599000 -- (-889.291) (-882.998) (-883.878) [-884.571] * (-884.124) (-886.913) (-884.106) [-886.360] -- 0:00:24
      599500 -- (-884.196) (-883.138) (-884.667) [-884.775] * (-885.274) (-889.025) [-884.326] (-886.639) -- 0:00:24
      600000 -- [-882.746] (-886.331) (-883.238) (-890.130) * [-884.496] (-883.305) (-886.873) (-883.029) -- 0:00:24

      Average standard deviation of split frequencies: 0.008005

      600500 -- (-884.892) (-885.016) (-894.405) [-884.656] * (-885.104) (-886.204) (-884.600) [-885.117] -- 0:00:24
      601000 -- (-888.193) (-892.160) (-885.104) [-883.272] * (-885.282) (-883.790) (-884.299) [-884.089] -- 0:00:24
      601500 -- (-883.544) (-883.052) (-887.614) [-882.810] * (-885.491) [-885.034] (-883.847) (-884.097) -- 0:00:24
      602000 -- (-884.928) [-885.705] (-886.134) (-885.554) * (-887.070) (-887.978) [-883.861] (-884.071) -- 0:00:24
      602500 -- [-885.179] (-885.523) (-890.744) (-885.510) * (-885.293) (-887.478) (-885.660) [-884.266] -- 0:00:24
      603000 -- [-883.097] (-884.163) (-883.263) (-887.738) * (-885.393) (-885.743) (-886.184) [-883.765] -- 0:00:24
      603500 -- (-885.387) [-884.767] (-882.403) (-884.797) * [-884.197] (-885.876) (-883.832) (-884.569) -- 0:00:24
      604000 -- [-883.455] (-883.590) (-885.515) (-884.999) * (-883.329) (-888.710) [-883.116] (-883.810) -- 0:00:24
      604500 -- [-883.294] (-884.967) (-884.874) (-883.765) * (-886.269) (-888.803) [-883.882] (-885.065) -- 0:00:24
      605000 -- (-886.932) [-884.466] (-888.896) (-886.328) * (-883.216) (-886.007) [-886.504] (-884.201) -- 0:00:24

      Average standard deviation of split frequencies: 0.008246

      605500 -- [-882.626] (-884.353) (-883.186) (-886.918) * [-884.167] (-886.671) (-885.766) (-883.907) -- 0:00:24
      606000 -- [-884.436] (-885.368) (-885.195) (-885.516) * (-884.075) (-883.807) (-885.821) [-885.000] -- 0:00:24
      606500 -- (-885.386) [-884.750] (-885.173) (-883.158) * [-884.855] (-885.689) (-885.358) (-883.464) -- 0:00:24
      607000 -- (-883.023) [-885.106] (-887.636) (-893.370) * (-884.609) (-883.212) (-885.077) [-883.241] -- 0:00:23
      607500 -- (-884.047) (-886.978) [-885.220] (-886.199) * (-889.411) (-884.438) [-884.822] (-884.725) -- 0:00:23
      608000 -- (-883.013) (-883.207) [-884.327] (-885.569) * (-883.305) (-884.772) (-883.178) [-884.631] -- 0:00:23
      608500 -- (-886.539) (-884.245) (-884.814) [-888.740] * [-883.734] (-884.603) (-888.513) (-886.057) -- 0:00:24
      609000 -- (-883.932) (-887.222) (-883.512) [-883.229] * [-882.660] (-884.701) (-886.295) (-885.313) -- 0:00:24
      609500 -- (-884.673) [-885.023] (-883.546) (-883.939) * (-883.711) [-884.865] (-884.644) (-883.421) -- 0:00:24
      610000 -- (-883.008) (-885.401) (-883.466) [-883.033] * (-884.519) [-885.678] (-884.156) (-883.539) -- 0:00:24

      Average standard deviation of split frequencies: 0.008080

      610500 -- (-886.073) (-883.955) (-883.410) [-883.853] * (-885.511) [-884.701] (-884.847) (-886.781) -- 0:00:24
      611000 -- (-884.541) (-883.490) (-886.256) [-885.043] * (-885.244) (-882.547) [-883.225] (-883.320) -- 0:00:24
      611500 -- (-887.225) [-883.661] (-883.922) (-884.304) * (-883.618) (-884.299) (-884.079) [-882.581] -- 0:00:24
      612000 -- (-887.960) [-884.262] (-885.887) (-885.068) * [-884.871] (-889.796) (-886.210) (-884.545) -- 0:00:24
      612500 -- (-892.017) [-885.177] (-886.943) (-883.823) * (-884.069) (-886.097) (-887.839) [-883.143] -- 0:00:24
      613000 -- [-888.447] (-885.069) (-883.500) (-883.390) * (-882.673) (-883.861) [-883.566] (-882.415) -- 0:00:23
      613500 -- (-883.466) (-888.610) (-884.033) [-884.283] * [-883.059] (-890.248) (-885.314) (-884.246) -- 0:00:23
      614000 -- [-883.301] (-886.056) (-884.545) (-890.597) * (-884.873) [-888.484] (-884.044) (-883.953) -- 0:00:23
      614500 -- [-883.162] (-883.614) (-883.275) (-884.907) * (-886.246) (-886.065) (-883.558) [-882.292] -- 0:00:23
      615000 -- (-883.432) (-884.174) [-883.158] (-884.513) * (-886.734) (-887.419) [-883.790] (-883.456) -- 0:00:23

      Average standard deviation of split frequencies: 0.007959

      615500 -- (-886.653) (-883.194) [-884.621] (-885.280) * (-883.005) (-887.339) [-883.283] (-882.858) -- 0:00:23
      616000 -- (-888.649) (-883.791) [-883.664] (-885.037) * [-884.358] (-886.618) (-892.047) (-882.705) -- 0:00:23
      616500 -- (-883.289) (-883.919) (-888.012) [-884.843] * (-882.409) [-885.408] (-889.201) (-885.653) -- 0:00:23
      617000 -- [-884.107] (-886.318) (-886.089) (-891.317) * [-883.049] (-885.598) (-885.217) (-885.071) -- 0:00:23
      617500 -- (-884.571) (-884.639) [-886.621] (-887.736) * (-889.166) (-885.405) [-883.944] (-883.203) -- 0:00:23
      618000 -- (-884.535) (-887.602) [-886.062] (-887.278) * (-885.997) (-883.552) (-890.289) [-882.610] -- 0:00:23
      618500 -- (-887.119) (-885.219) (-885.617) [-882.795] * (-883.775) (-886.112) (-888.558) [-885.282] -- 0:00:23
      619000 -- [-885.735] (-885.447) (-888.472) (-883.796) * (-883.657) [-887.685] (-883.303) (-882.938) -- 0:00:23
      619500 -- (-885.439) (-886.693) [-885.185] (-884.139) * [-884.366] (-888.586) (-885.835) (-885.946) -- 0:00:23
      620000 -- (-885.860) (-883.561) (-884.792) [-885.196] * (-883.407) [-883.201] (-887.171) (-882.623) -- 0:00:23

      Average standard deviation of split frequencies: 0.007595

      620500 -- [-887.879] (-888.678) (-884.891) (-883.530) * (-887.069) (-882.702) (-886.248) [-884.157] -- 0:00:23
      621000 -- [-884.183] (-884.540) (-884.263) (-890.094) * (-885.923) (-882.548) [-883.398] (-884.181) -- 0:00:23
      621500 -- (-883.660) (-885.200) (-884.417) [-887.862] * (-883.716) (-883.719) [-882.649] (-883.995) -- 0:00:23
      622000 -- (-885.143) (-883.704) (-886.427) [-884.302] * (-885.413) (-885.053) (-883.377) [-885.820] -- 0:00:23
      622500 -- (-883.783) (-885.455) [-883.789] (-884.025) * (-886.852) (-885.964) [-883.778] (-884.905) -- 0:00:23
      623000 -- (-882.745) [-883.903] (-885.697) (-883.864) * [-884.601] (-885.841) (-883.333) (-883.380) -- 0:00:22
      623500 -- (-883.315) [-884.451] (-884.700) (-886.316) * (-888.648) (-886.239) [-886.651] (-886.612) -- 0:00:22
      624000 -- (-883.580) (-884.081) (-885.937) [-886.685] * [-885.482] (-883.196) (-884.291) (-883.801) -- 0:00:22
      624500 -- (-882.977) (-885.863) [-883.919] (-885.069) * (-884.649) (-885.346) [-885.050] (-892.950) -- 0:00:22
      625000 -- (-884.599) (-884.577) (-886.510) [-885.907] * (-884.357) (-884.692) [-887.555] (-883.172) -- 0:00:22

      Average standard deviation of split frequencies: 0.007279

      625500 -- (-885.200) (-882.985) [-884.744] (-884.348) * [-886.464] (-884.475) (-885.730) (-886.445) -- 0:00:23
      626000 -- (-883.749) (-885.886) [-883.730] (-887.354) * (-886.779) (-882.875) [-885.591] (-884.926) -- 0:00:23
      626500 -- (-886.864) (-886.601) (-884.085) [-885.856] * (-884.266) (-883.611) [-883.081] (-882.930) -- 0:00:23
      627000 -- (-888.183) (-885.254) [-885.862] (-884.227) * (-882.794) (-883.030) (-886.912) [-883.853] -- 0:00:23
      627500 -- [-884.746] (-882.978) (-883.372) (-886.054) * [-882.731] (-882.897) (-889.999) (-883.920) -- 0:00:23
      628000 -- (-886.290) (-883.866) (-885.759) [-883.651] * (-884.317) [-882.448] (-891.810) (-885.880) -- 0:00:23
      628500 -- [-885.844] (-884.492) (-883.733) (-883.161) * [-882.737] (-884.257) (-891.800) (-883.868) -- 0:00:23
      629000 -- (-884.499) (-884.231) [-883.755] (-883.798) * (-884.537) (-885.895) [-886.726] (-885.879) -- 0:00:23
      629500 -- (-886.612) (-883.339) [-886.920] (-887.371) * (-883.765) (-883.672) [-885.143] (-886.202) -- 0:00:22
      630000 -- (-884.090) (-885.973) [-882.946] (-885.135) * (-883.999) (-885.901) [-884.133] (-883.087) -- 0:00:22

      Average standard deviation of split frequencies: 0.007774

      630500 -- (-885.852) (-883.642) (-883.552) [-885.805] * [-885.133] (-885.252) (-885.497) (-884.057) -- 0:00:22
      631000 -- (-884.749) [-882.375] (-883.410) (-883.631) * (-884.061) (-885.962) [-884.690] (-883.620) -- 0:00:22
      631500 -- (-885.269) [-884.109] (-883.392) (-884.155) * (-882.851) [-885.336] (-884.814) (-883.598) -- 0:00:22
      632000 -- (-884.150) [-883.007] (-884.240) (-884.351) * (-885.224) (-886.290) (-886.003) [-888.133] -- 0:00:22
      632500 -- (-885.995) (-883.551) [-885.042] (-884.690) * (-885.516) (-885.674) [-883.826] (-888.061) -- 0:00:22
      633000 -- (-887.065) (-884.689) [-885.556] (-884.090) * (-883.717) [-885.635] (-883.452) (-883.951) -- 0:00:22
      633500 -- (-885.608) (-884.715) [-883.939] (-884.961) * (-888.606) [-884.160] (-884.005) (-884.429) -- 0:00:22
      634000 -- [-888.631] (-886.418) (-886.610) (-883.318) * (-883.942) (-887.108) (-889.195) [-884.047] -- 0:00:22
      634500 -- (-884.019) (-886.261) (-884.740) [-883.731] * [-889.181] (-886.018) (-883.878) (-884.364) -- 0:00:22
      635000 -- (-885.124) (-882.684) [-883.275] (-890.116) * (-884.918) (-886.114) [-882.725] (-886.805) -- 0:00:22

      Average standard deviation of split frequencies: 0.007116

      635500 -- (-887.754) (-882.977) (-884.017) [-884.325] * (-882.487) (-883.724) [-883.942] (-886.156) -- 0:00:22
      636000 -- (-886.096) (-884.985) (-884.581) [-884.400] * (-882.461) (-884.841) (-882.510) [-886.801] -- 0:00:22
      636500 -- (-891.319) (-883.982) (-885.909) [-886.166] * [-883.208] (-883.214) (-885.960) (-885.724) -- 0:00:22
      637000 -- (-885.820) [-882.529] (-884.172) (-885.565) * (-884.280) [-892.534] (-888.872) (-885.225) -- 0:00:22
      637500 -- (-890.945) [-884.157] (-886.078) (-885.422) * [-883.318] (-886.033) (-884.032) (-884.710) -- 0:00:22
      638000 -- (-884.517) [-886.220] (-884.831) (-884.404) * [-883.768] (-886.014) (-885.146) (-885.005) -- 0:00:22
      638500 -- [-885.552] (-885.672) (-885.003) (-885.320) * (-884.969) [-884.046] (-890.016) (-887.289) -- 0:00:22
      639000 -- (-887.225) (-883.538) (-885.657) [-882.568] * (-887.127) [-882.951] (-882.814) (-883.083) -- 0:00:22
      639500 -- (-888.890) (-883.033) (-885.717) [-883.904] * (-882.856) (-885.949) (-883.657) [-885.496] -- 0:00:21
      640000 -- (-886.272) [-883.334] (-885.720) (-889.353) * (-883.239) [-884.019] (-883.591) (-883.763) -- 0:00:21

      Average standard deviation of split frequencies: 0.007309

      640500 -- (-887.219) (-886.591) [-883.049] (-884.253) * (-885.215) (-886.800) [-882.367] (-885.686) -- 0:00:21
      641000 -- (-883.876) (-884.255) [-885.134] (-884.312) * (-885.106) (-885.599) [-882.198] (-882.926) -- 0:00:21
      641500 -- [-885.107] (-882.385) (-890.459) (-884.376) * (-887.915) (-883.566) [-884.571] (-884.876) -- 0:00:21
      642000 -- (-885.041) (-883.800) (-885.919) [-884.972] * (-883.162) [-882.793] (-883.870) (-884.082) -- 0:00:22
      642500 -- [-888.012] (-883.187) (-885.427) (-883.779) * (-883.568) (-891.116) [-885.683] (-883.484) -- 0:00:22
      643000 -- (-884.176) (-883.001) (-887.897) [-884.147] * (-884.434) [-889.793] (-884.294) (-894.013) -- 0:00:22
      643500 -- [-883.187] (-883.135) (-885.102) (-885.971) * (-883.572) (-887.453) [-884.283] (-893.839) -- 0:00:22
      644000 -- (-887.106) (-884.852) [-883.940] (-885.809) * (-883.248) (-884.486) [-884.470] (-888.112) -- 0:00:22
      644500 -- (-885.947) (-883.292) [-886.167] (-890.925) * (-884.606) (-884.864) (-886.931) [-886.070] -- 0:00:22
      645000 -- (-885.067) (-885.360) [-885.476] (-885.849) * (-884.198) (-886.433) (-884.179) [-883.814] -- 0:00:22

      Average standard deviation of split frequencies: 0.007434

      645500 -- (-883.998) [-888.565] (-884.118) (-890.278) * (-884.965) (-891.032) [-885.058] (-885.234) -- 0:00:21
      646000 -- (-884.452) [-883.799] (-884.020) (-889.940) * [-885.044] (-885.579) (-886.056) (-886.405) -- 0:00:21
      646500 -- (-883.506) (-885.916) (-883.107) [-883.764] * (-884.080) (-883.302) (-884.595) [-884.677] -- 0:00:21
      647000 -- (-883.001) [-884.146] (-887.249) (-883.405) * (-885.729) (-885.710) [-883.364] (-883.835) -- 0:00:21
      647500 -- (-889.916) (-886.407) (-885.470) [-883.251] * (-884.244) [-883.915] (-886.921) (-889.668) -- 0:00:21
      648000 -- (-891.089) (-883.173) [-885.498] (-883.525) * [-890.202] (-885.155) (-891.356) (-884.618) -- 0:00:21
      648500 -- (-886.130) [-882.678] (-886.185) (-883.289) * (-882.953) (-884.134) [-886.055] (-888.051) -- 0:00:21
      649000 -- (-883.299) [-883.355] (-887.459) (-883.980) * (-888.558) (-884.533) (-884.032) [-888.195] -- 0:00:21
      649500 -- [-884.844] (-884.433) (-886.244) (-885.299) * [-883.473] (-885.668) (-883.812) (-883.936) -- 0:00:21
      650000 -- (-883.507) (-888.645) [-882.501] (-885.133) * (-884.497) (-884.796) [-884.349] (-883.354) -- 0:00:21

      Average standard deviation of split frequencies: 0.007438

      650500 -- (-885.875) [-888.091] (-883.423) (-885.768) * (-886.662) (-887.603) [-883.917] (-883.161) -- 0:00:21
      651000 -- [-882.831] (-884.835) (-885.885) (-883.409) * (-883.244) (-883.553) (-883.825) [-882.366] -- 0:00:21
      651500 -- (-885.614) (-887.175) [-884.185] (-885.111) * (-885.497) [-883.855] (-885.526) (-885.779) -- 0:00:21
      652000 -- (-884.410) [-885.024] (-885.934) (-884.997) * (-884.643) [-883.075] (-886.003) (-883.114) -- 0:00:21
      652500 -- (-886.771) (-883.887) (-884.892) [-886.638] * (-885.279) (-882.849) [-882.972] (-884.573) -- 0:00:21
      653000 -- (-887.645) (-884.827) (-884.426) [-883.445] * [-883.049] (-883.724) (-882.755) (-884.306) -- 0:00:21
      653500 -- (-887.016) (-888.066) [-883.007] (-888.322) * (-886.005) [-886.199] (-883.851) (-883.166) -- 0:00:21
      654000 -- (-883.967) [-887.460] (-883.553) (-886.359) * [-884.985] (-884.288) (-885.809) (-883.518) -- 0:00:21
      654500 -- (-883.782) (-883.369) (-884.779) [-882.780] * (-887.382) (-883.312) (-884.084) [-884.877] -- 0:00:21
      655000 -- (-883.523) (-883.904) (-886.961) [-883.463] * [-886.808] (-882.904) (-886.875) (-884.718) -- 0:00:21

      Average standard deviation of split frequencies: 0.007330

      655500 -- [-884.062] (-884.666) (-883.153) (-883.301) * (-883.414) (-884.343) (-887.005) [-885.750] -- 0:00:21
      656000 -- (-885.007) (-885.702) (-887.599) [-883.656] * (-883.982) (-883.481) [-884.199] (-885.626) -- 0:00:20
      656500 -- [-883.757] (-884.872) (-885.933) (-883.609) * [-885.749] (-885.304) (-886.135) (-882.504) -- 0:00:20
      657000 -- (-884.311) [-886.630] (-885.571) (-883.593) * (-884.599) (-886.180) [-883.754] (-882.830) -- 0:00:20
      657500 -- (-886.039) [-884.336] (-885.137) (-888.343) * (-883.603) (-886.571) (-884.256) [-884.630] -- 0:00:20
      658000 -- (-885.249) (-883.937) [-886.448] (-882.702) * (-883.551) (-883.215) [-883.910] (-884.764) -- 0:00:20
      658500 -- (-883.947) [-883.198] (-888.721) (-882.922) * (-886.072) (-882.972) [-886.807] (-886.021) -- 0:00:21
      659000 -- [-884.495] (-884.340) (-886.176) (-884.801) * (-884.291) [-883.909] (-885.758) (-885.554) -- 0:00:21
      659500 -- (-884.098) (-887.786) [-886.638] (-886.934) * [-883.993] (-883.999) (-886.532) (-884.002) -- 0:00:21
      660000 -- (-887.893) (-885.266) (-883.699) [-886.313] * (-883.460) (-882.813) [-883.922] (-884.866) -- 0:00:21

      Average standard deviation of split frequencies: 0.007326

      660500 -- (-884.590) (-885.519) [-883.301] (-886.719) * (-882.746) [-883.274] (-883.304) (-883.422) -- 0:00:21
      661000 -- (-886.906) (-884.713) (-883.774) [-884.409] * (-883.430) (-887.358) [-886.293] (-884.449) -- 0:00:21
      661500 -- (-883.306) (-884.556) [-884.094] (-882.559) * (-883.552) [-888.778] (-884.415) (-884.185) -- 0:00:20
      662000 -- (-885.487) (-884.747) [-882.967] (-886.534) * (-885.925) [-884.881] (-884.025) (-884.128) -- 0:00:20
      662500 -- [-884.099] (-884.865) (-883.529) (-883.124) * (-888.168) (-885.352) (-883.726) [-886.275] -- 0:00:20
      663000 -- [-885.289] (-883.726) (-884.725) (-883.121) * (-891.151) (-886.101) [-883.472] (-885.055) -- 0:00:20
      663500 -- (-886.663) [-884.456] (-886.440) (-883.273) * (-883.931) [-883.435] (-884.416) (-884.137) -- 0:00:20
      664000 -- (-889.804) [-886.047] (-884.699) (-887.059) * [-883.815] (-883.807) (-883.994) (-883.455) -- 0:00:20
      664500 -- [-885.992] (-885.611) (-886.030) (-885.917) * (-883.280) [-885.656] (-883.363) (-883.953) -- 0:00:20
      665000 -- (-883.724) (-885.961) [-885.134] (-886.631) * (-884.736) (-886.454) [-886.501] (-882.933) -- 0:00:20

      Average standard deviation of split frequencies: 0.007125

      665500 -- (-884.759) [-883.833] (-887.617) (-885.223) * [-883.163] (-882.327) (-888.540) (-887.879) -- 0:00:20
      666000 -- (-884.698) (-886.722) (-892.174) [-884.104] * [-883.901] (-883.553) (-884.695) (-886.307) -- 0:00:20
      666500 -- (-887.488) (-884.910) (-883.839) [-888.433] * (-884.461) (-884.568) (-886.130) [-885.311] -- 0:00:20
      667000 -- (-888.416) (-884.869) [-889.000] (-882.927) * [-883.194] (-883.813) (-888.373) (-885.692) -- 0:00:20
      667500 -- (-883.871) [-888.155] (-886.338) (-884.332) * (-883.388) (-883.024) (-885.284) [-883.658] -- 0:00:20
      668000 -- (-884.638) [-884.544] (-884.146) (-886.520) * (-884.858) (-885.654) (-884.913) [-884.108] -- 0:00:20
      668500 -- (-885.061) (-885.138) (-882.921) [-883.533] * (-883.771) (-883.892) [-884.344] (-888.070) -- 0:00:20
      669000 -- (-888.223) (-884.056) [-885.162] (-884.357) * [-883.245] (-883.625) (-883.966) (-885.521) -- 0:00:20
      669500 -- (-887.378) (-889.329) (-884.416) [-883.367] * (-882.567) (-884.939) (-883.418) [-885.467] -- 0:00:20
      670000 -- (-884.650) (-885.224) (-884.354) [-883.462] * (-886.792) [-884.064] (-884.075) (-892.478) -- 0:00:20

      Average standard deviation of split frequencies: 0.007357

      670500 -- (-885.166) (-883.813) (-883.864) [-884.552] * [-885.333] (-882.737) (-883.831) (-885.891) -- 0:00:20
      671000 -- (-887.335) (-883.287) (-883.781) [-886.119] * [-883.912] (-882.973) (-884.122) (-887.261) -- 0:00:20
      671500 -- (-886.681) [-884.041] (-883.246) (-886.611) * (-883.308) [-882.976] (-885.806) (-887.864) -- 0:00:20
      672000 -- (-886.443) (-884.380) [-884.435] (-884.117) * (-883.971) [-883.780] (-885.683) (-885.298) -- 0:00:20
      672500 -- (-885.863) (-887.252) (-886.773) [-884.117] * (-883.637) [-885.754] (-883.755) (-886.784) -- 0:00:19
      673000 -- (-883.895) [-883.919] (-883.927) (-884.123) * (-883.176) (-884.473) (-884.298) [-884.104] -- 0:00:19
      673500 -- (-886.241) [-886.988] (-883.873) (-885.260) * [-884.688] (-884.481) (-885.251) (-883.804) -- 0:00:19
      674000 -- [-883.587] (-885.047) (-884.029) (-884.341) * (-884.661) (-883.274) [-884.243] (-883.088) -- 0:00:19
      674500 -- (-882.992) (-884.306) (-883.039) [-886.442] * [-885.051] (-887.784) (-882.870) (-883.330) -- 0:00:19
      675000 -- (-884.911) [-884.103] (-884.373) (-885.563) * (-887.384) [-886.535] (-886.178) (-883.778) -- 0:00:19

      Average standard deviation of split frequencies: 0.007624

      675500 -- (-888.957) [-883.742] (-885.808) (-883.990) * [-886.475] (-884.916) (-889.976) (-883.688) -- 0:00:20
      676000 -- [-885.952] (-883.389) (-886.021) (-887.110) * (-884.916) (-888.249) [-887.157] (-887.085) -- 0:00:20
      676500 -- (-884.055) (-883.584) [-882.965] (-886.481) * [-883.974] (-884.056) (-884.332) (-886.638) -- 0:00:20
      677000 -- (-888.605) (-883.867) (-883.834) [-887.486] * (-882.929) [-883.537] (-885.174) (-883.474) -- 0:00:20
      677500 -- (-888.300) (-885.182) (-888.290) [-888.424] * (-885.543) (-885.773) (-883.885) [-885.239] -- 0:00:19
      678000 -- (-884.297) (-885.995) (-882.793) [-885.892] * (-885.722) [-888.651] (-884.073) (-885.416) -- 0:00:19
      678500 -- [-883.278] (-883.590) (-889.916) (-885.429) * (-884.661) (-888.804) (-883.407) [-886.039] -- 0:00:19
      679000 -- (-884.310) [-887.154] (-891.136) (-884.670) * (-886.503) (-883.385) [-884.440] (-884.093) -- 0:00:19
      679500 -- (-885.437) (-884.039) [-882.950] (-885.857) * [-888.058] (-884.139) (-887.328) (-883.894) -- 0:00:19
      680000 -- (-886.500) (-888.130) [-883.087] (-883.179) * [-888.045] (-883.220) (-887.752) (-884.986) -- 0:00:19

      Average standard deviation of split frequencies: 0.007341

      680500 -- [-884.042] (-885.917) (-883.164) (-884.570) * (-884.361) [-884.459] (-883.135) (-884.290) -- 0:00:19
      681000 -- (-887.395) [-885.671] (-883.184) (-884.556) * (-884.368) (-884.078) (-883.483) [-885.763] -- 0:00:19
      681500 -- (-884.036) (-883.157) (-882.868) [-883.553] * (-885.382) (-886.454) [-884.504] (-883.704) -- 0:00