--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Mon Nov 14 16:49:50 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/216/Csat-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -4430.02 -4447.74 2 -4430.19 -4445.02 -------------------------------------- TOTAL -4430.10 -4447.11 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.620457 0.014000 1.396620 1.859078 1.615321 1323.57 1326.57 1.000 r(A<->C){all} 0.121403 0.000312 0.087439 0.156438 0.120534 1127.55 1142.89 1.001 r(A<->G){all} 0.279533 0.000942 0.220369 0.339272 0.278326 882.86 884.36 1.000 r(A<->T){all} 0.086000 0.000493 0.045637 0.129382 0.084810 860.08 927.98 1.000 r(C<->G){all} 0.042756 0.000072 0.027911 0.060683 0.042070 1119.96 1178.12 1.000 r(C<->T){all} 0.401755 0.001052 0.337355 0.463942 0.401372 823.13 832.60 1.002 r(G<->T){all} 0.068553 0.000167 0.044216 0.094335 0.067917 1143.45 1176.90 1.000 pi(A){all} 0.170142 0.000109 0.149423 0.189882 0.170042 1108.74 1169.05 1.000 pi(C){all} 0.329307 0.000157 0.304992 0.354699 0.329219 993.97 1021.39 1.000 pi(G){all} 0.280788 0.000161 0.256565 0.306325 0.280661 1000.62 1176.46 1.000 pi(T){all} 0.219763 0.000126 0.198288 0.242065 0.219560 890.75 993.60 1.003 alpha{1,2} 0.127970 0.000127 0.106339 0.149635 0.126989 1364.49 1432.74 1.000 alpha{3} 3.170872 0.619212 1.876519 4.761786 3.064193 1280.18 1347.57 1.000 pinvar{all} 0.291495 0.001539 0.219276 0.370737 0.292728 962.63 1134.57 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -4103.58788 Model 2: PositiveSelection -4103.587899 Model 0: one-ratio -4161.750023 Model 3: discrete -4092.292415 Model 7: beta -4097.4731 Model 8: beta&w>1 -4092.614712 Model 0 vs 1 116.32428599999912 Model 2 vs 1 3.80000001314329E-5 Model 8 vs 7 9.716776000000209 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.982* 1.332 190 S 0.991** 1.342 264 K 0.960* 1.306 268 L 0.866 1.200 349 T 0.908 1.248 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.934 1.589 +- 0.491 190 S 0.934 1.588 +- 0.482 264 K 0.803 1.418 +- 0.506 268 L 0.686 1.274 +- 0.558 349 T 0.771 1.384 +- 0.548
>C1 MALLPAPVTYSYSHRTVNANTLKYISLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQ NRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL LTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILK GFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAP KPTMHGPGGDEEKLLPRVoooo >C2 MALLPAPVTYPYSHRAVNANTLKYISLLTLTLQNDILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQ NRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL LTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILK GFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAP KPTMQGPGDDEEKLLPRVoooo >C3 MALLPAPVTYSYSHRAVNANTLKYISLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGGAAAAATAASSGGAPEQ NRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL LTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILK GFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAP KPTMQGPGGDEEKLLPRVoooo >C4 MALLPAPIPYSYSHRPVNANTLKYISLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAAAATAASAGGAPV QNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFG LLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNIL KGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSA PKPTMQGPGGDEEKLLPRVooo >C5 MALLPAPVTYSYSRRPVNANTLKYVSLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGGAAAAATTDLSGGAPEQ NKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL LTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVVVKYADNILK GFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAP KPTMQGPGGDEEKLLPRVoooo >C6 MALLPAPVSYAYAHAHRPVNANTLKYISLLTLTLQNAILGLSMRYARTRP GDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMD TLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILR RKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGGAAAAATAASSGGAP EQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPF GLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVVVKYADNI LKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPAKS APKSSMQGPGGDEEKLLPRVoo >C7 MALLPAPVSYSYSHRPVNANTLKYISLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGGAAAAATAASSGGAPEQ NRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL ITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVVVKYADNILK GFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPGRSAP KSTMQGPGGDEEKLLPRVoooo >C8 MALLPAPVTYSYRPVNANTLKYISLLTLTLQNAILGLSMRYARTRPGDIF LSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKV CVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLL NTQWGALLLLVMGIVLVQLAQTVGSSTGSAGGAAAAATAASSGGIPEQNK MLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLT CFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGF ATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSVPKL AMQGPGSDEEKLLPRVoooooo >C9 MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGGAAAAATASSRGA APEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSI PFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVVVKYAD NILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLYGYDPA RSAPKSSMQAPGGDEEKLLPRV >C10 MALLPAPVTYSYRPVNANTLKYISLLTLTLQNAILGLSMRYARTRPGDIF LSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKV CVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLL NTQWGALLLLVMGIVMVQLAQTVGPSSGSAGGTGAAATASSVGGAPEQNR MLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLT CLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVVVKYADNILKGF ATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAPKS SMQGPAGDEEKLLPRVoooooo >C11 MALLPAPVTYSYSHRQVNANTLKYISLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADGAGAGAAATAAASSAGG APEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSI PFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVVVKYAD NILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPA RSAPKSSMQGPGGDEEKLLPRV >C12 MALLPAPVTYSYSHRPVNANTLKYISLLTLTLQNAILGLSMRYARTRPGD IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTL KVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK LLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAGASATAASSGGAPEQNR MLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLT CFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVVVKYADNILKGF ATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSTPKS NMQGPGGDEEKLLPRVoooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=383 C1 MALLPAPVTYSYS----HRTVNANTLKYISLLTLTLQNAILGLSMRYART C2 MALLPAPVTYPYS----HRAVNANTLKYISLLTLTLQNDILGLSMRYART C3 MALLPAPVTYSYS----HRAVNANTLKYISLLTLTLQNAILGLSMRYART C4 MALLPAPIPYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART C5 MALLPAPVTYSYS----RRPVNANTLKYVSLLTLTLQNAILGLSMRYART C6 MALLPAPVSYAYAH--AHRPVNANTLKYISLLTLTLQNAILGLSMRYART C7 MALLPAPVSYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART C8 MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART C9 MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART C10 MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART C11 MALLPAPVTYSYS----HRQVNANTLKYISLLTLTLQNAILGLSMRYART C12 MALLPAPVTYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART ******* .*.* * ********:********* *********** C1 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C2 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C3 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C4 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C5 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C6 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C7 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C8 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C9 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP C10 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C11 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP C12 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP **********************************************:*** C1 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C2 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C3 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C4 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C5 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C6 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C7 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C8 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C9 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C10 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C11 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI C12 MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI ************************************************** C1 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA C2 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA C3 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATA C4 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAA----AATA C5 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATT C6 LRRKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGG-AAA----AATA C7 LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGG-AAA----AATA C8 LRRKLLNTQWGALLLLVMGIVLVQLAQTVGSSTGSAGG-AAA----AATA C9 LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGG-AAA----AATA C10 LRRKLLNTQWGALLLLVMGIVMVQLAQTVGPSSGSAGG-TGA----AATA C11 LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADG-AGAGAAATAAA C12 LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAG-ASA------TA *********************:****** ..::*.* * :.* :: C1 ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C2 ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C3 ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C4 ASAGGAPVQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C5 DLSGGAPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C6 ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C7 ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C8 ASSGGIPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C9 SSRGAAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C10 SSVGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C11 SSAGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL C12 ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL *. * **:*************************************** C1 SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV C2 SLLSIPFGLLTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV C3 SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV C4 SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV C5 SLLSIPFGLLTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVV C6 SLLSIPFGLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVV C7 SLLSIPFGLITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVV C8 SLLSIPFGLLTCFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVV C9 SLLSIPFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVV C10 SLLSIPFGLLTCLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVV C11 SLLSIPFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVV C12 SLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVV *********:**.:*******::***:*** ** **.************* C1 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C2 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C3 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C4 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C5 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C6 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C7 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C8 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C9 VKYADNILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLY C10 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C11 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY C12 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY ****************************:*******:************* C1 GYDPARSAPKPTMHGPGGDEEKLLPRVoooo-- C2 GYDPARSAPKPTMQGPGDDEEKLLPRVoooo-- C3 GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- C4 GYDPARSAPKPTMQGPGGDEEKLLPRVooo--- C5 GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- C6 GYDPAKSAPKSSMQGPGGDEEKLLPRVoo---- C7 GYDPGRSAPKSTMQGPGGDEEKLLPRVoooo-- C8 GYDPARSVPKLAMQGPGSDEEKLLPRVoooooo C9 GYDPARSAPKSSMQAPGGDEEKLLPRV------ C10 GYDPARSAPKSSMQGPAGDEEKLLPRVoooooo C11 GYDPARSAPKSSMQGPGGDEEKLLPRV------ C12 GYDPARSTPKSNMQGPGGDEEKLLPRVoooooo ****.:*.** *:.*..********* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 372 type PROTEIN Struct Unchecked Input File /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 372 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [52594] Library Relaxation: Multi_proc [72] Relaxation Summary: [52594]--->[51906] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/216/Csat-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.745 Mb, Max= 32.178 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MALLPAPVTYSYS----HRTVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMHGPGGDEEKLLPRVoooo-- >C2 MALLPAPVTYPYS----HRAVNANTLKYISLLTLTLQNDILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGDDEEKLLPRVoooo-- >C3 MALLPAPVTYSYS----HRAVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- >C4 MALLPAPIPYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAA----AATA ASAGGAPVQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRVooo--- >C5 MALLPAPVTYSYS----RRPVNANTLKYVSLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATT DLSGGAPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- >C6 MALLPAPVSYAYAH--AHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPAKSAPKSSMQGPGGDEEKLLPRVoo---- >C7 MALLPAPVSYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPGRSAPKSTMQGPGGDEEKLLPRVoooo-- >C8 MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGSSTGSAGG-AAA----AATA ASSGGIPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSVPKLAMQGPGSDEEKLLPRVoooooo >C9 MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGG-AAA----AATA SSRGAAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLY GYDPARSAPKSSMQAPGGDEEKLLPRV------ >C10 MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTVGPSSGSAGG-TGA----AATA SSVGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPAGDEEKLLPRVoooooo >C11 MALLPAPVTYSYS----HRQVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADG-AGAGAAATAAA SSAGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPGGDEEKLLPRV------ >C12 MALLPAPVTYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAG-ASA------TA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSTPKSNMQGPGGDEEKLLPRVoooooo FORMAT of file /tmp/tmp6288770107578437875aln Not Supported[FATAL:T-COFFEE] >C1 MALLPAPVTYSYS----HRTVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMHGPGGDEEKLLPRVoooo-- >C2 MALLPAPVTYPYS----HRAVNANTLKYISLLTLTLQNDILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGDDEEKLLPRVoooo-- >C3 MALLPAPVTYSYS----HRAVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- >C4 MALLPAPIPYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAA----AATA ASAGGAPVQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRVooo--- >C5 MALLPAPVTYSYS----RRPVNANTLKYVSLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATT DLSGGAPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- >C6 MALLPAPVSYAYAH--AHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPAKSAPKSSMQGPGGDEEKLLPRVoo---- >C7 MALLPAPVSYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPGRSAPKSTMQGPGGDEEKLLPRVoooo-- >C8 MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGSSTGSAGG-AAA----AATA ASSGGIPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSVPKLAMQGPGSDEEKLLPRVoooooo >C9 MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGG-AAA----AATA SSRGAAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLY GYDPARSAPKSSMQAPGGDEEKLLPRV------ >C10 MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTVGPSSGSAGG-TGA----AATA SSVGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPAGDEEKLLPRVoooooo >C11 MALLPAPVTYSYS----HRQVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADG-AGAGAAATAAA SSAGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPGGDEEKLLPRV------ >C12 MALLPAPVTYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAG-ASA------TA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSTPKSNMQGPGGDEEKLLPRVoooooo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:383 S:98 BS:383 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # SEQ_INDEX C11 10 # SEQ_INDEX C12 11 # PW_SEQ_DISTANCES BOT 0 1 98.39 C1 C2 98.39 TOP 1 0 98.39 C2 C1 98.39 BOT 0 2 99.19 C1 C3 99.19 TOP 2 0 99.19 C3 C1 99.19 BOT 0 3 98.11 C1 C4 98.11 TOP 3 0 98.11 C4 C1 98.11 BOT 0 4 97.04 C1 C5 97.04 TOP 4 0 97.04 C5 C1 97.04 BOT 0 5 96.22 C1 C6 96.22 TOP 5 0 96.22 C6 C1 96.22 BOT 0 6 97.04 C1 C7 97.04 TOP 6 0 97.04 C7 C1 97.04 BOT 0 7 96.49 C1 C8 96.49 TOP 7 0 96.49 C8 C1 96.49 BOT 0 8 95.11 C1 C9 95.11 TOP 8 0 95.11 C9 C1 95.11 BOT 0 9 95.95 C1 C10 95.95 TOP 9 0 95.95 C10 C1 95.95 BOT 0 10 95.38 C1 C11 95.38 TOP 10 0 95.38 C11 C1 95.38 BOT 0 11 97.03 C1 C12 97.03 TOP 11 0 97.03 C12 C1 97.03 BOT 1 2 98.66 C2 C3 98.66 TOP 2 1 98.66 C3 C2 98.66 BOT 1 3 97.30 C2 C4 97.30 TOP 3 1 97.30 C4 C2 97.30 BOT 1 4 96.24 C2 C5 96.24 TOP 4 1 96.24 C5 C2 96.24 BOT 1 5 95.68 C2 C6 95.68 TOP 5 1 95.68 C6 C2 95.68 BOT 1 6 96.24 C2 C7 96.24 TOP 6 1 96.24 C7 C2 96.24 BOT 1 7 95.95 C2 C8 95.95 TOP 7 1 95.95 C8 C2 95.95 BOT 1 8 94.57 C2 C9 94.57 TOP 8 1 94.57 C9 C2 94.57 BOT 1 9 95.41 C2 C10 95.41 TOP 9 1 95.41 C10 C2 95.41 BOT 1 10 94.84 C2 C11 94.84 TOP 10 1 94.84 C11 C2 94.84 BOT 1 11 96.22 C2 C12 96.22 TOP 11 1 96.22 C12 C2 96.22 BOT 2 3 98.38 C3 C4 98.38 TOP 3 2 98.38 C4 C3 98.38 BOT 2 4 97.58 C3 C5 97.58 TOP 4 2 97.58 C5 C3 97.58 BOT 2 5 96.49 C3 C6 96.49 TOP 5 2 96.49 C6 C3 96.49 BOT 2 6 97.31 C3 C7 97.31 TOP 6 2 97.31 C7 C3 97.31 BOT 2 7 96.76 C3 C8 96.76 TOP 7 2 96.76 C8 C3 96.76 BOT 2 8 95.65 C3 C9 95.65 TOP 8 2 95.65 C9 C3 95.65 BOT 2 9 96.22 C3 C10 96.22 TOP 9 2 96.22 C10 C3 96.22 BOT 2 10 95.65 C3 C11 95.65 TOP 10 2 95.65 C11 C3 95.65 BOT 2 11 97.30 C3 C12 97.30 TOP 11 2 97.30 C12 C3 97.30 BOT 3 4 96.50 C4 C5 96.50 TOP 4 3 96.50 C5 C4 96.50 BOT 3 5 96.22 C4 C6 96.22 TOP 5 3 96.22 C6 C4 96.22 BOT 3 6 97.04 C4 C7 97.04 TOP 6 3 97.04 C7 C4 97.04 BOT 3 7 96.21 C4 C8 96.21 TOP 7 3 96.21 C8 C4 96.21 BOT 3 8 94.84 C4 C9 94.84 TOP 8 3 94.84 C9 C4 94.84 BOT 3 9 95.93 C4 C10 95.93 TOP 9 3 95.93 C10 C4 95.93 BOT 3 10 95.38 C4 C11 95.38 TOP 10 3 95.38 C11 C4 95.38 BOT 3 11 96.75 C4 C12 96.75 TOP 11 3 96.75 C12 C4 96.75 BOT 4 5 94.59 C5 C6 94.59 TOP 5 4 94.59 C6 C5 94.59 BOT 4 6 95.43 C5 C7 95.43 TOP 6 4 95.43 C7 C5 95.43 BOT 4 7 95.68 C5 C8 95.68 TOP 7 4 95.68 C8 C5 95.68 BOT 4 8 94.29 C5 C9 94.29 TOP 8 4 94.29 C9 C5 94.29 BOT 4 9 94.86 C5 C10 94.86 TOP 9 4 94.86 C10 C5 94.86 BOT 4 10 93.75 C5 C11 93.75 TOP 10 4 93.75 C11 C5 93.75 BOT 4 11 95.41 C5 C12 95.41 TOP 11 4 95.41 C12 C5 95.41 BOT 5 6 97.30 C6 C7 97.30 TOP 6 5 97.30 C7 C6 97.30 BOT 5 7 95.38 C6 C8 95.38 TOP 7 5 95.38 C8 C6 95.38 BOT 5 8 93.51 C6 C9 93.51 TOP 8 5 93.51 C9 C6 93.51 BOT 5 9 95.92 C6 C10 95.92 TOP 9 5 95.92 C10 C6 95.92 BOT 5 10 94.57 C6 C11 94.57 TOP 10 5 94.57 C11 C6 94.57 BOT 5 11 96.20 C6 C12 96.20 TOP 11 5 96.20 C12 C6 96.20 BOT 6 7 96.49 C7 C8 96.49 TOP 7 6 96.49 C8 C7 96.49 BOT 6 8 94.02 C7 C9 94.02 TOP 8 6 94.02 C9 C7 94.02 BOT 6 9 96.49 C7 C10 96.49 TOP 9 6 96.49 C10 C7 96.49 BOT 6 10 95.38 C7 C11 95.38 TOP 10 6 95.38 C11 C7 95.38 BOT 6 11 97.30 C7 C12 97.30 TOP 11 6 97.30 C12 C7 97.30 BOT 7 8 94.26 C8 C9 94.26 TOP 8 7 94.26 C9 C8 94.26 BOT 7 9 95.70 C8 C10 95.70 TOP 9 7 95.70 C10 C8 95.70 BOT 7 10 94.54 C8 C11 94.54 TOP 10 7 94.54 C11 C8 94.54 BOT 7 11 96.76 C8 C12 96.76 TOP 11 7 96.76 C12 C8 96.76 BOT 8 9 94.81 C9 C10 94.81 TOP 9 8 94.81 C10 C9 94.81 BOT 8 10 94.29 C9 C11 94.29 TOP 10 8 94.29 C11 C9 94.29 BOT 8 11 94.54 C9 C12 94.54 TOP 11 8 94.54 C12 C9 94.54 BOT 9 10 96.72 C10 C11 96.72 TOP 10 9 96.72 C11 C10 96.72 BOT 9 11 96.76 C10 C12 96.76 TOP 11 9 96.76 C12 C10 96.76 BOT 10 11 96.99 C11 C12 96.99 TOP 11 10 96.99 C12 C11 96.99 AVG 0 C1 * 96.90 AVG 1 C2 * 96.32 AVG 2 C3 * 97.20 AVG 3 C4 * 96.60 AVG 4 C5 * 95.58 AVG 5 C6 * 95.64 AVG 6 C7 * 96.37 AVG 7 C8 * 95.84 AVG 8 C9 * 94.54 AVG 9 C10 * 95.89 AVG 10 C11 * 95.23 AVG 11 C12 * 96.48 TOT TOT * 96.05 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCGCTCCTGCCCGCCCCCGTCACGTATTCCTATTCC----------- C2 ATGGCGCTCCTGCCCGCCCCCGTCACGTATCCCTATTCC----------- C3 ATGGCGCTCCTGCCCGCCCCCGTCACGTATTCCTATTCC----------- C4 ATGGCGCTCCTGCCCGCCCCCATCCCGTATTCCTATTCC----------- C5 ATGGCGCTCCTGCCCGCCCCCGTCACATATTCTTATTCC----------- C6 ATGGCGCTCCTGCCCGCCCCCGTCTCCTATGCCTATGCCCAT------GC C7 ATGGCGCTCCTGCCCGCCCCCGTCTCCTATTCCTATTCC----------- C8 ATGGCGCTCCTTCCCGCACCCGTCACCTATTCCTAT-------------- C9 ATGGCGCTTCTGCCCGCACCTGCCACATACTCATACTCCTACTCGTATCC C10 ATGGCGCTTCTGCCTGCACCCGTCACCTATTCCTAT-------------- C11 ATGGCGCTCCTGCCCGCACCCGTCACCTATTCCTATTCC----------- C12 ATGGCGCTCCTGCCCGCCCCCGTCACCTATTCCTACTCC----------- ******** ** ** **.** . * * ** * ** C1 -CATCGCACAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC C2 -CATCGCGCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC C3 -CATCGCGCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC C4 -CATCGCCCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC C5 -CGTCGTCCAGTGAACGCCAATACGCTGAAGTACGTCAGCCTGCTGACGC C6 CCATCGGCCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC C7 -CATCGACCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC C8 ----CGTCCAGTGAATGCCAATACTCTAAAGTACATCAGTCTGCTGACGC C9 CCGCCGCCTAGTGAACGCCAACACGTTGAAGTACATCAGCCTGCTGACGC C10 ----CGCCCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC C11 -CATCGCCAAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC C12 -CATCGCCCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC ** ****** ***** ** *.******.**** ********** C1 TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTACGCCCGCACC C2 TGACCCTGCAGAATGACATCCTGGGCCTCAGCATGCGCTACGCCCGCACC C3 TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTACGCCCGCACC C4 TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTATGCCCGCACC C5 TGACCCTACAGAATGCCATCCTGGGACTCAGCATGCGCTATGCCCGCACC C6 TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTATGCCCGCACC C7 TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTATGCCCGCACC C8 TGACCCTCCAGAATGCTATCCTGGGCCTCAGTATGCGATATGCCCGTACT C9 TGACCCTGCAAAATGCCATCCTGGGGCTCAGCATGCGGTACGCCCGCACC C10 TGACCTTGCAGAATGCTATCCTGGGCCTCAGCATGCGCTACGCCCGCACC C11 TGACTTTGCAGAATGCGATCCTGGGTCTCAGCATGCGCTATGCCCGCACC C12 TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTACGCCCGCACC **** * **.****. ******** ***** ***** ** ***** ** C1 CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT C2 CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT C3 CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT C4 CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCCGAGTT C5 CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT C6 CGACCTGGCGACATCTTCCTCAGCTCCACGGCCGTGCTGATGGCCGAGTT C7 CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCCGAGTT C8 CGACCAGGCGACATCTTCCTCAGTTCAACGGCCGTGCTAATGGCCGAGTT C9 CGGCCCGGCGACATCTTCCTCAGCTCCACGGCCGTCCTAATGGCCGAGTT C10 CGGCCTGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCAGAGTT C11 CGGCCGGGCGACATCTTCCTCAGTTCCACGGCCGTGCTAATGGCCGAGTT C12 CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCCGAGTT **.** ***************** **.******** ** *****.***** C1 CGCCAAACTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG C2 CGCCAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG C3 CGCCAAACTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG C4 TGCCAAACTGATCACGTGCCTGTTCCTGGTCTTTAACGAGGAGGGCAAGG C5 TGCCAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG C6 CGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG C7 TGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG C8 CGCTAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG C9 CGCCAAGCTCATCACGTGCCTGTTCCTGGTCTTCAACGAAGAGGGCAAAG C10 CGCCAAGCTCATTACGTGCCTGTTCCTGGTCTTCAATGAGGAGGGCAAGG C11 CGCCAAACTCATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG C12 TGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ** **.** ** *********** ******** ** **.********.* C1 ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC C2 ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC C3 ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC C4 ATGCCCAGAAGTTTGTCCGCTCGCTGCACAAGACCATCATTGCGAATCCC C5 ATGCCCAGAAGTTTGTCCGCTCGCTGCACAAGACCATCATTGCGAATCCC C6 ATGCCCAGAAGTTCGTGCGCTCGCTGCACAAGACCATCATCGCCAATCCC C7 ATGCCCAGAAGTTCGTCCGTTCGCTGCACAAGACCATCATTGCCAATCCC C8 ATGCCCAGAAGTTTGTCAGATCGCTGCACAAGACTATCATTGCCAATCCT C9 ATGCCCAAAAGTTTGTCCGTTCGCTGCACAAGACCATTGTTGCCAACCCC C10 ATGCCCAGAAGTTCGTCCGTTCGCTGCATAAGACTATCATTGCGAATCCA C11 ATGCCCAGAAGTTCGTCCGTTCGCTGCACAAGACCATCATTGCCAATCCC C12 ATGCCCAGAAGTTCGTCCGCTCGCTGCACAAGACCATCATTGCCAATCCC *******.***** ** .* ******** ***** ** .* ** ** ** C1 ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAAAA C2 ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA C3 ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA C4 ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTACATCGTGCAGAA C5 ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA C6 ATGGACACGTTGAAGGTGTGCGTGCCCTCGCTGGTGTACATCGTGCAGAA C7 ATGGACACGCTGAAGGTGTGTGTGCCCTCGCTGGTCTACATCGTCCAAAA C8 ATGGATACGCTGAAGGTGTGTGTGCCCTCGCTGGTTTACATCGTCCAAAA C9 ATGGACACGCTGAAGGTATGTGTGCCGTCGCTGGTATACATTGTTCAAAA C10 ATGGACACGCTAAAGGTGTGTGTGCCCTCGCTGGTTTACATCGTCCAAAA C11 ATGGACACGCTGAAGGTGTGCGTGCCCTCGCTGGTGTACATCGTCCAGAA C12 ATGGACACGCTGAAGGTGTGCGTGCCCTCGCTGGTTTACATCGTCCAGAA ***** *** *.*****.** ** ** ******** ** ** ** **.** C1 CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG C2 CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG C3 CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG C4 TAACCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG C5 CAACCTGCTGTACGTCTCGGCCTCCCATTTGGATGCGGCCACCTACCAGG C6 CAACCTGCTGTACGTGTCCGCCTCCCACTTGGATGCGGCCACCTACCAGG C7 CAACCTGCTGTATGTATCCGCCTCCCACTTGGATGCAGCCACCTACCAGG C8 CAACCTGTTGTATGTATCCGCCTCCCATTTGGATGCAGCTACTTACCAGG C9 CAACCTGCTGTACGTGTCCGCCTCCCACTTGGACGCAGCCACCTACCAAG C10 CAACCTGCTGTATGTGTCCGCCTCCCACTTGGATGCGGCCACCTACCAGG C11 CAACCTGCTGTATGTGTCCGCCTCGCACTTGGATGCGGCCACCTACCAGG C12 CAACCTGCTGTATGTGTCCGCCTCGCATCTGGATGCGGCCACCTACCAGG ** *** **** ** ** ***** ** **** **.** ** *****.* C1 TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT C2 TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT C3 TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT C4 TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATC C5 TGACGTACCAGCTGAAGATTCTCACCACAGCCATGTTCGCGGTTGTCATC C6 TGACGTACCAGCTGAAGATCCTCACCACGGCCATGTTCGCGGTGGTCATC C7 TGACGTACCAGCTGAAGATCCTCACCACGGCCATGTTTGCTGTTGTGATC C8 TTACGTACCAGCTGAAGATACTCACCACGGCCATGTTTGCGGTTGTTATT C9 TTACGTATCAGCTGAAGATCCTTACCACGGCCATGTTTGCGGTGGTTATC C10 TGACTTACCAGCTGAAGATCCTCACCACGGCCATGTTCGCGGTGGTGATT C11 TGACGTACCAGCTAAAGATCCTCACCACGGCCATGTTTGCTGTGGTGATA C12 TGACGTACCAGCTGAAGATCCTCACCACCGCCATGTTTGCGGTGGTGATC * ** ** *****.***** ** ***** ******** ** ** ** ** C1 CTGCGCCGCAAGCTGCTGAACACGCAGTGGGGTGCGCTGCTGCTCCTGGT C2 CTGCGACGCAAGCTGCTGAACACGCAGTGGGGAGCGCTGCTGCTCCTTGT C3 CTGCGCCGCAAGCTGCTGAACACGCAGTGGGGAGCGCTGCTGCTCCTGGT C4 CTGCGTCGCAAGCTGCTGAACACCCAGTGGGGAGCGCTGCTGCTCCTGGT C5 CTGCGTCGCAAGCTGCTAAACACCCAGTGGGGAGCACTGCTGCTCCTCGT C6 CTGCGCCGCAAGCTGCTTAACACCCAGTGGGGTGCGCTGCTGCTCCTGGT C7 CTGCGCCGCAAGCTGCTCAACACACAGTGGGGTGCGTTGCTGCTCCTGGT C8 CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCATTGTTGCTCTTGGT C9 CTGCGGCGCAAGCTGCTAAACACTCAGTGGGGCGCGCTGTTGCTGCTGGT C10 CTGCGTCGCAAGTTGCTCAACACCCAATGGGGTGCGCTGTTGCTCCTGGT C11 CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCGCTGTTGCTCCTGGT C12 CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCTCTGCTGCTCCTGGT ***** ****** **** ***** **.***** ** ** **** * ** C1 GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGACGAGTG C2 GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGACGAGTG C3 GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGGCGAGTG C4 CATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGACCGTCGAGTG C5 GATGGGTATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGGCGAGTG C6 GATGGGCATTGTCATGGTGCAGTTGGCCCAAACTGAGGGACCATCGAGTG C7 GATGGGCATTGTCCTGGTGCAGTTGGCCCAAACAGTGGGACCATCGAGTG C8 GATGGGCATTGTTCTGGTGCAATTGGCCCAGACGGTGGGATCATCGACTG C9 GATGGGCATTGTGCTAGTGCAGCTGGCTCAAACAGAGGCTCCGGCGACTG C10 TATGGGTATTGTCATGGTCCAGTTGGCTCAAACGGTGGGACCGTCGAGCG C11 GATGGGCATCGTTCTGGTGCAGTTGGCCCAAACTGTGGGCCCGTCGAGCG C12 GATGGGCATTGTCCTGGTGCAGTTGGCCCAAACGGTGGGTCCATCGAGTG ***** ** ** .*.** **. **** **.** *:** *. *** * C1 GCTCAGCCGGTGGT---GCCGCAGCT------------GCAGCCACGGCC C2 GTTCGGCCGGTGGA---GCCGCAGCT------------GCCGCCACGGCC C3 GCTCGGCCGGTGGA---GCCGCAGCT------------GCCGCCACGGCC C4 GTTCAGCCGGTGGAGCTGCAGCAGCA------------GCAGCCACGGCC C5 GTTCAGCCGGTGGA---GCTGCAGCA------------GCAGCCACGACT C6 GCTCAGCCGGTGGA---GCTGCGGCG------------GCAGCCACGGCC C7 GCTCAGCCGGTGGA---GCTGCAGCA------------GCGGCCACGGCA C8 GGTCAGCCGGTGGA---GCTGCAGCA------------GCAGCCACGGCC C9 GTTCGGCCGGTGGA---GCGGCAGCT------------GCGGCCACGGCG C10 GTTCAGCCGGTGGA---ACTGGAGCT------------GCAGCGACCGCC C11 GTCCAGCCGATGGA---GCCGGAGCCGGAGCTGCGGCCACGGCCGCCGCC C12 GTTCGGCCGCTGGA---GCTTCGGCC------------------ACGGCC * *.**** ***: .* .** .* .* C1 GCCTCCTCTGGCGGTGCTCCCGAGCAGAACAGGATGCTCGGACTGTGGGC C2 GCCTCCTCTGGCGGGGCGCCTGAGCAGAACAGGATGCTCGGACTGTGGGC C3 GCCTCCTCTGGCGGGGCGCCTGAGCAGAACAGGATGCTCGGACTGTGGGC C4 GCCTCCGCTGGAGGAGCACCTGTGCAGAACAGGATGCTTGGACTGTGGGC C5 GATTTGTCTGGAGGAGCACCTGAGCAGAACAAGATGCTTGGACTGTGGGC C6 GCCTCCTCGGGCGGAGCACCGGAGCAGAACAGGATGCTGGGCCTGTGGGC C7 GCCTCCTCTGGAGGAGCGCCCGAACAGAACAGAATGCTGGGTCTGTGGGC C8 GCCTCTTCCGGCGGAATACCCGAACAAAACAAGATGCTTGGGCTATGGGC C9 TCTTCTAGAGGAGCAGCCCCCGAACAGAACCGTATGCTCGGACTGTGGGC C10 TCTTCCGTTGGAGGAGCACCCGAACAGAACAGGATGCTCGGACTGTGGGC C11 TCCTCCGCTGGCGGAGCACCCGAGCAGAACAGGATGCTCGGACTGTGGGC C12 GCCTCCTCGGGAGGAGCGCCCGAACAGAACAGGATGCTGGGTCTGTGGGC . * **.* . ** *:.**.***.. ***** ** **.***** C1 CGCACTGGGCGCCTGCTTCCTCTCCGGATTCGCGGGCATCTACTTTGAGA C2 CGCACTGGGCGCCTGCTTCCTCTCTGGATTCGCGGGCATCTACTTCGAGA C3 CGCACTGGGCGCCTGCTTCCTCTCCGGATTCGCGGGCATCTACTTCGAGA C4 CGCATTGGGCGCCTGCTTCCTGTCCGGATTTGCGGGCATCTACTTCGAGA C5 CGCATTGGGAGCCTGCTTCCTATCCGGATTTGCGGGCATATACTTCGAGA C6 CGCACTGGGCGCCTGTTTCCTCTCCGGCTTCGCGGGCATCTACTTCGAGA C7 CGCACTGGGCGCCTGTTTCCTTTCTGGATTTGCGGGCATCTACTTTGAGA C8 TGCCCTGGGTGCCTGTTTCCTTTCCGGATTTGCGGGCATCTACTTCGAAA C9 CGCCCTAGGCGCCTGTTTCCTCTCCGGATTTGCGGGCATCTACTTCGAAA C10 AGCACTGGGTGCCTGCTTCCTTTCCGGATTCGCGGGCATATACTTTGAGA C11 AGCACTGGGCGCCTGCTTTCTGTCCGGATTCGCTGGCATCTACTTCGAGA C12 CGCCCTGGGCGCCTGTTTCCTCTCCGGATTCGCGGGCATCTACTTCGAGA **. *.** ***** ** ** ** **.** ** *****.***** **.* C1 AGATCCTCAAGGGTGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGTTG C2 AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGTTG C3 AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGAAATGTGCAGTTG C4 AGATCCTCAAGGGTGCCGAGATCTCCGTGTGGATGAGGAATGTGCAGTTG C5 AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGAGGAATGTGCAGTTG C6 AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGAGGAACGTTCAGCTG C7 AGATCCTCAAGGGCGCCGAGATCTCTGTGTGGATGAGGAACGTTCAGTTG C8 AGATACTAAAGGGTGCAGAGATCTCGGTGTGGATGAGGAATGTCCAGTTG C9 AGATCCTCAAGGGAGCCGAGATCTCCGTGTGGATGAGGAACGTGCAACTA C10 AGATCCTCAAAGGAGCCGAGATCTCCGTGTGGATGAGGAATGTCCAGCTG C11 AGATCCTCAAGGGTGCCGAGATTTCCGTGTGGATGAGGAACGTCCAGCTG C12 AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGCTG ****.**.**.** **.***** ** *********.*.** ** **. *. C1 AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGTTTCGTTAACGACGG C2 AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCATCGTTAACGACGG C3 AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCTTCGTTAACGACGG C4 AGTCTGCTTAGCATTCCCTTCGGCCTGCTCACCTGCTTTGTGAACGACGG C5 AGCCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCTTCATCAACGACGG C6 AGTCTGCTCAGCATTCCCTTCGGCCTGATCACCTGCTTCGTGAACGACGG C7 AGTCTGCTCAGCATTCCCTTCGGACTGATCACCTGCTTTGTAAACGACGG C8 AGTCTGCTCAGCATTCCTTTCGGCCTGCTCACCTGCTTTGTAAACGACGG C9 AGTCTGCTCAGTATTCCCTTTGGCCTGCTCACCTGCGTCGTTAACGATGG C10 AGTCTGCTGAGTATTCCCTTCGGCCTGCTCACTTGCCTCGTAAACGACGG C11 AGCCTGCTGAGCATTCCCTTCGGCCTGCTCACCTGCCTCGTGAACGACGG C12 AGTCTGCTGAGCATTCCCTTCGGCCTGCTCACCTGCTTCGTGAACGACGG ** ***** ** ***** ** **.***.**** ** * .* ***** ** C1 CAGTAGGATCTTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT C2 CAGCAGGATATTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT C3 CAGCAGGATCTTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT C4 CAGCAGGATCTTCGATCAGGGATTCTTTAAGGGCTACGATCTGTTTGTCT C5 CAGTAGGATCTTCGATCAGGGATTCTTCAAGGGCTACGATCTGTTTGTGT C6 CAGCCGGATCTTCGATCGGGGCTTCTTCCACGGCTACGATCTGTTCGTCT C7 CAGCAGGATCTTCGACCGGGGATTCTTCAATGGCTACGATATGTTCGTCT C8 CAGTAGGATCTTCGACCAAGGATTCTTCAATGGCTACGATCTGTTCGTTT C9 CAGCAGGATCTTCGACCAAGGCTTCTTCCACGGCTACGATTTGTTTGTCT C10 CAGTCGGATCTTCGACCAGGGGTTCTTCAATGGCTACGATGCGTTCGTTT C11 CAGCCGGATCTTCGAGCAGGGATTTTTCCATGGCTACGACGTATTCGTCT C12 CAGCCGGATCTTCGACCAGGGATTCTTCCATGGCTACGATGTGTTCGTCT *** .****.***** *..** ** ** .* ******** .** ** * C1 GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG C2 GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG C3 GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG C4 GGTATCTGGTGCTGCTGCAGGCCGGCGGTGGATTGATTGTGGCCGTGGTG C5 GCTATCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATTGTGGCCGTGGTG C6 GGTACCTCGCTCTGCTGCAGGCCGGCGGCGGTTTGATTGTGGCCGTGGTG C7 GGTATCTAGTTCTGCTGCAGGCCGGCGGTGGCTTGATAGTGGCCGTGGTG C8 GGTATCTAGTTCTGCTGCAGGCCGGCGGTGGTTTGATCGTGGCCGTGGTG C9 GGTACCTGGTACTCCTGCAGGCCGGCGGCGGTTTGATCGTGGCCGTAGTG C10 GGTACCTGGTTCTTCTGCAGGCCGGCGGTGGCCTGATCGTAGCCGTAGTG C11 GGTATCTGGTCCTGCTGCAGGCCGGCGGCGGCCTGATCGTGGCCGTGGTG C12 GGTATCTGGTGCTGCTGCAGGCCGGCGGTGGCCTGATCGTGGCCGTGGTG * ** ** * ** ************** ** **** ** *****.*** C1 GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT C2 GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT C3 GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT C4 GTCAAGTATGCGGATAACATACTCAAGGGCTTCGCCACCTCGCTGGCCAT C5 GTCAAGTATGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT C6 GTCAAGTACGCGGACAACATTCTGAAGGGCTTCGCCACCTCGCTGGCCAT C7 GTCAAGTATGCGGACAACATTCTGAAGGGCTTCGCCACCTCGCTGGCCAT C8 GTGAAGTATGCAGACAACATACTTAAAGGTTTCGCCACCTCGTTGGCCAT C9 GTCAAGTATGCGGACAACATACTCAAAGGCTTTGCCACTTCGCTAGCCAT C10 GTCAAGTATGCGGACAACATACTCAAGGGCTTCGCCACCTCCCTGGCCAT C11 GTCAAGTATGCGGACAACATACTCAAGGGCTTCGCCACCTCGCTGGCCAT C12 GTCAAGTATGCGGACAACATACTGAAGGGCTTCGCCACCTCGCTGGCCAT ** ***** **.** *****:** **.** ** ***** ** *.***** C1 CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC C2 CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC C3 CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC C4 CATCATCTCGTGCGTGGCCTCCATCTACATCTTCGATTTCAATCTCACGT C5 CATCATCTCGTGCGTGGCCTCCATATACATCTTCGATTTCAATCTCACGC C6 CATCATCTCGTGCGTGGCCTCCATCTACATCTTCGACTTCAATCTCACGC C7 CATTATCTCATGTGTGGCCTCCATCTACATCTTTGACTTCAATCTCACGC C8 CATCATATCGTGTGTGGCCTCCATCTACATCTTTGACTTCAATCTCACAC C9 CATCATCTCGTGCGTGGCCTCCATCTACATCTTTGAGTTCAACCTTACGC C10 CATCATTTCGTGCGTGGCCTCCATCTACATCTTTGACTTCAATCTCACAC C11 CATCATCTCGTGCGTAGCCTCCATCTACATCTTCGACTTCAATCTCACGC C12 CATCATCTCGTGCGTGGCCTCCATCTACATCTTTGACTTCAATCTCACGC *** ** **.** **.********.******** ** ***** ** **. C1 TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATATTTCTCTAC C2 TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATCTTCCTCTAC C3 TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATCTTCCTCTAC C4 TGCAGTTCAGCTTTGGAGCTGGGCTGGTCATAGCCTCGATCTTTCTCTAC C5 TGCAGTTTAGCTTTGGCGCTGGCCTGGTCATCGCCTCGATCTTTCTCTAC C6 TGCAGTTCAGCTTCGGCGCTGGCCTGGTCATCGCCTCCATCTTCCTGTAC C7 TGCAGTTCAGCTTCGGAGCTGGTCTGGTCATCGCTTCGATCTTCCTATAT C8 TCCAGTTTAGCTTTGGAGCTGGTCTGGTAATCGCCTCGATCTTTTTATAT C9 TGCAGTTCACCTTTGGAGCTGGTCTGGTCATCGCTTCAATTTTCCTGTAT C10 TGCAGTTTAGCTTCGGAGCTGGCCTGGTCATCGCCTCGATCTTTCTTTAT C11 TTCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCTTCGATCTTTCTATAT C12 TGCAGTTCAGCTTCGGAGCCGGCCTGGTCATCGCCTCGATCTTTTTGTAT * ***** * *** **.** ** *****.**.** ** ** ** * ** C1 GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCATGGTCCTGG C2 GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG C3 GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG C4 GGCTACGATCCTGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGACCTGG C5 GGCTACGATCCTGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG C6 GGCTACGATCCGGCCAAATCGGCGCCAAAGTCCAGCATGCAGGGCCCCGG C7 GGCTATGATCCGGGCAGATCGGCGCCAAAGTCGACTATGCAGGGTCCTGG C8 GGCTATGATCCTGCCAGGTCCGTACCAAAATTGGCAATGCAGGGCCCTGG C9 GGTTACGACCCGGCGAGATCGGCGCCGAAATCCAGTATGCAGGCTCCCGG C10 GGCTACGATCCTGCCAGATCGGCGCCAAAGTCGAGTATGCAGGGTCCTGC C11 GGCTACGATCCGGCCAGATCGGCTCCAAAGTCGAGCATGCAGGGTCCTGG C12 GGCTATGATCCTGCCAGATCCACGCCCAAGTCGAATATGCAGGGTCCTGG ** ** ** ** * *..** . ** **. . ***** * ** * C1 CGGCGATGAGGAGAAGCTGCTGCCGCGCGTC------------------ C2 CGACGATGAGGAGAAGCTGCTGCCACGCGTC------------------ C3 CGGCGATGAGGAGAAGCTCCTGCCACGCGTC------------------ C4 TGGCGATGAGGAGAAGCTGTTGCCACGCGTC------------------ C5 TGGCGATGAGGAGAAGCTGCTGCCACGCGTC------------------ C6 CGGCGACGAGGAGAAGCTGCTGCCACGCGTC------------------ C7 CGGCGATGAGGAGAAGCTGCTGCCACGCGTC------------------ C8 CAGCGATGAGGAGAAATTACTGCCACGCGTC------------------ C9 CGGCGACGAGGAAAAGCTGCTGCCCCGTGTC------------------ C10 TGGCGACGAGGAAAAGTTGCTGCCGCGCGTC------------------ C11 CGGCGACGAGGAGAAGCTGCTGCCGCGCGTC------------------ C12 CGGCGACGAGGAGAAACTGCTGCCACGCGTC------------------ ..*** *****.**. * **** ** *** >C1 ATGGCGCTCCTGCCCGCCCCCGTCACGTATTCCTATTCC----------- -CATCGCACAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT CGCCAAACTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAAAA CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT CTGCGCCGCAAGCTGCTGAACACGCAGTGGGGTGCGCTGCTGCTCCTGGT GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGACGAGTG GCTCAGCCGGTGGT---GCCGCAGCT------------GCAGCCACGGCC GCCTCCTCTGGCGGTGCTCCCGAGCAGAACAGGATGCTCGGACTGTGGGC CGCACTGGGCGCCTGCTTCCTCTCCGGATTCGCGGGCATCTACTTTGAGA AGATCCTCAAGGGTGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGTTG AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGTTTCGTTAACGACGG CAGTAGGATCTTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATATTTCTCTAC GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCATGGTCCTGG CGGCGATGAGGAGAAGCTGCTGCCGCGCGTC------------------ >C2 ATGGCGCTCCTGCCCGCCCCCGTCACGTATCCCTATTCC----------- -CATCGCGCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGACATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT CGCCAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT CTGCGACGCAAGCTGCTGAACACGCAGTGGGGAGCGCTGCTGCTCCTTGT GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGACGAGTG GTTCGGCCGGTGGA---GCCGCAGCT------------GCCGCCACGGCC GCCTCCTCTGGCGGGGCGCCTGAGCAGAACAGGATGCTCGGACTGTGGGC CGCACTGGGCGCCTGCTTCCTCTCTGGATTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGTTG AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCATCGTTAACGACGG CAGCAGGATATTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATCTTCCTCTAC GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG CGACGATGAGGAGAAGCTGCTGCCACGCGTC------------------ >C3 ATGGCGCTCCTGCCCGCCCCCGTCACGTATTCCTATTCC----------- -CATCGCGCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT CGCCAAACTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT CTGCGCCGCAAGCTGCTGAACACGCAGTGGGGAGCGCTGCTGCTCCTGGT GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGGCGAGTG GCTCGGCCGGTGGA---GCCGCAGCT------------GCCGCCACGGCC GCCTCCTCTGGCGGGGCGCCTGAGCAGAACAGGATGCTCGGACTGTGGGC CGCACTGGGCGCCTGCTTCCTCTCCGGATTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGAAATGTGCAGTTG AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCTTCGTTAACGACGG CAGCAGGATCTTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATCTTCCTCTAC GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG CGGCGATGAGGAGAAGCTCCTGCCACGCGTC------------------ >C4 ATGGCGCTCCTGCCCGCCCCCATCCCGTATTCCTATTCC----------- -CATCGCCCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTATGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCCGAGTT TGCCAAACTGATCACGTGCCTGTTCCTGGTCTTTAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTCCGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTACATCGTGCAGAA TAACCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATC CTGCGTCGCAAGCTGCTGAACACCCAGTGGGGAGCGCTGCTGCTCCTGGT CATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGACCGTCGAGTG GTTCAGCCGGTGGAGCTGCAGCAGCA------------GCAGCCACGGCC GCCTCCGCTGGAGGAGCACCTGTGCAGAACAGGATGCTTGGACTGTGGGC CGCATTGGGCGCCTGCTTCCTGTCCGGATTTGCGGGCATCTACTTCGAGA AGATCCTCAAGGGTGCCGAGATCTCCGTGTGGATGAGGAATGTGCAGTTG AGTCTGCTTAGCATTCCCTTCGGCCTGCTCACCTGCTTTGTGAACGACGG CAGCAGGATCTTCGATCAGGGATTCTTTAAGGGCTACGATCTGTTTGTCT GGTATCTGGTGCTGCTGCAGGCCGGCGGTGGATTGATTGTGGCCGTGGTG GTCAAGTATGCGGATAACATACTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTCGATTTCAATCTCACGT TGCAGTTCAGCTTTGGAGCTGGGCTGGTCATAGCCTCGATCTTTCTCTAC GGCTACGATCCTGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGACCTGG TGGCGATGAGGAGAAGCTGTTGCCACGCGTC------------------ >C5 ATGGCGCTCCTGCCCGCCCCCGTCACATATTCTTATTCC----------- -CGTCGTCCAGTGAACGCCAATACGCTGAAGTACGTCAGCCTGCTGACGC TGACCCTACAGAATGCCATCCTGGGACTCAGCATGCGCTATGCCCGCACC CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT TGCCAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTCCGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA CAACCTGCTGTACGTCTCGGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACAGCCATGTTCGCGGTTGTCATC CTGCGTCGCAAGCTGCTAAACACCCAGTGGGGAGCACTGCTGCTCCTCGT GATGGGTATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGGCGAGTG GTTCAGCCGGTGGA---GCTGCAGCA------------GCAGCCACGACT GATTTGTCTGGAGGAGCACCTGAGCAGAACAAGATGCTTGGACTGTGGGC CGCATTGGGAGCCTGCTTCCTATCCGGATTTGCGGGCATATACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGAGGAATGTGCAGTTG AGCCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCTTCATCAACGACGG CAGTAGGATCTTCGATCAGGGATTCTTCAAGGGCTACGATCTGTTTGTGT GCTATCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATTGTGGCCGTGGTG GTCAAGTATGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGATTTCAATCTCACGC TGCAGTTTAGCTTTGGCGCTGGCCTGGTCATCGCCTCGATCTTTCTCTAC GGCTACGATCCTGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG TGGCGATGAGGAGAAGCTGCTGCCACGCGTC------------------ >C6 ATGGCGCTCCTGCCCGCCCCCGTCTCCTATGCCTATGCCCAT------GC CCATCGGCCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTATGCCCGCACC CGACCTGGCGACATCTTCCTCAGCTCCACGGCCGTGCTGATGGCCGAGTT CGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTGCGCTCGCTGCACAAGACCATCATCGCCAATCCC ATGGACACGTTGAAGGTGTGCGTGCCCTCGCTGGTGTACATCGTGCAGAA CAACCTGCTGTACGTGTCCGCCTCCCACTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATCCTCACCACGGCCATGTTCGCGGTGGTCATC CTGCGCCGCAAGCTGCTTAACACCCAGTGGGGTGCGCTGCTGCTCCTGGT GATGGGCATTGTCATGGTGCAGTTGGCCCAAACTGAGGGACCATCGAGTG GCTCAGCCGGTGGA---GCTGCGGCG------------GCAGCCACGGCC GCCTCCTCGGGCGGAGCACCGGAGCAGAACAGGATGCTGGGCCTGTGGGC CGCACTGGGCGCCTGTTTCCTCTCCGGCTTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGAGGAACGTTCAGCTG AGTCTGCTCAGCATTCCCTTCGGCCTGATCACCTGCTTCGTGAACGACGG CAGCCGGATCTTCGATCGGGGCTTCTTCCACGGCTACGATCTGTTCGTCT GGTACCTCGCTCTGCTGCAGGCCGGCGGCGGTTTGATTGTGGCCGTGGTG GTCAAGTACGCGGACAACATTCTGAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGCGCTGGCCTGGTCATCGCCTCCATCTTCCTGTAC GGCTACGATCCGGCCAAATCGGCGCCAAAGTCCAGCATGCAGGGCCCCGG CGGCGACGAGGAGAAGCTGCTGCCACGCGTC------------------ >C7 ATGGCGCTCCTGCCCGCCCCCGTCTCCTATTCCTATTCC----------- -CATCGACCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTATGCCCGCACC CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCCGAGTT TGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGTTCGCTGCACAAGACCATCATTGCCAATCCC ATGGACACGCTGAAGGTGTGTGTGCCCTCGCTGGTCTACATCGTCCAAAA CAACCTGCTGTATGTATCCGCCTCCCACTTGGATGCAGCCACCTACCAGG TGACGTACCAGCTGAAGATCCTCACCACGGCCATGTTTGCTGTTGTGATC CTGCGCCGCAAGCTGCTCAACACACAGTGGGGTGCGTTGCTGCTCCTGGT GATGGGCATTGTCCTGGTGCAGTTGGCCCAAACAGTGGGACCATCGAGTG GCTCAGCCGGTGGA---GCTGCAGCA------------GCGGCCACGGCA GCCTCCTCTGGAGGAGCGCCCGAACAGAACAGAATGCTGGGTCTGTGGGC CGCACTGGGCGCCTGTTTCCTTTCTGGATTTGCGGGCATCTACTTTGAGA AGATCCTCAAGGGCGCCGAGATCTCTGTGTGGATGAGGAACGTTCAGTTG AGTCTGCTCAGCATTCCCTTCGGACTGATCACCTGCTTTGTAAACGACGG CAGCAGGATCTTCGACCGGGGATTCTTCAATGGCTACGATATGTTCGTCT GGTATCTAGTTCTGCTGCAGGCCGGCGGTGGCTTGATAGTGGCCGTGGTG GTCAAGTATGCGGACAACATTCTGAAGGGCTTCGCCACCTCGCTGGCCAT CATTATCTCATGTGTGGCCTCCATCTACATCTTTGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGTCTGGTCATCGCTTCGATCTTCCTATAT GGCTATGATCCGGGCAGATCGGCGCCAAAGTCGACTATGCAGGGTCCTGG CGGCGATGAGGAGAAGCTGCTGCCACGCGTC------------------ >C8 ATGGCGCTCCTTCCCGCACCCGTCACCTATTCCTAT-------------- ----CGTCCAGTGAATGCCAATACTCTAAAGTACATCAGTCTGCTGACGC TGACCCTCCAGAATGCTATCCTGGGCCTCAGTATGCGATATGCCCGTACT CGACCAGGCGACATCTTCCTCAGTTCAACGGCCGTGCTAATGGCCGAGTT CGCTAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTCAGATCGCTGCACAAGACTATCATTGCCAATCCT ATGGATACGCTGAAGGTGTGTGTGCCCTCGCTGGTTTACATCGTCCAAAA CAACCTGTTGTATGTATCCGCCTCCCATTTGGATGCAGCTACTTACCAGG TTACGTACCAGCTGAAGATACTCACCACGGCCATGTTTGCGGTTGTTATT CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCATTGTTGCTCTTGGT GATGGGCATTGTTCTGGTGCAATTGGCCCAGACGGTGGGATCATCGACTG GGTCAGCCGGTGGA---GCTGCAGCA------------GCAGCCACGGCC GCCTCTTCCGGCGGAATACCCGAACAAAACAAGATGCTTGGGCTATGGGC TGCCCTGGGTGCCTGTTTCCTTTCCGGATTTGCGGGCATCTACTTCGAAA AGATACTAAAGGGTGCAGAGATCTCGGTGTGGATGAGGAATGTCCAGTTG AGTCTGCTCAGCATTCCTTTCGGCCTGCTCACCTGCTTTGTAAACGACGG CAGTAGGATCTTCGACCAAGGATTCTTCAATGGCTACGATCTGTTCGTTT GGTATCTAGTTCTGCTGCAGGCCGGCGGTGGTTTGATCGTGGCCGTGGTG GTGAAGTATGCAGACAACATACTTAAAGGTTTCGCCACCTCGTTGGCCAT CATCATATCGTGTGTGGCCTCCATCTACATCTTTGACTTCAATCTCACAC TCCAGTTTAGCTTTGGAGCTGGTCTGGTAATCGCCTCGATCTTTTTATAT GGCTATGATCCTGCCAGGTCCGTACCAAAATTGGCAATGCAGGGCCCTGG CAGCGATGAGGAGAAATTACTGCCACGCGTC------------------ >C9 ATGGCGCTTCTGCCCGCACCTGCCACATACTCATACTCCTACTCGTATCC CCGCCGCCTAGTGAACGCCAACACGTTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAAAATGCCATCCTGGGGCTCAGCATGCGGTACGCCCGCACC CGGCCCGGCGACATCTTCCTCAGCTCCACGGCCGTCCTAATGGCCGAGTT CGCCAAGCTCATCACGTGCCTGTTCCTGGTCTTCAACGAAGAGGGCAAAG ATGCCCAAAAGTTTGTCCGTTCGCTGCACAAGACCATTGTTGCCAACCCC ATGGACACGCTGAAGGTATGTGTGCCGTCGCTGGTATACATTGTTCAAAA CAACCTGCTGTACGTGTCCGCCTCCCACTTGGACGCAGCCACCTACCAAG TTACGTATCAGCTGAAGATCCTTACCACGGCCATGTTTGCGGTGGTTATC CTGCGGCGCAAGCTGCTAAACACTCAGTGGGGCGCGCTGTTGCTGCTGGT GATGGGCATTGTGCTAGTGCAGCTGGCTCAAACAGAGGCTCCGGCGACTG GTTCGGCCGGTGGA---GCGGCAGCT------------GCGGCCACGGCG TCTTCTAGAGGAGCAGCCCCCGAACAGAACCGTATGCTCGGACTGTGGGC CGCCCTAGGCGCCTGTTTCCTCTCCGGATTTGCGGGCATCTACTTCGAAA AGATCCTCAAGGGAGCCGAGATCTCCGTGTGGATGAGGAACGTGCAACTA AGTCTGCTCAGTATTCCCTTTGGCCTGCTCACCTGCGTCGTTAACGATGG CAGCAGGATCTTCGACCAAGGCTTCTTCCACGGCTACGATTTGTTTGTCT GGTACCTGGTACTCCTGCAGGCCGGCGGCGGTTTGATCGTGGCCGTAGTG GTCAAGTATGCGGACAACATACTCAAAGGCTTTGCCACTTCGCTAGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTTGAGTTCAACCTTACGC TGCAGTTCACCTTTGGAGCTGGTCTGGTCATCGCTTCAATTTTCCTGTAT GGTTACGACCCGGCGAGATCGGCGCCGAAATCCAGTATGCAGGCTCCCGG CGGCGACGAGGAAAAGCTGCTGCCCCGTGTC------------------ >C10 ATGGCGCTTCTGCCTGCACCCGTCACCTATTCCTAT-------------- ----CGCCCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCTTGCAGAATGCTATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGGCCTGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCAGAGTT CGCCAAGCTCATTACGTGCCTGTTCCTGGTCTTCAATGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGTTCGCTGCATAAGACTATCATTGCGAATCCA ATGGACACGCTAAAGGTGTGTGTGCCCTCGCTGGTTTACATCGTCCAAAA CAACCTGCTGTATGTGTCCGCCTCCCACTTGGATGCGGCCACCTACCAGG TGACTTACCAGCTGAAGATCCTCACCACGGCCATGTTCGCGGTGGTGATT CTGCGTCGCAAGTTGCTCAACACCCAATGGGGTGCGCTGTTGCTCCTGGT TATGGGTATTGTCATGGTCCAGTTGGCTCAAACGGTGGGACCGTCGAGCG GTTCAGCCGGTGGA---ACTGGAGCT------------GCAGCGACCGCC TCTTCCGTTGGAGGAGCACCCGAACAGAACAGGATGCTCGGACTGTGGGC AGCACTGGGTGCCTGCTTCCTTTCCGGATTCGCGGGCATATACTTTGAGA AGATCCTCAAAGGAGCCGAGATCTCCGTGTGGATGAGGAATGTCCAGCTG AGTCTGCTGAGTATTCCCTTCGGCCTGCTCACTTGCCTCGTAAACGACGG CAGTCGGATCTTCGACCAGGGGTTCTTCAATGGCTACGATGCGTTCGTTT GGTACCTGGTTCTTCTGCAGGCCGGCGGTGGCCTGATCGTAGCCGTAGTG GTCAAGTATGCGGACAACATACTCAAGGGCTTCGCCACCTCCCTGGCCAT CATCATTTCGTGCGTGGCCTCCATCTACATCTTTGACTTCAATCTCACAC TGCAGTTTAGCTTCGGAGCTGGCCTGGTCATCGCCTCGATCTTTCTTTAT GGCTACGATCCTGCCAGATCGGCGCCAAAGTCGAGTATGCAGGGTCCTGC TGGCGACGAGGAAAAGTTGCTGCCGCGCGTC------------------ >C11 ATGGCGCTCCTGCCCGCACCCGTCACCTATTCCTATTCC----------- -CATCGCCAAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACTTTGCAGAATGCGATCCTGGGTCTCAGCATGCGCTATGCCCGCACC CGGCCGGGCGACATCTTCCTCAGTTCCACGGCCGTGCTAATGGCCGAGTT CGCCAAACTCATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGTTCGCTGCACAAGACCATCATTGCCAATCCC ATGGACACGCTGAAGGTGTGCGTGCCCTCGCTGGTGTACATCGTCCAGAA CAACCTGCTGTATGTGTCCGCCTCGCACTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTAAAGATCCTCACCACGGCCATGTTTGCTGTGGTGATA CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCGCTGTTGCTCCTGGT GATGGGCATCGTTCTGGTGCAGTTGGCCCAAACTGTGGGCCCGTCGAGCG GTCCAGCCGATGGA---GCCGGAGCCGGAGCTGCGGCCACGGCCGCCGCC TCCTCCGCTGGCGGAGCACCCGAGCAGAACAGGATGCTCGGACTGTGGGC AGCACTGGGCGCCTGCTTTCTGTCCGGATTCGCTGGCATCTACTTCGAGA AGATCCTCAAGGGTGCCGAGATTTCCGTGTGGATGAGGAACGTCCAGCTG AGCCTGCTGAGCATTCCCTTCGGCCTGCTCACCTGCCTCGTGAACGACGG CAGCCGGATCTTCGAGCAGGGATTTTTCCATGGCTACGACGTATTCGTCT GGTATCTGGTCCTGCTGCAGGCCGGCGGCGGCCTGATCGTGGCCGTGGTG GTCAAGTATGCGGACAACATACTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTAGCCTCCATCTACATCTTCGACTTCAATCTCACGC TTCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCTTCGATCTTTCTATAT GGCTACGATCCGGCCAGATCGGCTCCAAAGTCGAGCATGCAGGGTCCTGG CGGCGACGAGGAGAAGCTGCTGCCGCGCGTC------------------ >C12 ATGGCGCTCCTGCCCGCCCCCGTCACCTATTCCTACTCC----------- -CATCGCCCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTACGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCCGAGTT TGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGCTCGCTGCACAAGACCATCATTGCCAATCCC ATGGACACGCTGAAGGTGTGCGTGCCCTCGCTGGTTTACATCGTCCAGAA CAACCTGCTGTATGTGTCCGCCTCGCATCTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATCCTCACCACCGCCATGTTTGCGGTGGTGATC CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCTCTGCTGCTCCTGGT GATGGGCATTGTCCTGGTGCAGTTGGCCCAAACGGTGGGTCCATCGAGTG GTTCGGCCGCTGGA---GCTTCGGCC------------------ACGGCC GCCTCCTCGGGAGGAGCGCCCGAACAGAACAGGATGCTGGGTCTGTGGGC CGCCCTGGGCGCCTGTTTCCTCTCCGGATTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGCTG AGTCTGCTGAGCATTCCCTTCGGCCTGCTCACCTGCTTCGTGAACGACGG CAGCCGGATCTTCGACCAGGGATTCTTCCATGGCTACGATGTGTTCGTCT GGTATCTGGTGCTGCTGCAGGCCGGCGGTGGCCTGATCGTGGCCGTGGTG GTCAAGTATGCGGACAACATACTGAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTTGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCCGGCCTGGTCATCGCCTCGATCTTTTTGTAT GGCTATGATCCTGCCAGATCCACGCCCAAGTCGAATATGCAGGGTCCTGG CGGCGACGAGGAGAAACTGCTGCCACGCGTC------------------ >C1 MALLPAPVTYSYSooooHRTVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGoAAAooooAATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMHGPGGDEEKLLPRV >C2 MALLPAPVTYPYSooooHRAVNANTLKYISLLTLTLQNDILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGoAAAooooAATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGDDEEKLLPRV >C3 MALLPAPVTYSYSooooHRAVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGGoAAAooooAATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRV >C4 MALLPAPIPYSYSooooHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAAooooAATA ASAGGAPVQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRV >C5 MALLPAPVTYSYSooooRRPVNANTLKYVSLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGGoAAAooooAATT DLSGGAPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRV >C6 MALLPAPVSYAYAHooAHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGGoAAAooooAATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPAKSAPKSSMQGPGGDEEKLLPRV >C7 MALLPAPVSYSYSooooHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGGoAAAooooAATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPGRSAPKSTMQGPGGDEEKLLPRV >C8 MALLPAPVTYSYooooooRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGSSTGSAGGoAAAooooAATA ASSGGIPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSVPKLAMQGPGSDEEKLLPRV >C9 MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGGoAAAooooAATA SSRGAAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLY GYDPARSAPKSSMQAPGGDEEKLLPRV >C10 MALLPAPVTYSYooooooRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTVGPSSGSAGGoTGAooooAATA SSVGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPAGDEEKLLPRV >C11 MALLPAPVTYSYSooooHRQVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADGoAGAGAAATAAA SSAGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPGGDEEKLLPRV >C12 MALLPAPVTYSYSooooHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAGoASAooooooTA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSTPKSNMQGPGGDEEKLLPRV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 12 taxa and 1149 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Taxon 11 -> C11 Taxon 12 -> C12 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479140561 Setting output file names to "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 705502237 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3714470184 Seed = 141175611 Swapseed = 1479140561 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 56 unique site patterns Division 2 has 37 unique site patterns Division 3 has 200 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -6282.536455 -- -24.979900 Chain 2 -- -6057.365432 -- -24.979900 Chain 3 -- -6157.098967 -- -24.979900 Chain 4 -- -6119.012146 -- -24.979900 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -6220.419834 -- -24.979900 Chain 2 -- -6221.452661 -- -24.979900 Chain 3 -- -5998.055725 -- -24.979900 Chain 4 -- -6198.389790 -- -24.979900 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-6282.536] (-6057.365) (-6157.099) (-6119.012) * [-6220.420] (-6221.453) (-5998.056) (-6198.390) 500 -- (-4759.316) (-4793.354) [-4678.989] (-4790.832) * (-4778.935) (-4766.855) (-4751.554) [-4741.659] -- 0:33:19 1000 -- [-4539.020] (-4689.287) (-4527.064) (-4580.887) * (-4621.370) (-4568.436) [-4564.176] (-4596.282) -- 0:16:39 1500 -- (-4536.545) (-4515.558) [-4485.744] (-4507.564) * (-4500.204) (-4523.390) (-4478.087) [-4477.339] -- 0:22:11 2000 -- (-4503.170) (-4496.484) (-4474.662) [-4462.339] * [-4447.953] (-4513.976) (-4463.893) (-4465.108) -- 0:16:38 2500 -- (-4473.108) (-4461.691) (-4447.949) [-4437.218] * [-4451.293] (-4503.705) (-4457.203) (-4451.361) -- 0:13:18 3000 -- (-4471.001) [-4445.219] (-4456.287) (-4437.627) * (-4439.595) (-4477.510) [-4438.566] (-4436.472) -- 0:16:37 3500 -- (-4461.975) (-4440.544) (-4439.911) [-4437.987] * [-4429.563] (-4461.629) (-4443.097) (-4441.180) -- 0:14:14 4000 -- [-4443.585] (-4446.478) (-4443.301) (-4442.693) * (-4438.270) (-4453.096) (-4433.437) [-4437.223] -- 0:12:27 4500 -- (-4438.503) (-4438.336) [-4436.560] (-4440.731) * (-4427.634) (-4449.283) [-4432.240] (-4449.028) -- 0:14:44 5000 -- (-4439.422) (-4436.253) [-4436.639] (-4436.030) * (-4438.745) (-4444.820) (-4443.705) [-4440.421] -- 0:13:16 Average standard deviation of split frequencies: 0.078567 5500 -- (-4432.399) (-4446.949) (-4431.248) [-4435.947] * (-4438.079) (-4438.127) [-4441.653] (-4443.844) -- 0:15:04 6000 -- [-4430.263] (-4439.791) (-4432.382) (-4444.002) * (-4439.258) (-4438.553) [-4437.032] (-4433.673) -- 0:13:48 6500 -- [-4427.877] (-4441.234) (-4435.669) (-4446.325) * (-4435.716) [-4434.883] (-4433.382) (-4436.001) -- 0:12:44 7000 -- [-4431.485] (-4440.387) (-4434.989) (-4438.406) * (-4444.201) (-4439.484) (-4446.062) [-4431.487] -- 0:14:11 7500 -- (-4452.483) (-4436.216) [-4442.200] (-4441.238) * [-4431.316] (-4445.217) (-4433.227) (-4447.971) -- 0:13:14 8000 -- [-4440.402] (-4449.550) (-4448.580) (-4438.847) * (-4447.944) (-4446.930) (-4431.354) [-4429.491] -- 0:12:24 8500 -- (-4437.203) (-4449.356) (-4448.454) [-4432.421] * (-4435.635) (-4444.954) (-4434.995) [-4432.126] -- 0:13:36 9000 -- [-4436.339] (-4447.362) (-4431.869) (-4438.253) * (-4432.893) (-4447.586) (-4439.317) [-4441.764] -- 0:12:50 9500 -- [-4436.759] (-4438.620) (-4442.594) (-4441.132) * [-4426.688] (-4438.626) (-4428.474) (-4438.559) -- 0:13:54 10000 -- [-4438.852] (-4437.488) (-4437.742) (-4458.013) * (-4443.611) (-4436.200) (-4444.851) [-4428.251] -- 0:13:12 Average standard deviation of split frequencies: 0.044194 10500 -- [-4430.217] (-4433.773) (-4433.373) (-4430.302) * [-4431.515] (-4442.511) (-4448.713) (-4443.165) -- 0:12:33 11000 -- (-4438.321) (-4432.153) (-4443.608) [-4439.879] * [-4435.362] (-4428.664) (-4442.191) (-4441.558) -- 0:13:29 11500 -- (-4436.366) [-4429.108] (-4434.576) (-4428.540) * (-4431.165) (-4435.423) [-4442.320] (-4454.109) -- 0:12:53 12000 -- [-4433.901] (-4446.440) (-4439.838) (-4433.984) * (-4431.437) (-4437.903) (-4446.157) [-4435.983] -- 0:12:21 12500 -- (-4440.691) [-4433.014] (-4444.052) (-4441.831) * (-4436.899) [-4435.320] (-4439.419) (-4441.228) -- 0:13:10 13000 -- (-4444.221) (-4447.495) [-4429.474] (-4439.583) * (-4434.715) [-4433.362] (-4439.491) (-4435.675) -- 0:12:39 13500 -- (-4431.220) [-4443.419] (-4446.045) (-4441.571) * (-4443.572) [-4426.830] (-4449.262) (-4450.997) -- 0:13:23 14000 -- (-4443.233) (-4432.097) [-4433.700] (-4436.738) * (-4439.477) (-4435.026) (-4438.460) [-4432.538] -- 0:12:54 14500 -- [-4440.384] (-4437.898) (-4435.542) (-4451.934) * (-4438.618) (-4437.364) (-4434.618) [-4429.550] -- 0:12:27 15000 -- (-4434.810) (-4435.659) [-4433.983] (-4436.227) * (-4440.638) (-4433.318) (-4435.141) [-4430.813] -- 0:13:08 Average standard deviation of split frequencies: 0.033672 15500 -- (-4433.277) (-4432.274) [-4433.968] (-4442.371) * (-4433.609) (-4437.453) [-4431.797] (-4440.692) -- 0:12:42 16000 -- [-4436.074] (-4433.592) (-4450.325) (-4433.726) * (-4440.039) (-4432.526) [-4437.477] (-4439.640) -- 0:13:19 16500 -- [-4435.510] (-4432.307) (-4440.628) (-4444.938) * [-4429.012] (-4436.052) (-4443.767) (-4431.480) -- 0:12:54 17000 -- [-4435.180] (-4441.396) (-4442.068) (-4440.078) * (-4438.292) [-4432.096] (-4450.918) (-4441.298) -- 0:12:31 17500 -- (-4434.253) (-4443.096) (-4440.580) [-4438.230] * (-4438.043) (-4432.255) (-4437.570) [-4439.716] -- 0:13:06 18000 -- [-4432.510] (-4431.138) (-4432.580) (-4432.387) * (-4438.949) (-4440.066) [-4430.386] (-4436.719) -- 0:12:43 18500 -- (-4434.341) (-4428.502) (-4441.370) [-4432.006] * [-4435.603] (-4445.967) (-4443.837) (-4442.735) -- 0:12:22 19000 -- (-4436.117) [-4431.583] (-4438.223) (-4441.375) * (-4437.454) [-4451.223] (-4448.531) (-4438.892) -- 0:12:54 19500 -- [-4435.821] (-4432.175) (-4433.926) (-4433.377) * [-4439.188] (-4453.311) (-4433.742) (-4446.531) -- 0:12:34 20000 -- (-4445.244) [-4446.426] (-4438.028) (-4448.355) * (-4442.753) (-4443.486) [-4434.655] (-4444.511) -- 0:13:04 Average standard deviation of split frequencies: 0.056264 20500 -- (-4444.224) (-4443.279) [-4436.760] (-4442.506) * [-4446.928] (-4446.226) (-4436.157) (-4436.955) -- 0:12:44 21000 -- (-4435.738) [-4433.839] (-4437.890) (-4447.854) * [-4435.302] (-4442.064) (-4431.903) (-4443.799) -- 0:12:25 21500 -- [-4440.215] (-4436.868) (-4438.476) (-4438.589) * [-4430.157] (-4447.449) (-4440.296) (-4439.137) -- 0:12:53 22000 -- (-4436.904) (-4430.557) [-4434.524] (-4437.843) * (-4435.760) (-4440.786) (-4435.870) [-4445.395] -- 0:12:35 22500 -- [-4432.781] (-4436.864) (-4435.498) (-4439.940) * (-4433.738) [-4437.458] (-4444.033) (-4454.185) -- 0:13:02 23000 -- (-4442.357) (-4440.960) [-4433.534] (-4434.990) * (-4439.899) [-4433.306] (-4442.248) (-4437.946) -- 0:12:44 23500 -- (-4437.331) (-4445.869) (-4434.937) [-4430.262] * (-4438.250) [-4447.535] (-4433.236) (-4444.387) -- 0:12:27 24000 -- (-4426.982) (-4438.330) [-4433.789] (-4439.277) * (-4436.078) (-4442.284) (-4437.181) [-4437.607] -- 0:12:52 24500 -- [-4430.603] (-4441.259) (-4438.421) (-4439.078) * (-4435.121) (-4439.284) (-4434.837) [-4435.019] -- 0:12:36 25000 -- (-4435.105) (-4444.867) (-4438.198) [-4433.455] * (-4436.961) (-4440.247) [-4447.206] (-4433.686) -- 0:12:21 Average standard deviation of split frequencies: 0.038679 25500 -- (-4453.170) (-4439.296) (-4430.890) [-4440.264] * (-4437.544) [-4436.772] (-4433.346) (-4440.026) -- 0:12:44 26000 -- (-4453.796) [-4438.720] (-4440.567) (-4442.206) * (-4433.050) (-4439.470) (-4441.199) [-4440.726] -- 0:12:29 26500 -- (-4449.671) (-4442.894) [-4436.667] (-4434.969) * (-4445.683) (-4439.390) (-4437.178) [-4441.336] -- 0:12:51 27000 -- (-4446.905) (-4432.680) (-4435.243) [-4435.464] * (-4433.608) [-4439.991] (-4450.124) (-4440.606) -- 0:12:36 27500 -- (-4432.231) [-4437.755] (-4451.356) (-4442.235) * [-4430.512] (-4436.833) (-4444.294) (-4442.017) -- 0:12:22 28000 -- (-4441.353) [-4431.896] (-4442.792) (-4440.056) * (-4439.204) (-4446.775) [-4442.132] (-4439.646) -- 0:12:43 28500 -- [-4436.865] (-4445.856) (-4435.433) (-4438.156) * [-4433.400] (-4445.389) (-4433.321) (-4441.363) -- 0:12:29 29000 -- (-4437.359) (-4448.143) (-4431.265) [-4436.428] * (-4439.449) [-4439.892] (-4449.531) (-4438.091) -- 0:12:16 29500 -- (-4439.286) (-4446.967) (-4447.576) [-4436.033] * (-4437.196) [-4439.944] (-4434.731) (-4452.432) -- 0:12:36 30000 -- (-4434.728) (-4438.540) [-4433.477] (-4434.333) * (-4442.905) [-4432.449] (-4431.051) (-4451.115) -- 0:12:23 Average standard deviation of split frequencies: 0.029719 30500 -- [-4432.365] (-4440.937) (-4444.146) (-4437.381) * (-4434.437) (-4433.186) (-4435.920) [-4436.476] -- 0:12:42 31000 -- (-4438.355) (-4436.825) (-4436.213) [-4437.192] * [-4438.170] (-4438.744) (-4439.414) (-4434.795) -- 0:12:30 31500 -- [-4438.634] (-4441.450) (-4446.053) (-4446.679) * (-4446.286) (-4435.248) [-4435.574] (-4444.809) -- 0:12:17 32000 -- (-4434.624) (-4441.587) (-4439.038) [-4434.572] * [-4434.825] (-4434.415) (-4444.654) (-4433.904) -- 0:12:36 32500 -- (-4441.351) (-4446.867) [-4434.567] (-4425.105) * [-4431.071] (-4436.802) (-4450.670) (-4445.113) -- 0:12:24 33000 -- (-4434.941) (-4440.116) (-4434.131) [-4433.979] * (-4435.688) (-4438.592) [-4439.500] (-4433.635) -- 0:12:41 33500 -- (-4438.403) [-4429.329] (-4442.222) (-4433.886) * (-4445.134) [-4430.070] (-4437.592) (-4439.610) -- 0:12:30 34000 -- (-4432.009) [-4439.058] (-4442.901) (-4436.378) * (-4445.596) (-4432.931) [-4431.833] (-4443.565) -- 0:12:18 34500 -- [-4437.465] (-4433.398) (-4436.099) (-4440.405) * (-4441.365) (-4439.468) [-4433.741] (-4449.659) -- 0:12:35 35000 -- (-4434.972) (-4434.689) (-4440.096) [-4437.472] * (-4442.336) (-4443.771) [-4436.013] (-4443.782) -- 0:12:24 Average standard deviation of split frequencies: 0.037413 35500 -- [-4435.052] (-4437.384) (-4436.442) (-4450.766) * (-4444.618) (-4442.575) [-4433.861] (-4439.711) -- 0:12:13 36000 -- (-4449.253) (-4442.357) (-4441.148) [-4437.643] * [-4433.861] (-4444.379) (-4438.001) (-4445.353) -- 0:12:29 36500 -- (-4442.443) [-4435.880] (-4438.948) (-4445.389) * (-4436.912) (-4453.061) [-4436.298] (-4448.427) -- 0:12:19 37000 -- (-4441.453) [-4435.082] (-4440.999) (-4445.665) * (-4444.733) (-4447.300) (-4437.105) [-4428.897] -- 0:12:34 37500 -- [-4435.407] (-4437.208) (-4435.425) (-4457.473) * (-4443.443) [-4437.182] (-4440.983) (-4431.799) -- 0:12:24 38000 -- (-4435.262) [-4434.865] (-4441.437) (-4440.428) * (-4436.838) (-4431.753) [-4434.628] (-4446.873) -- 0:12:14 38500 -- (-4444.267) [-4434.962] (-4438.432) (-4436.415) * (-4434.705) [-4431.110] (-4437.727) (-4433.264) -- 0:12:29 39000 -- (-4446.751) (-4448.714) [-4441.310] (-4444.119) * (-4428.468) (-4451.291) [-4429.218] (-4435.442) -- 0:12:19 39500 -- (-4439.740) (-4449.477) (-4434.564) [-4439.604] * (-4435.390) (-4438.234) [-4432.734] (-4441.462) -- 0:12:09 40000 -- [-4438.574] (-4441.419) (-4445.499) (-4436.233) * (-4434.080) [-4439.833] (-4438.029) (-4444.194) -- 0:12:24 Average standard deviation of split frequencies: 0.025668 40500 -- (-4432.627) [-4436.055] (-4442.652) (-4435.648) * (-4443.522) (-4440.049) [-4441.256] (-4434.148) -- 0:12:14 41000 -- (-4433.627) (-4440.374) (-4445.285) [-4439.860] * (-4444.210) [-4442.747] (-4447.053) (-4439.726) -- 0:12:28 41500 -- (-4442.772) (-4443.210) (-4447.871) [-4435.070] * [-4444.476] (-4443.502) (-4437.176) (-4438.153) -- 0:12:19 42000 -- [-4435.069] (-4433.333) (-4447.523) (-4442.235) * (-4440.962) (-4441.509) (-4435.198) [-4427.210] -- 0:12:09 42500 -- (-4434.277) (-4442.635) [-4441.019] (-4435.475) * [-4438.566] (-4438.882) (-4436.447) (-4436.241) -- 0:12:23 43000 -- (-4446.322) (-4435.437) (-4431.653) [-4435.196] * (-4447.716) [-4435.578] (-4436.848) (-4447.632) -- 0:12:14 43500 -- [-4438.720] (-4438.390) (-4429.029) (-4434.281) * (-4446.231) [-4437.029] (-4431.920) (-4450.066) -- 0:12:27 44000 -- (-4445.877) (-4436.046) [-4436.862] (-4435.800) * (-4440.562) (-4437.905) [-4436.088] (-4439.040) -- 0:12:18 44500 -- (-4440.504) [-4433.404] (-4433.870) (-4428.340) * (-4447.122) (-4440.964) (-4442.964) [-4435.347] -- 0:12:10 45000 -- [-4436.338] (-4437.813) (-4432.223) (-4436.909) * (-4444.370) (-4446.184) [-4446.106] (-4437.079) -- 0:12:22 Average standard deviation of split frequencies: 0.022692 45500 -- (-4440.656) [-4435.854] (-4439.325) (-4443.864) * (-4442.223) (-4450.626) (-4437.609) [-4440.974] -- 0:12:14 46000 -- [-4437.306] (-4431.959) (-4442.079) (-4436.484) * (-4447.308) (-4445.630) [-4442.259] (-4438.389) -- 0:12:05 46500 -- (-4441.929) (-4442.672) [-4440.548] (-4435.849) * (-4440.659) [-4435.801] (-4453.928) (-4437.061) -- 0:12:18 47000 -- (-4440.081) (-4440.479) [-4439.232] (-4431.364) * (-4440.460) (-4432.955) [-4437.438] (-4440.264) -- 0:12:09 47500 -- [-4441.339] (-4444.595) (-4438.391) (-4443.885) * (-4434.527) [-4437.352] (-4444.615) (-4438.147) -- 0:12:21 48000 -- (-4439.896) [-4438.466] (-4433.877) (-4446.915) * [-4437.029] (-4435.864) (-4432.832) (-4441.545) -- 0:12:13 48500 -- (-4436.959) (-4432.440) [-4428.579] (-4446.886) * (-4442.851) [-4434.188] (-4434.991) (-4443.324) -- 0:12:05 49000 -- [-4437.494] (-4440.701) (-4447.990) (-4447.802) * (-4437.131) (-4433.771) [-4432.074] (-4436.423) -- 0:12:17 49500 -- (-4441.100) [-4431.921] (-4434.152) (-4437.426) * [-4430.687] (-4432.251) (-4432.175) (-4450.508) -- 0:12:09 50000 -- (-4436.378) (-4437.284) [-4434.984] (-4434.576) * (-4443.017) (-4442.606) [-4432.084] (-4445.833) -- 0:12:21 Average standard deviation of split frequencies: 0.026051 50500 -- (-4440.575) [-4439.964] (-4432.417) (-4433.761) * (-4438.475) (-4429.979) [-4431.546] (-4439.508) -- 0:12:13 51000 -- (-4441.974) (-4440.491) (-4435.245) [-4433.985] * [-4443.261] (-4433.292) (-4435.120) (-4441.148) -- 0:12:05 51500 -- (-4444.389) (-4444.761) (-4443.746) [-4437.131] * [-4440.573] (-4438.245) (-4438.248) (-4432.443) -- 0:12:16 52000 -- (-4453.788) (-4438.684) [-4435.629] (-4432.892) * (-4434.795) [-4442.203] (-4440.804) (-4446.917) -- 0:12:09 52500 -- (-4451.568) [-4445.650] (-4432.813) (-4435.854) * (-4440.914) (-4445.902) [-4426.696] (-4447.583) -- 0:12:19 53000 -- (-4446.269) (-4434.183) (-4446.395) [-4431.571] * (-4436.503) (-4436.438) (-4437.867) [-4442.657] -- 0:12:12 53500 -- (-4440.214) [-4435.426] (-4447.145) (-4437.037) * (-4432.763) (-4442.485) (-4427.177) [-4433.160] -- 0:12:05 54000 -- (-4447.192) (-4438.204) (-4445.236) [-4432.549] * [-4437.877] (-4436.330) (-4431.189) (-4434.035) -- 0:12:15 54500 -- [-4436.076] (-4445.210) (-4436.869) (-4435.822) * (-4437.240) (-4444.329) [-4437.747] (-4436.266) -- 0:12:08 55000 -- (-4441.966) (-4449.959) [-4441.956] (-4434.064) * [-4442.850] (-4437.918) (-4438.776) (-4439.925) -- 0:12:18 Average standard deviation of split frequencies: 0.028621 55500 -- (-4435.563) (-4433.097) (-4448.773) [-4435.623] * (-4434.194) (-4451.642) [-4433.098] (-4431.698) -- 0:12:11 56000 -- (-4431.759) (-4438.857) (-4439.339) [-4434.131] * [-4433.123] (-4449.585) (-4442.598) (-4441.429) -- 0:12:04 56500 -- (-4444.545) [-4434.496] (-4436.147) (-4451.990) * (-4441.571) (-4445.997) (-4437.946) [-4428.410] -- 0:12:14 57000 -- (-4451.443) (-4441.199) [-4441.375] (-4438.067) * [-4434.592] (-4448.975) (-4441.509) (-4439.272) -- 0:12:07 57500 -- [-4433.059] (-4443.211) (-4444.663) (-4440.370) * (-4442.398) (-4445.662) [-4431.831] (-4447.380) -- 0:12:17 58000 -- [-4443.150] (-4439.595) (-4429.763) (-4453.015) * [-4434.678] (-4437.955) (-4441.858) (-4438.590) -- 0:12:10 58500 -- (-4442.470) (-4444.726) (-4431.655) [-4455.165] * (-4439.285) [-4438.983] (-4429.206) (-4443.911) -- 0:12:04 59000 -- (-4462.294) [-4431.533] (-4428.606) (-4444.023) * (-4445.093) (-4436.769) (-4442.370) [-4434.973] -- 0:12:13 59500 -- (-4443.591) (-4434.818) [-4432.946] (-4435.979) * [-4435.603] (-4436.467) (-4438.901) (-4439.681) -- 0:12:07 60000 -- [-4432.956] (-4446.318) (-4442.188) (-4435.186) * [-4438.683] (-4440.152) (-4439.811) (-4433.689) -- 0:12:16 Average standard deviation of split frequencies: 0.027196 60500 -- (-4438.916) (-4432.910) [-4431.055] (-4436.777) * [-4429.879] (-4444.161) (-4436.433) (-4432.904) -- 0:12:09 61000 -- (-4431.475) (-4441.090) [-4436.803] (-4430.315) * (-4446.366) (-4438.011) (-4435.763) [-4429.744] -- 0:12:03 61500 -- [-4441.465] (-4430.343) (-4452.189) (-4429.895) * (-4434.532) (-4440.254) [-4436.411] (-4440.199) -- 0:12:12 62000 -- (-4438.759) (-4438.464) (-4446.031) [-4436.053] * (-4439.724) (-4438.947) [-4438.812] (-4441.876) -- 0:12:06 62500 -- (-4439.096) (-4438.331) [-4437.596] (-4434.961) * (-4435.935) (-4446.538) [-4438.583] (-4431.790) -- 0:12:15 63000 -- [-4447.301] (-4440.290) (-4442.320) (-4434.228) * [-4431.882] (-4441.035) (-4434.679) (-4441.525) -- 0:12:08 63500 -- [-4431.176] (-4443.946) (-4446.458) (-4439.589) * (-4434.337) (-4446.341) (-4438.069) [-4443.560] -- 0:12:02 64000 -- (-4436.131) (-4438.412) (-4437.280) [-4444.128] * [-4429.048] (-4443.704) (-4435.639) (-4434.570) -- 0:12:11 64500 -- (-4438.308) [-4437.643] (-4438.674) (-4437.665) * (-4440.246) [-4443.044] (-4436.450) (-4441.363) -- 0:12:05 65000 -- [-4439.975] (-4441.529) (-4448.401) (-4442.041) * (-4434.661) (-4438.403) (-4448.096) [-4439.705] -- 0:11:59 Average standard deviation of split frequencies: 0.031427 65500 -- (-4436.864) (-4441.634) (-4441.941) [-4450.981] * (-4441.000) (-4439.819) (-4441.132) [-4434.836] -- 0:12:07 66000 -- [-4442.626] (-4445.106) (-4433.673) (-4435.383) * [-4431.481] (-4451.168) (-4432.350) (-4437.446) -- 0:12:01 66500 -- (-4437.214) (-4438.475) [-4428.886] (-4444.405) * (-4438.124) (-4438.807) [-4441.154] (-4444.527) -- 0:12:09 67000 -- [-4434.602] (-4449.781) (-4446.290) (-4439.117) * [-4437.945] (-4438.631) (-4440.378) (-4438.176) -- 0:12:04 67500 -- (-4456.757) (-4437.872) (-4439.022) [-4434.138] * [-4431.111] (-4438.137) (-4435.444) (-4435.908) -- 0:11:58 68000 -- (-4438.944) (-4444.081) (-4446.393) [-4438.833] * (-4435.668) (-4433.592) (-4430.614) [-4437.723] -- 0:12:06 68500 -- (-4437.229) (-4436.656) (-4449.482) [-4437.970] * [-4444.964] (-4437.558) (-4436.866) (-4437.685) -- 0:12:00 69000 -- [-4442.754] (-4445.724) (-4448.352) (-4431.822) * (-4439.472) [-4442.176] (-4444.917) (-4443.112) -- 0:12:08 69500 -- (-4438.448) (-4440.393) [-4435.786] (-4442.525) * [-4434.687] (-4439.638) (-4438.334) (-4437.131) -- 0:12:02 70000 -- (-4439.708) [-4440.398] (-4438.771) (-4434.794) * (-4441.081) (-4434.646) [-4435.653] (-4438.435) -- 0:11:57 Average standard deviation of split frequencies: 0.028907 70500 -- (-4439.233) (-4436.212) (-4444.660) [-4435.860] * (-4440.060) [-4428.627] (-4437.294) (-4438.001) -- 0:12:05 71000 -- (-4444.006) (-4438.361) (-4447.960) [-4439.575] * (-4438.689) (-4436.601) (-4444.582) [-4438.245] -- 0:11:59 71500 -- (-4444.094) (-4442.559) [-4445.993] (-4439.814) * (-4434.980) (-4432.249) (-4439.258) [-4435.384] -- 0:11:54 72000 -- (-4434.162) (-4442.895) [-4433.518] (-4440.296) * (-4440.616) [-4433.732] (-4444.833) (-4431.111) -- 0:12:01 72500 -- (-4440.968) (-4441.029) (-4434.740) [-4446.398] * (-4444.517) (-4441.462) (-4439.495) [-4441.984] -- 0:11:56 73000 -- (-4438.528) [-4427.942] (-4426.792) (-4433.257) * (-4449.253) [-4429.459] (-4434.150) (-4434.303) -- 0:12:03 73500 -- (-4443.027) (-4433.637) [-4442.029] (-4433.365) * (-4433.513) (-4438.058) [-4438.473] (-4439.630) -- 0:11:58 74000 -- (-4443.460) [-4429.507] (-4446.989) (-4439.079) * (-4448.856) (-4431.303) (-4431.210) [-4443.614] -- 0:11:53 74500 -- (-4438.377) (-4436.644) [-4437.489] (-4437.717) * (-4434.500) [-4438.322] (-4430.610) (-4443.128) -- 0:12:00 75000 -- (-4441.721) (-4441.759) [-4436.849] (-4441.925) * (-4441.381) (-4443.167) [-4432.051] (-4445.404) -- 0:11:55 Average standard deviation of split frequencies: 0.024811 75500 -- (-4435.462) (-4440.042) [-4426.267] (-4432.598) * (-4435.219) (-4443.258) [-4430.977] (-4440.267) -- 0:12:02 76000 -- (-4439.066) (-4453.370) (-4430.905) [-4435.206] * [-4437.808] (-4438.124) (-4445.326) (-4442.730) -- 0:11:57 76500 -- (-4442.567) (-4438.601) [-4436.692] (-4434.572) * (-4442.314) (-4437.177) (-4452.165) [-4429.462] -- 0:11:52 77000 -- (-4446.482) [-4434.588] (-4435.372) (-4438.283) * (-4438.976) [-4432.583] (-4435.862) (-4437.553) -- 0:11:59 77500 -- (-4442.582) (-4443.032) (-4442.338) [-4438.182] * (-4438.539) (-4434.694) [-4434.547] (-4450.091) -- 0:11:54 78000 -- (-4440.486) (-4446.619) (-4439.406) [-4439.742] * [-4436.349] (-4436.261) (-4434.048) (-4448.867) -- 0:12:01 78500 -- (-4436.293) [-4437.455] (-4434.861) (-4435.429) * (-4442.276) [-4441.112] (-4435.878) (-4439.525) -- 0:11:56 79000 -- (-4438.866) (-4443.883) (-4444.769) [-4443.975] * [-4437.083] (-4439.117) (-4434.872) (-4434.607) -- 0:11:51 79500 -- [-4442.469] (-4441.952) (-4437.520) (-4436.891) * (-4430.281) (-4451.827) [-4432.817] (-4428.554) -- 0:11:57 80000 -- [-4433.144] (-4450.197) (-4437.321) (-4439.794) * (-4447.918) [-4437.649] (-4428.616) (-4436.993) -- 0:11:53 Average standard deviation of split frequencies: 0.024210 80500 -- [-4436.006] (-4452.352) (-4442.828) (-4435.602) * (-4438.595) (-4439.811) [-4438.703] (-4431.608) -- 0:11:48 81000 -- (-4453.561) (-4429.128) (-4438.865) [-4440.183] * (-4440.095) [-4441.906] (-4432.929) (-4434.957) -- 0:11:54 81500 -- (-4445.408) (-4450.250) (-4435.132) [-4428.669] * [-4437.844] (-4443.212) (-4436.701) (-4440.715) -- 0:11:50 82000 -- [-4440.273] (-4444.875) (-4440.649) (-4434.281) * (-4436.820) (-4446.523) [-4432.877] (-4437.403) -- 0:11:56 82500 -- (-4430.980) (-4438.958) (-4439.493) [-4431.252] * (-4440.581) (-4442.650) (-4450.881) [-4438.996] -- 0:11:51 83000 -- (-4431.799) [-4436.926] (-4450.618) (-4443.724) * (-4438.764) (-4442.453) (-4447.218) [-4433.787] -- 0:11:47 83500 -- [-4443.133] (-4439.228) (-4449.519) (-4443.550) * (-4437.630) (-4436.246) (-4437.075) [-4434.392] -- 0:11:53 84000 -- (-4431.993) [-4433.142] (-4436.432) (-4441.527) * (-4444.353) [-4429.335] (-4435.409) (-4438.678) -- 0:11:48 84500 -- (-4444.140) [-4434.099] (-4444.246) (-4445.871) * (-4450.839) (-4440.349) (-4431.741) [-4431.325] -- 0:11:55 85000 -- [-4432.545] (-4437.771) (-4442.132) (-4434.016) * (-4440.235) (-4435.762) [-4445.091] (-4435.746) -- 0:11:50 Average standard deviation of split frequencies: 0.025580 85500 -- (-4441.313) [-4432.202] (-4438.347) (-4434.169) * (-4435.349) (-4439.754) (-4438.201) [-4436.536] -- 0:11:45 86000 -- [-4437.709] (-4435.497) (-4444.703) (-4433.318) * (-4437.821) (-4446.518) (-4434.201) [-4435.512] -- 0:11:52 86500 -- (-4446.706) (-4441.143) [-4444.218] (-4433.961) * (-4444.888) [-4439.195] (-4443.404) (-4428.977) -- 0:11:47 87000 -- [-4435.398] (-4440.556) (-4449.476) (-4435.068) * (-4450.286) (-4430.593) [-4430.721] (-4428.046) -- 0:11:53 87500 -- (-4440.385) (-4439.258) [-4434.990] (-4436.983) * (-4440.068) [-4433.109] (-4441.546) (-4436.176) -- 0:11:49 88000 -- (-4431.731) (-4446.261) (-4437.732) [-4439.545] * (-4436.739) (-4430.888) (-4438.868) [-4435.988] -- 0:11:44 88500 -- (-4432.652) [-4437.005] (-4438.867) (-4436.568) * (-4438.721) [-4436.507] (-4436.766) (-4440.959) -- 0:11:50 89000 -- [-4442.083] (-4440.947) (-4433.589) (-4440.255) * [-4436.989] (-4431.041) (-4435.870) (-4440.015) -- 0:11:46 89500 -- (-4442.510) [-4430.470] (-4447.366) (-4433.740) * [-4438.694] (-4441.009) (-4442.687) (-4445.102) -- 0:11:41 90000 -- [-4429.556] (-4441.746) (-4444.109) (-4438.144) * (-4442.865) (-4433.599) [-4433.151] (-4441.651) -- 0:11:47 Average standard deviation of split frequencies: 0.020104 90500 -- [-4429.526] (-4438.697) (-4433.210) (-4434.922) * (-4442.636) (-4444.760) [-4433.275] (-4445.485) -- 0:11:43 91000 -- (-4436.957) (-4439.615) (-4437.838) [-4430.700] * (-4427.708) (-4449.622) [-4431.999] (-4452.228) -- 0:11:49 91500 -- (-4438.404) (-4441.578) [-4434.877] (-4441.571) * [-4431.984] (-4429.796) (-4433.340) (-4447.708) -- 0:11:44 92000 -- [-4440.409] (-4439.155) (-4436.088) (-4451.382) * [-4434.511] (-4443.144) (-4441.737) (-4446.705) -- 0:11:40 92500 -- (-4436.346) [-4435.804] (-4437.295) (-4439.837) * [-4440.863] (-4441.724) (-4432.605) (-4441.959) -- 0:11:46 93000 -- (-4451.786) [-4433.670] (-4442.642) (-4436.037) * [-4439.318] (-4428.640) (-4446.910) (-4447.317) -- 0:11:42 93500 -- (-4430.100) (-4439.980) (-4444.831) [-4426.267] * (-4438.670) [-4436.156] (-4434.887) (-4454.233) -- 0:11:47 94000 -- (-4437.509) (-4430.725) (-4440.736) [-4437.610] * (-4440.644) [-4427.677] (-4435.370) (-4442.549) -- 0:11:43 94500 -- (-4446.521) (-4441.750) (-4434.113) [-4447.078] * (-4435.946) (-4435.465) (-4438.741) [-4434.582] -- 0:11:39 95000 -- (-4443.574) (-4434.046) [-4437.031] (-4439.076) * [-4441.588] (-4437.897) (-4432.754) (-4438.175) -- 0:11:44 Average standard deviation of split frequencies: 0.015784 95500 -- (-4442.293) (-4430.039) (-4439.153) [-4439.047] * (-4434.948) (-4436.271) (-4442.359) [-4435.022] -- 0:11:40 96000 -- (-4436.030) [-4430.663] (-4438.787) (-4435.271) * [-4434.935] (-4432.371) (-4443.165) (-4438.004) -- 0:11:36 96500 -- (-4436.417) (-4449.759) (-4433.992) [-4426.860] * (-4433.341) (-4444.130) [-4437.069] (-4436.840) -- 0:11:42 97000 -- (-4438.560) (-4434.711) [-4440.767] (-4433.696) * [-4429.334] (-4439.864) (-4441.661) (-4439.465) -- 0:11:38 97500 -- [-4437.708] (-4450.642) (-4435.495) (-4437.275) * (-4438.245) (-4441.258) [-4436.879] (-4435.490) -- 0:11:43 98000 -- [-4429.281] (-4454.626) (-4440.010) (-4440.648) * [-4437.243] (-4435.288) (-4439.204) (-4429.208) -- 0:11:39 98500 -- [-4434.399] (-4447.870) (-4431.474) (-4440.120) * (-4446.694) [-4445.541] (-4463.869) (-4438.875) -- 0:11:35 99000 -- (-4433.161) (-4445.678) [-4440.636] (-4434.296) * (-4438.811) (-4450.479) [-4444.288] (-4439.861) -- 0:11:40 99500 -- [-4430.904] (-4437.545) (-4443.700) (-4440.082) * [-4439.984] (-4437.503) (-4447.660) (-4443.027) -- 0:11:36 100000 -- (-4456.356) (-4434.095) [-4437.803] (-4444.813) * (-4435.940) [-4432.243] (-4441.028) (-4430.573) -- 0:11:42 Average standard deviation of split frequencies: 0.016390 100500 -- (-4437.573) [-4432.166] (-4433.293) (-4435.746) * [-4430.664] (-4447.278) (-4439.966) (-4442.593) -- 0:11:38 101000 -- (-4441.165) (-4430.722) (-4432.586) [-4430.653] * [-4434.013] (-4442.848) (-4448.214) (-4453.611) -- 0:11:34 101500 -- (-4432.038) (-4441.237) (-4439.901) [-4431.537] * [-4430.937] (-4432.497) (-4430.275) (-4435.943) -- 0:11:39 102000 -- (-4438.268) (-4439.792) [-4435.270] (-4436.384) * (-4441.851) (-4444.640) [-4429.783] (-4439.446) -- 0:11:35 102500 -- (-4440.264) [-4437.030] (-4446.062) (-4436.539) * [-4442.233] (-4443.622) (-4446.912) (-4437.807) -- 0:11:40 103000 -- (-4439.264) (-4446.892) (-4440.861) [-4435.890] * (-4444.374) (-4443.708) [-4433.644] (-4442.631) -- 0:11:36 103500 -- (-4440.119) (-4441.690) [-4444.326] (-4436.011) * (-4439.843) [-4428.903] (-4434.882) (-4433.661) -- 0:11:32 104000 -- (-4431.548) (-4432.784) (-4441.166) [-4434.058] * (-4441.355) [-4426.940] (-4436.939) (-4433.068) -- 0:11:37 104500 -- [-4437.242] (-4429.422) (-4438.150) (-4438.962) * (-4440.301) (-4432.337) [-4442.418] (-4436.684) -- 0:11:34 105000 -- (-4442.095) (-4454.550) [-4435.299] (-4434.657) * [-4433.812] (-4447.968) (-4441.103) (-4434.210) -- 0:11:30 Average standard deviation of split frequencies: 0.014528 105500 -- [-4436.546] (-4442.649) (-4435.464) (-4441.381) * [-4438.873] (-4435.637) (-4440.247) (-4440.299) -- 0:11:35 106000 -- [-4433.706] (-4444.127) (-4428.782) (-4442.965) * (-4447.385) (-4439.398) (-4451.594) [-4436.310] -- 0:11:31 106500 -- (-4441.388) [-4438.661] (-4437.248) (-4440.268) * (-4437.978) [-4439.949] (-4442.988) (-4442.806) -- 0:11:36 107000 -- (-4442.190) (-4448.130) [-4436.648] (-4445.387) * [-4432.826] (-4445.931) (-4443.746) (-4441.448) -- 0:11:32 107500 -- (-4443.623) (-4441.673) [-4434.752] (-4441.471) * (-4440.746) (-4439.018) [-4437.079] (-4437.188) -- 0:11:29 108000 -- (-4436.488) (-4439.047) [-4432.020] (-4438.809) * (-4435.133) (-4429.467) (-4457.733) [-4429.950] -- 0:11:33 108500 -- [-4437.672] (-4435.567) (-4450.716) (-4432.310) * (-4434.964) (-4440.217) [-4437.205] (-4437.276) -- 0:11:30 109000 -- (-4440.415) (-4436.737) (-4440.818) [-4448.905] * (-4436.729) [-4442.789] (-4435.903) (-4446.721) -- 0:11:34 109500 -- (-4437.126) (-4440.240) (-4438.988) [-4442.104] * (-4435.936) (-4447.684) [-4436.420] (-4441.249) -- 0:11:31 110000 -- [-4427.049] (-4438.306) (-4447.985) (-4440.932) * (-4440.620) (-4435.932) (-4437.546) [-4437.991] -- 0:11:27 Average standard deviation of split frequencies: 0.012495 110500 -- [-4434.018] (-4448.633) (-4445.024) (-4443.263) * (-4442.209) (-4440.493) (-4448.517) [-4438.616] -- 0:11:32 111000 -- (-4442.971) (-4447.589) [-4436.818] (-4463.282) * [-4434.832] (-4438.176) (-4439.876) (-4440.783) -- 0:11:28 111500 -- [-4435.994] (-4444.787) (-4432.897) (-4438.793) * [-4434.132] (-4457.982) (-4442.992) (-4438.566) -- 0:11:25 112000 -- [-4441.686] (-4445.288) (-4449.927) (-4437.415) * [-4431.775] (-4451.312) (-4451.466) (-4431.567) -- 0:11:29 112500 -- (-4459.354) (-4433.991) [-4433.464] (-4443.253) * [-4442.099] (-4448.348) (-4437.464) (-4435.889) -- 0:11:26 113000 -- (-4446.482) [-4432.202] (-4437.086) (-4435.687) * (-4437.987) [-4439.651] (-4439.566) (-4444.014) -- 0:11:30 113500 -- (-4438.823) [-4441.797] (-4436.953) (-4451.411) * (-4433.078) (-4438.102) [-4432.772] (-4432.674) -- 0:11:27 114000 -- (-4437.749) (-4432.834) [-4433.784] (-4430.412) * (-4438.821) (-4450.289) (-4439.860) [-4431.313] -- 0:11:23 114500 -- [-4433.118] (-4432.630) (-4443.287) (-4430.955) * [-4439.559] (-4448.706) (-4442.276) (-4439.330) -- 0:11:28 115000 -- (-4443.296) (-4437.445) [-4433.787] (-4438.281) * (-4442.223) (-4434.504) (-4442.524) [-4437.498] -- 0:11:24 Average standard deviation of split frequencies: 0.011108 115500 -- [-4442.446] (-4430.802) (-4445.976) (-4439.864) * [-4442.682] (-4446.024) (-4439.352) (-4444.236) -- 0:11:29 116000 -- (-4450.944) (-4439.277) (-4444.088) [-4433.728] * (-4452.788) [-4439.662] (-4433.903) (-4438.072) -- 0:11:25 116500 -- [-4432.877] (-4438.818) (-4430.652) (-4438.625) * (-4449.199) (-4429.569) [-4445.299] (-4437.807) -- 0:11:22 117000 -- (-4439.601) (-4436.422) [-4431.571] (-4434.361) * (-4454.174) [-4436.629] (-4434.734) (-4442.622) -- 0:11:26 117500 -- (-4445.174) [-4432.182] (-4434.694) (-4442.363) * (-4440.230) [-4437.537] (-4434.247) (-4451.782) -- 0:11:23 118000 -- (-4440.790) [-4438.230] (-4440.578) (-4435.777) * (-4437.314) [-4434.234] (-4445.518) (-4446.519) -- 0:11:20 118500 -- (-4435.685) (-4435.009) (-4434.356) [-4438.605] * (-4436.260) [-4430.185] (-4439.209) (-4442.171) -- 0:11:24 119000 -- [-4431.215] (-4447.559) (-4430.756) (-4431.873) * [-4438.304] (-4436.522) (-4441.072) (-4436.237) -- 0:11:21 119500 -- (-4431.455) (-4435.074) [-4436.551] (-4443.594) * (-4448.198) [-4435.694] (-4445.776) (-4435.906) -- 0:11:25 120000 -- (-4428.401) (-4439.232) (-4439.535) [-4435.595] * (-4449.209) (-4439.157) (-4438.086) [-4437.135] -- 0:11:22 Average standard deviation of split frequencies: 0.012278 120500 -- (-4437.935) [-4440.247] (-4434.282) (-4440.470) * [-4440.635] (-4447.081) (-4443.874) (-4439.210) -- 0:11:18 121000 -- [-4438.602] (-4434.785) (-4447.515) (-4446.050) * [-4433.255] (-4446.048) (-4443.599) (-4446.801) -- 0:11:22 121500 -- (-4443.658) [-4435.624] (-4442.851) (-4442.127) * (-4433.034) (-4438.285) (-4441.389) [-4437.296] -- 0:11:19 122000 -- [-4435.766] (-4441.334) (-4446.854) (-4437.355) * (-4439.579) (-4436.241) (-4438.502) [-4435.886] -- 0:11:23 122500 -- [-4432.586] (-4433.291) (-4447.427) (-4439.644) * (-4446.570) [-4427.824] (-4441.395) (-4442.357) -- 0:11:20 123000 -- (-4439.283) [-4435.276] (-4434.804) (-4436.914) * [-4440.836] (-4439.087) (-4446.341) (-4442.392) -- 0:11:17 123500 -- [-4435.807] (-4441.063) (-4438.701) (-4445.400) * (-4429.831) (-4436.357) (-4442.020) [-4443.341] -- 0:11:21 124000 -- (-4438.197) [-4436.717] (-4427.279) (-4433.366) * [-4433.786] (-4436.731) (-4436.798) (-4445.042) -- 0:11:18 124500 -- (-4441.461) (-4439.804) (-4434.872) [-4433.099] * (-4429.665) (-4431.964) [-4433.390] (-4447.890) -- 0:11:15 125000 -- (-4440.206) (-4430.713) (-4440.632) [-4438.022] * (-4438.735) (-4435.193) [-4436.707] (-4439.730) -- 0:11:19 Average standard deviation of split frequencies: 0.013362 125500 -- (-4443.198) (-4442.678) (-4435.440) [-4436.037] * [-4432.636] (-4444.415) (-4440.355) (-4438.028) -- 0:11:15 126000 -- (-4442.561) (-4457.482) (-4441.147) [-4442.955] * (-4441.669) (-4438.758) (-4433.734) [-4432.831] -- 0:11:19 126500 -- (-4436.037) [-4439.192] (-4436.448) (-4433.346) * (-4438.226) (-4447.877) (-4441.115) [-4433.501] -- 0:11:16 127000 -- (-4437.495) (-4446.399) (-4442.947) [-4437.114] * (-4445.639) [-4447.240] (-4441.602) (-4442.961) -- 0:11:13 127500 -- (-4434.481) [-4434.444] (-4438.650) (-4445.053) * (-4442.627) (-4440.264) [-4436.780] (-4445.245) -- 0:11:17 128000 -- (-4434.552) [-4429.185] (-4443.345) (-4446.681) * (-4441.516) (-4439.080) (-4437.531) [-4437.757] -- 0:11:14 128500 -- (-4447.358) [-4435.095] (-4434.232) (-4436.276) * (-4437.736) [-4449.537] (-4437.107) (-4441.222) -- 0:11:18 129000 -- (-4448.333) (-4434.255) (-4442.934) [-4438.891] * (-4436.116) (-4451.215) (-4445.647) [-4436.499] -- 0:11:15 129500 -- [-4450.264] (-4449.033) (-4449.868) (-4439.098) * (-4447.009) (-4435.572) (-4436.175) [-4426.155] -- 0:11:12 130000 -- [-4427.682] (-4443.007) (-4444.743) (-4444.641) * (-4436.972) (-4440.003) (-4435.811) [-4433.519] -- 0:11:15 Average standard deviation of split frequencies: 0.012885 130500 -- [-4437.224] (-4442.086) (-4445.905) (-4435.352) * [-4437.023] (-4436.906) (-4446.582) (-4447.710) -- 0:11:12 131000 -- (-4444.941) [-4433.377] (-4436.316) (-4449.002) * (-4439.452) (-4435.187) [-4445.674] (-4437.081) -- 0:11:09 131500 -- (-4434.226) (-4442.082) [-4436.217] (-4442.159) * (-4434.916) (-4445.151) [-4450.107] (-4433.353) -- 0:11:13 132000 -- (-4443.328) (-4445.569) (-4434.993) [-4432.021] * (-4435.726) (-4453.072) (-4441.182) [-4434.606] -- 0:11:10 132500 -- (-4436.884) (-4433.258) [-4445.250] (-4443.170) * (-4433.021) (-4442.171) [-4439.352] (-4439.573) -- 0:11:14 133000 -- (-4450.424) (-4438.837) [-4437.923] (-4437.301) * (-4437.510) [-4441.197] (-4443.525) (-4443.190) -- 0:11:11 133500 -- [-4441.311] (-4436.149) (-4443.951) (-4441.260) * (-4437.020) (-4441.251) (-4437.563) [-4443.801] -- 0:11:08 134000 -- (-4448.053) (-4433.907) [-4441.612] (-4439.394) * [-4433.441] (-4447.398) (-4438.740) (-4438.758) -- 0:11:12 134500 -- (-4432.333) (-4445.791) [-4435.212] (-4439.145) * (-4437.889) [-4434.372] (-4446.196) (-4445.994) -- 0:11:09 135000 -- [-4434.993] (-4446.560) (-4441.169) (-4436.333) * (-4444.250) [-4431.363] (-4432.456) (-4442.165) -- 0:11:12 Average standard deviation of split frequencies: 0.012874 135500 -- (-4441.344) [-4439.159] (-4431.750) (-4446.461) * [-4436.089] (-4440.046) (-4442.106) (-4441.666) -- 0:11:09 136000 -- (-4441.309) [-4447.627] (-4431.729) (-4439.295) * (-4435.932) (-4440.802) (-4440.517) [-4439.629] -- 0:11:07 136500 -- (-4446.781) (-4444.492) (-4436.933) [-4431.613] * (-4438.992) [-4438.577] (-4443.724) (-4438.015) -- 0:11:10 137000 -- (-4437.792) [-4440.538] (-4431.697) (-4443.974) * (-4434.391) [-4432.767] (-4440.173) (-4437.603) -- 0:11:07 137500 -- (-4444.809) (-4435.371) (-4436.277) [-4435.228] * (-4438.382) (-4450.772) [-4442.575] (-4438.399) -- 0:11:04 138000 -- (-4436.573) (-4434.786) (-4450.931) [-4432.773] * [-4434.422] (-4435.762) (-4441.563) (-4442.242) -- 0:11:08 138500 -- (-4435.227) (-4449.530) (-4437.821) [-4436.853] * (-4436.293) [-4439.389] (-4442.761) (-4438.079) -- 0:11:05 139000 -- (-4440.673) [-4442.940] (-4438.430) (-4438.616) * (-4444.078) [-4441.907] (-4447.196) (-4436.984) -- 0:11:08 139500 -- [-4434.332] (-4439.050) (-4446.495) (-4436.007) * (-4455.656) [-4436.780] (-4438.650) (-4429.509) -- 0:11:06 140000 -- (-4442.642) (-4449.092) (-4436.598) [-4435.398] * (-4445.678) (-4439.595) (-4442.892) [-4437.234] -- 0:11:03 Average standard deviation of split frequencies: 0.012447 140500 -- [-4430.087] (-4438.225) (-4442.557) (-4444.046) * (-4439.464) (-4441.727) (-4436.863) [-4430.076] -- 0:11:06 141000 -- (-4437.831) [-4426.945] (-4449.561) (-4451.979) * [-4441.791] (-4440.427) (-4448.654) (-4441.145) -- 0:11:04 141500 -- [-4435.290] (-4432.599) (-4452.530) (-4441.178) * (-4440.814) [-4430.461] (-4431.605) (-4432.957) -- 0:11:07 142000 -- (-4437.026) [-4435.405] (-4441.742) (-4451.793) * (-4444.801) [-4435.033] (-4438.135) (-4445.490) -- 0:11:04 142500 -- [-4432.124] (-4431.941) (-4435.511) (-4436.402) * (-4447.911) (-4441.150) (-4437.628) [-4445.500] -- 0:11:01 143000 -- (-4438.052) (-4445.071) [-4430.862] (-4442.767) * [-4440.191] (-4441.445) (-4443.252) (-4441.503) -- 0:11:05 143500 -- (-4429.172) [-4436.884] (-4434.420) (-4441.772) * (-4444.563) (-4432.249) (-4446.445) [-4432.980] -- 0:11:02 144000 -- (-4441.259) (-4440.065) (-4433.879) [-4433.669] * [-4440.827] (-4440.658) (-4437.742) (-4431.928) -- 0:10:59 144500 -- (-4448.625) (-4438.311) (-4436.283) [-4434.233] * (-4430.468) (-4436.595) [-4433.783] (-4438.115) -- 0:11:03 145000 -- (-4451.537) (-4434.650) (-4436.664) [-4433.808] * [-4430.244] (-4445.218) (-4448.570) (-4443.528) -- 0:11:00 Average standard deviation of split frequencies: 0.012054 145500 -- [-4435.034] (-4438.981) (-4441.294) (-4439.366) * (-4440.326) [-4439.743] (-4438.557) (-4442.761) -- 0:11:03 146000 -- (-4441.574) [-4436.270] (-4435.547) (-4431.999) * (-4438.585) [-4433.655] (-4435.030) (-4432.161) -- 0:11:00 146500 -- [-4433.770] (-4441.072) (-4447.036) (-4437.634) * [-4439.605] (-4438.516) (-4440.315) (-4441.202) -- 0:10:58 147000 -- [-4438.734] (-4437.485) (-4434.667) (-4437.727) * (-4445.201) (-4433.615) [-4434.401] (-4441.060) -- 0:11:01 147500 -- (-4442.744) (-4435.466) [-4437.440] (-4442.185) * (-4448.186) (-4432.639) [-4433.091] (-4431.677) -- 0:10:58 148000 -- (-4458.213) [-4437.410] (-4432.010) (-4448.467) * [-4439.738] (-4455.907) (-4438.851) (-4432.773) -- 0:11:02 148500 -- (-4440.139) [-4431.813] (-4437.883) (-4461.162) * [-4435.419] (-4444.819) (-4429.582) (-4440.624) -- 0:10:59 149000 -- (-4438.397) (-4438.607) [-4436.483] (-4444.207) * (-4437.114) (-4439.005) (-4430.272) [-4432.798] -- 0:10:56 149500 -- [-4432.806] (-4437.897) (-4440.133) (-4447.779) * [-4436.610] (-4439.643) (-4447.581) (-4437.332) -- 0:10:59 150000 -- (-4436.711) (-4437.566) (-4439.427) [-4433.396] * (-4436.528) (-4438.637) (-4443.191) [-4441.748] -- 0:10:57 Average standard deviation of split frequencies: 0.013633 150500 -- (-4429.266) (-4439.829) [-4433.045] (-4441.705) * (-4438.937) (-4441.168) [-4434.922] (-4443.033) -- 0:10:54 151000 -- [-4453.475] (-4439.500) (-4441.700) (-4442.031) * (-4449.371) (-4439.768) (-4435.682) [-4434.402] -- 0:10:57 151500 -- (-4445.775) (-4428.445) [-4437.488] (-4435.309) * (-4449.836) (-4443.118) (-4440.865) [-4429.217] -- 0:10:55 152000 -- (-4442.668) (-4436.508) (-4441.218) [-4431.244] * (-4442.674) (-4438.136) (-4446.137) [-4428.539] -- 0:10:58 152500 -- (-4437.518) (-4433.199) (-4445.622) [-4434.377] * (-4460.290) (-4441.875) [-4437.175] (-4435.052) -- 0:10:55 153000 -- (-4439.217) (-4442.820) (-4431.378) [-4436.354] * (-4442.059) (-4442.365) [-4444.190] (-4442.443) -- 0:10:53 153500 -- (-4435.734) (-4440.077) (-4437.671) [-4435.712] * [-4441.492] (-4444.833) (-4450.615) (-4443.506) -- 0:10:56 154000 -- (-4427.682) (-4440.478) [-4439.131] (-4448.888) * (-4446.392) (-4434.357) (-4435.058) [-4442.338] -- 0:10:53 154500 -- (-4431.852) (-4432.674) (-4433.922) [-4446.108] * (-4442.866) [-4441.037] (-4433.916) (-4445.967) -- 0:10:56 155000 -- (-4433.865) [-4443.334] (-4447.615) (-4436.559) * (-4439.486) [-4429.746] (-4442.576) (-4441.883) -- 0:10:54 Average standard deviation of split frequencies: 0.013598 155500 -- (-4437.701) [-4434.839] (-4445.792) (-4432.566) * (-4430.302) (-4431.900) [-4436.089] (-4453.838) -- 0:10:51 156000 -- (-4445.531) [-4436.432] (-4437.268) (-4433.624) * [-4439.301] (-4435.574) (-4439.525) (-4438.992) -- 0:10:54 156500 -- (-4445.850) [-4435.876] (-4441.092) (-4434.056) * [-4430.972] (-4434.404) (-4440.914) (-4457.437) -- 0:10:52 157000 -- (-4447.899) (-4444.773) (-4444.491) [-4436.416] * (-4433.950) (-4438.771) (-4433.443) [-4433.851] -- 0:10:55 157500 -- [-4434.552] (-4434.092) (-4438.837) (-4439.884) * (-4438.868) [-4438.713] (-4437.523) (-4429.071) -- 0:10:52 158000 -- (-4431.339) (-4439.306) [-4445.743] (-4440.347) * (-4429.012) (-4430.717) (-4437.551) [-4443.203] -- 0:10:50 158500 -- (-4444.071) (-4440.230) (-4444.773) [-4430.866] * (-4443.486) [-4431.700] (-4436.097) (-4443.851) -- 0:10:53 159000 -- (-4444.699) (-4445.587) [-4432.926] (-4433.593) * (-4448.537) (-4438.602) [-4430.385] (-4432.989) -- 0:10:50 159500 -- (-4442.062) (-4434.612) (-4442.039) [-4433.107] * (-4439.453) (-4444.498) [-4437.538] (-4437.994) -- 0:10:48 160000 -- (-4440.023) [-4432.375] (-4442.728) (-4440.798) * (-4450.835) (-4435.093) (-4446.135) [-4446.254] -- 0:10:51 Average standard deviation of split frequencies: 0.011946 160500 -- [-4436.217] (-4434.459) (-4440.531) (-4433.246) * (-4437.875) [-4430.183] (-4446.067) (-4438.914) -- 0:10:48 161000 -- (-4439.928) (-4438.327) (-4435.097) [-4430.719] * (-4436.618) [-4429.746] (-4434.366) (-4446.151) -- 0:10:51 161500 -- (-4440.534) (-4434.857) (-4432.710) [-4431.950] * (-4437.376) (-4439.581) [-4434.467] (-4449.628) -- 0:10:48 162000 -- (-4444.862) (-4433.042) (-4444.213) [-4437.061] * (-4441.895) (-4437.679) [-4435.656] (-4438.611) -- 0:10:46 162500 -- (-4457.453) [-4429.344] (-4438.644) (-4434.092) * (-4455.617) (-4435.598) (-4432.222) [-4434.433] -- 0:10:49 163000 -- (-4452.600) (-4455.436) [-4435.099] (-4441.724) * (-4442.266) (-4436.012) [-4434.416] (-4444.070) -- 0:10:47 163500 -- (-4449.357) (-4438.987) [-4432.918] (-4440.315) * (-4438.029) [-4435.073] (-4439.698) (-4437.721) -- 0:10:49 164000 -- (-4438.446) (-4445.403) (-4435.034) [-4433.961] * (-4441.565) [-4437.346] (-4444.254) (-4447.320) -- 0:10:47 164500 -- (-4445.683) (-4438.968) [-4436.089] (-4434.534) * (-4430.325) (-4440.379) (-4445.582) [-4441.186] -- 0:10:45 165000 -- (-4438.055) (-4436.994) (-4436.610) [-4440.550] * [-4435.540] (-4438.873) (-4448.278) (-4438.902) -- 0:10:47 Average standard deviation of split frequencies: 0.010345 165500 -- (-4450.836) (-4445.494) [-4432.995] (-4441.816) * [-4430.192] (-4431.280) (-4442.366) (-4435.215) -- 0:10:45 166000 -- (-4433.826) [-4431.175] (-4434.817) (-4440.799) * (-4436.754) (-4436.956) (-4442.228) [-4432.452] -- 0:10:43 166500 -- [-4434.344] (-4440.530) (-4434.549) (-4432.609) * (-4439.169) (-4434.039) [-4436.052] (-4448.431) -- 0:10:45 167000 -- [-4438.407] (-4445.841) (-4442.813) (-4437.465) * [-4431.291] (-4441.083) (-4432.094) (-4447.605) -- 0:10:43 167500 -- (-4444.072) (-4443.064) [-4446.131] (-4436.727) * [-4437.536] (-4433.608) (-4440.504) (-4445.230) -- 0:10:46 168000 -- (-4444.884) (-4435.322) (-4431.259) [-4437.984] * (-4434.604) (-4440.247) (-4435.368) [-4429.962] -- 0:10:43 168500 -- (-4446.716) (-4434.113) (-4446.394) [-4431.449] * (-4441.443) (-4446.272) [-4437.795] (-4444.229) -- 0:10:41 169000 -- (-4434.614) (-4433.601) [-4432.593] (-4443.271) * (-4435.827) (-4433.373) (-4443.658) [-4435.763] -- 0:10:44 169500 -- (-4438.379) (-4433.629) (-4437.588) [-4427.424] * [-4431.679] (-4443.740) (-4440.601) (-4433.360) -- 0:10:41 170000 -- (-4429.974) [-4431.826] (-4429.357) (-4440.144) * (-4442.841) (-4435.142) [-4437.241] (-4435.856) -- 0:10:44 Average standard deviation of split frequencies: 0.010062 170500 -- (-4441.527) [-4437.945] (-4438.983) (-4441.025) * (-4434.212) (-4440.550) (-4434.144) [-4439.447] -- 0:10:42 171000 -- (-4443.434) (-4440.072) [-4442.316] (-4441.350) * (-4436.787) (-4442.772) [-4435.985] (-4435.525) -- 0:10:39 171500 -- (-4433.601) [-4433.255] (-4437.899) (-4434.650) * (-4447.244) (-4444.133) [-4434.454] (-4441.097) -- 0:10:42 172000 -- (-4439.603) (-4438.411) [-4441.037] (-4434.602) * (-4444.453) [-4434.735] (-4434.789) (-4436.204) -- 0:10:40 172500 -- [-4435.602] (-4431.644) (-4443.517) (-4432.931) * (-4440.420) (-4432.857) [-4430.662] (-4442.594) -- 0:10:38 173000 -- (-4439.074) (-4443.918) (-4434.551) [-4438.640] * (-4438.441) (-4448.968) [-4432.741] (-4439.226) -- 0:10:40 173500 -- (-4439.661) [-4439.791] (-4439.441) (-4438.112) * (-4441.219) (-4433.723) [-4428.746] (-4445.227) -- 0:10:38 174000 -- (-4450.192) (-4444.564) (-4436.730) [-4431.805] * [-4435.067] (-4434.760) (-4435.785) (-4441.619) -- 0:10:40 174500 -- (-4435.538) (-4438.927) (-4443.109) [-4434.028] * (-4441.962) (-4442.224) [-4435.287] (-4441.279) -- 0:10:38 175000 -- (-4441.252) [-4436.335] (-4427.394) (-4440.216) * [-4435.233] (-4433.799) (-4438.577) (-4440.568) -- 0:10:36 Average standard deviation of split frequencies: 0.009566 175500 -- (-4437.312) (-4443.551) [-4428.865] (-4434.594) * (-4440.515) (-4436.867) (-4435.863) [-4439.301] -- 0:10:38 176000 -- (-4438.788) (-4441.271) [-4434.479] (-4439.090) * (-4445.160) (-4447.523) (-4437.645) [-4435.517] -- 0:10:36 176500 -- (-4441.909) (-4440.440) (-4433.238) [-4433.914] * (-4439.947) (-4441.356) [-4432.814] (-4434.184) -- 0:10:39 177000 -- [-4434.828] (-4442.053) (-4441.024) (-4439.566) * (-4439.102) (-4441.636) [-4435.343] (-4437.553) -- 0:10:37 177500 -- (-4432.241) (-4437.867) (-4434.707) [-4434.118] * [-4433.076] (-4444.737) (-4437.408) (-4433.679) -- 0:10:34 178000 -- (-4449.927) (-4436.437) [-4427.186] (-4446.679) * (-4434.599) (-4443.537) (-4431.213) [-4436.201] -- 0:10:37 178500 -- (-4450.381) (-4440.006) [-4439.317] (-4440.067) * (-4442.130) (-4439.225) (-4426.382) [-4436.645] -- 0:10:35 179000 -- (-4446.367) [-4441.290] (-4449.994) (-4430.235) * (-4440.332) (-4438.240) (-4433.961) [-4441.842] -- 0:10:32 179500 -- [-4437.891] (-4440.607) (-4439.010) (-4444.092) * (-4443.696) (-4441.882) [-4433.851] (-4445.260) -- 0:10:35 180000 -- (-4442.815) (-4437.705) (-4435.128) [-4438.218] * [-4436.376] (-4435.635) (-4432.306) (-4443.322) -- 0:10:33 Average standard deviation of split frequencies: 0.009692 180500 -- (-4437.905) (-4444.185) [-4437.272] (-4439.574) * [-4434.628] (-4431.548) (-4434.290) (-4436.073) -- 0:10:35 181000 -- (-4440.457) (-4439.244) [-4436.405] (-4427.197) * (-4435.518) [-4432.585] (-4449.484) (-4439.099) -- 0:10:33 181500 -- (-4434.381) (-4444.792) (-4439.311) [-4431.271] * (-4435.234) (-4450.478) [-4437.461] (-4447.353) -- 0:10:31 182000 -- (-4445.514) (-4437.700) (-4438.222) [-4435.887] * (-4441.021) (-4444.244) (-4441.715) [-4441.656] -- 0:10:33 182500 -- (-4437.694) (-4430.631) [-4444.380] (-4436.175) * (-4442.330) [-4442.893] (-4454.313) (-4437.918) -- 0:10:31 183000 -- (-4432.777) (-4431.728) [-4433.197] (-4435.537) * (-4445.575) (-4440.107) [-4440.384] (-4440.115) -- 0:10:33 183500 -- (-4429.347) (-4435.407) (-4435.754) [-4432.126] * (-4447.392) (-4436.644) [-4436.182] (-4441.720) -- 0:10:31 184000 -- [-4437.983] (-4439.315) (-4434.791) (-4438.393) * (-4438.298) (-4443.959) (-4439.048) [-4435.706] -- 0:10:29 184500 -- (-4440.035) (-4442.181) (-4443.140) [-4434.174] * (-4443.022) (-4447.961) (-4435.900) [-4438.812] -- 0:10:32 185000 -- (-4450.616) [-4439.598] (-4435.904) (-4433.050) * (-4444.514) (-4430.045) [-4436.239] (-4447.027) -- 0:10:29 Average standard deviation of split frequencies: 0.008448 185500 -- (-4449.414) [-4440.566] (-4434.383) (-4436.260) * (-4438.229) (-4433.014) [-4440.801] (-4440.201) -- 0:10:27 186000 -- [-4441.352] (-4438.728) (-4434.178) (-4434.807) * [-4433.339] (-4442.807) (-4447.449) (-4433.010) -- 0:10:30 186500 -- [-4443.043] (-4443.977) (-4443.288) (-4436.824) * (-4437.760) [-4434.809] (-4450.440) (-4437.841) -- 0:10:28 187000 -- [-4433.846] (-4431.533) (-4437.071) (-4442.398) * (-4434.325) (-4432.507) [-4450.767] (-4434.400) -- 0:10:30 187500 -- (-4441.516) (-4451.312) (-4441.164) [-4439.759] * [-4431.260] (-4431.868) (-4441.540) (-4443.259) -- 0:10:28 188000 -- (-4436.458) (-4444.680) (-4454.570) [-4439.145] * (-4441.848) [-4439.475] (-4437.511) (-4446.602) -- 0:10:26 188500 -- [-4432.611] (-4441.343) (-4440.446) (-4447.869) * (-4447.881) (-4435.685) (-4438.022) [-4436.891] -- 0:10:28 189000 -- (-4436.380) (-4437.777) (-4432.938) [-4437.403] * (-4444.264) [-4440.009] (-4441.008) (-4441.907) -- 0:10:26 189500 -- [-4434.394] (-4435.106) (-4432.229) (-4437.378) * (-4444.494) (-4433.567) [-4432.446] (-4446.630) -- 0:10:28 190000 -- (-4430.070) (-4441.157) (-4449.446) [-4436.288] * [-4440.084] (-4440.087) (-4440.606) (-4435.558) -- 0:10:26 Average standard deviation of split frequencies: 0.010596 190500 -- (-4436.778) [-4447.951] (-4441.287) (-4433.583) * (-4447.458) [-4427.645] (-4432.750) (-4442.762) -- 0:10:24 191000 -- [-4431.393] (-4434.172) (-4431.602) (-4436.600) * (-4435.502) [-4433.722] (-4430.941) (-4447.015) -- 0:10:26 191500 -- [-4434.527] (-4437.918) (-4435.284) (-4443.434) * (-4439.304) [-4434.910] (-4444.767) (-4460.108) -- 0:10:24 192000 -- (-4445.905) (-4445.112) [-4434.088] (-4445.682) * [-4434.169] (-4436.317) (-4438.270) (-4449.123) -- 0:10:22 192500 -- (-4441.933) [-4437.850] (-4439.073) (-4446.773) * (-4437.156) (-4440.414) (-4436.966) [-4437.426] -- 0:10:25 193000 -- [-4432.008] (-4434.231) (-4437.442) (-4441.110) * (-4432.545) [-4438.761] (-4435.640) (-4442.813) -- 0:10:23 193500 -- (-4451.780) [-4435.779] (-4437.250) (-4436.077) * (-4450.314) (-4438.491) (-4442.850) [-4433.645] -- 0:10:25 194000 -- (-4439.029) [-4440.507] (-4431.031) (-4435.487) * (-4451.103) (-4434.396) [-4433.414] (-4448.295) -- 0:10:23 194500 -- (-4449.061) (-4433.109) (-4445.348) [-4437.008] * [-4443.741] (-4436.701) (-4438.862) (-4437.723) -- 0:10:21 195000 -- [-4442.054] (-4437.481) (-4457.193) (-4435.045) * (-4436.718) (-4435.820) [-4437.256] (-4451.658) -- 0:10:23 Average standard deviation of split frequencies: 0.010102 195500 -- (-4444.379) (-4434.439) (-4444.277) [-4444.092] * [-4428.040] (-4448.755) (-4438.370) (-4444.309) -- 0:10:21 196000 -- [-4435.031] (-4443.665) (-4443.333) (-4453.039) * (-4439.481) (-4449.851) [-4436.229] (-4439.373) -- 0:10:23 196500 -- [-4435.489] (-4440.277) (-4435.128) (-4445.403) * (-4430.890) (-4448.527) [-4430.908] (-4444.246) -- 0:10:21 197000 -- (-4453.705) (-4440.227) [-4437.531] (-4435.331) * [-4431.029] (-4438.322) (-4443.016) (-4439.526) -- 0:10:19 197500 -- (-4446.093) [-4449.510] (-4437.405) (-4438.567) * [-4435.993] (-4441.672) (-4438.894) (-4437.714) -- 0:10:21 198000 -- (-4434.441) (-4453.069) [-4431.757] (-4439.101) * [-4430.456] (-4440.644) (-4444.636) (-4440.536) -- 0:10:19 198500 -- (-4449.354) (-4438.661) [-4438.041] (-4432.501) * (-4431.297) [-4434.216] (-4452.068) (-4446.073) -- 0:10:17 199000 -- (-4444.992) (-4441.557) (-4450.796) [-4444.460] * [-4441.713] (-4435.336) (-4448.731) (-4445.793) -- 0:10:19 199500 -- (-4458.606) (-4443.186) (-4442.959) [-4443.766] * [-4443.515] (-4438.023) (-4442.870) (-4433.184) -- 0:10:17 200000 -- (-4446.337) (-4442.945) (-4440.000) [-4432.650] * (-4435.963) (-4429.190) [-4430.622] (-4453.003) -- 0:10:20 Average standard deviation of split frequencies: 0.010336 200500 -- (-4454.544) [-4439.523] (-4435.359) (-4443.197) * (-4444.537) [-4441.672] (-4439.366) (-4443.115) -- 0:10:18 201000 -- (-4448.685) (-4447.056) [-4436.415] (-4440.001) * (-4435.861) (-4435.462) (-4444.680) [-4441.871] -- 0:10:16 201500 -- (-4444.488) (-4447.040) [-4441.227] (-4428.585) * (-4439.136) [-4435.460] (-4436.190) (-4437.954) -- 0:10:18 202000 -- [-4439.748] (-4443.565) (-4437.958) (-4443.120) * (-4441.911) [-4443.717] (-4441.669) (-4435.414) -- 0:10:16 202500 -- (-4447.794) (-4444.160) [-4432.316] (-4440.495) * [-4436.090] (-4433.059) (-4433.337) (-4440.550) -- 0:10:18 203000 -- [-4445.213] (-4450.218) (-4438.704) (-4439.601) * (-4437.864) (-4439.150) (-4436.488) [-4432.865] -- 0:10:16 203500 -- (-4436.267) [-4441.879] (-4435.257) (-4453.097) * (-4451.231) [-4440.397] (-4443.253) (-4438.621) -- 0:10:14 204000 -- (-4443.732) (-4434.720) [-4433.454] (-4446.666) * (-4444.644) (-4435.883) [-4441.042] (-4440.594) -- 0:10:16 204500 -- (-4437.473) (-4439.122) [-4433.423] (-4441.358) * (-4432.384) [-4433.842] (-4450.269) (-4434.972) -- 0:10:14 205000 -- [-4430.615] (-4447.651) (-4441.780) (-4435.504) * [-4433.336] (-4434.982) (-4449.914) (-4436.658) -- 0:10:12 Average standard deviation of split frequencies: 0.010984 205500 -- (-4445.586) (-4441.774) (-4442.638) [-4429.685] * [-4437.772] (-4438.234) (-4446.789) (-4445.490) -- 0:10:14 206000 -- [-4437.389] (-4442.254) (-4444.578) (-4440.371) * (-4430.539) [-4434.371] (-4440.687) (-4449.305) -- 0:10:12 206500 -- [-4430.170] (-4447.117) (-4442.078) (-4445.032) * [-4435.969] (-4432.506) (-4436.152) (-4447.105) -- 0:10:14 207000 -- (-4442.069) [-4432.823] (-4439.228) (-4452.074) * (-4440.478) [-4427.304] (-4434.658) (-4441.334) -- 0:10:12 207500 -- (-4443.328) (-4446.622) [-4437.846] (-4446.422) * [-4437.263] (-4429.220) (-4429.444) (-4439.938) -- 0:10:11 208000 -- (-4442.865) (-4437.577) (-4438.241) [-4441.613] * (-4440.220) [-4439.596] (-4435.015) (-4443.900) -- 0:10:13 208500 -- (-4435.496) (-4438.429) (-4447.559) [-4431.894] * (-4439.380) (-4438.418) [-4432.037] (-4440.689) -- 0:10:11 209000 -- [-4432.637] (-4443.892) (-4436.869) (-4435.440) * (-4446.006) (-4430.767) [-4434.134] (-4438.505) -- 0:10:13 209500 -- (-4444.555) (-4429.846) (-4447.749) [-4440.005] * (-4435.756) [-4441.301] (-4438.253) (-4440.688) -- 0:10:11 210000 -- (-4438.956) [-4438.260] (-4436.956) (-4434.696) * [-4433.087] (-4444.569) (-4439.461) (-4446.853) -- 0:10:09 Average standard deviation of split frequencies: 0.008354 210500 -- [-4428.283] (-4438.096) (-4443.618) (-4449.484) * (-4431.634) (-4438.546) [-4429.597] (-4445.123) -- 0:10:11 211000 -- (-4434.704) [-4436.537] (-4434.304) (-4448.519) * (-4432.390) (-4437.331) [-4435.556] (-4440.513) -- 0:10:09 211500 -- (-4432.891) (-4431.110) [-4434.957] (-4440.100) * [-4437.852] (-4440.436) (-4432.271) (-4441.768) -- 0:10:07 212000 -- (-4439.954) [-4437.924] (-4438.321) (-4437.098) * (-4440.403) (-4436.924) (-4439.745) [-4436.080] -- 0:10:09 212500 -- (-4453.320) (-4445.314) (-4438.016) [-4434.732] * (-4441.211) (-4442.958) (-4444.523) [-4438.702] -- 0:10:07 213000 -- [-4439.640] (-4441.104) (-4436.666) (-4440.164) * (-4444.418) (-4444.975) (-4438.634) [-4433.582] -- 0:10:09 213500 -- (-4439.196) (-4446.529) (-4433.442) [-4440.218] * (-4444.923) (-4446.453) (-4437.434) [-4432.661] -- 0:10:07 214000 -- (-4441.289) (-4442.520) [-4432.867] (-4438.422) * (-4461.616) (-4436.914) (-4430.338) [-4430.327] -- 0:10:06 214500 -- [-4435.285] (-4450.155) (-4442.675) (-4436.314) * (-4447.112) (-4444.788) (-4437.952) [-4440.642] -- 0:10:07 215000 -- (-4444.961) (-4436.080) [-4433.767] (-4452.347) * [-4432.848] (-4444.048) (-4446.782) (-4439.546) -- 0:10:06 Average standard deviation of split frequencies: 0.008148 215500 -- (-4445.582) [-4436.933] (-4441.177) (-4439.046) * (-4442.268) (-4437.218) [-4434.066] (-4441.646) -- 0:10:07 216000 -- [-4440.536] (-4431.291) (-4431.524) (-4452.237) * [-4440.925] (-4440.630) (-4442.130) (-4432.534) -- 0:10:06 216500 -- (-4437.825) (-4440.971) (-4443.854) [-4430.873] * (-4437.208) (-4450.673) (-4438.785) [-4431.660] -- 0:10:04 217000 -- (-4436.083) (-4436.386) (-4443.189) [-4432.894] * (-4432.253) (-4432.187) [-4435.381] (-4439.058) -- 0:10:06 217500 -- [-4435.082] (-4441.715) (-4441.381) (-4441.754) * [-4433.139] (-4437.526) (-4436.655) (-4446.349) -- 0:10:04 218000 -- (-4438.189) (-4439.519) (-4432.387) [-4437.160] * (-4448.435) [-4437.005] (-4439.310) (-4440.526) -- 0:10:02 218500 -- (-4435.738) (-4443.040) [-4427.391] (-4437.737) * [-4439.957] (-4443.565) (-4439.256) (-4434.072) -- 0:10:04 219000 -- (-4435.721) (-4441.317) [-4433.349] (-4434.285) * (-4435.550) [-4442.466] (-4436.295) (-4446.149) -- 0:10:02 219500 -- (-4445.970) (-4444.945) (-4441.221) [-4440.708] * [-4432.159] (-4434.617) (-4435.507) (-4435.363) -- 0:10:04 220000 -- (-4437.095) [-4439.679] (-4435.192) (-4447.185) * (-4446.033) [-4429.290] (-4436.500) (-4440.623) -- 0:10:02 Average standard deviation of split frequencies: 0.007548 220500 -- (-4439.052) (-4434.024) [-4438.360] (-4436.616) * (-4432.694) [-4439.086] (-4439.786) (-4438.598) -- 0:10:00 221000 -- [-4437.733] (-4438.771) (-4437.515) (-4439.021) * (-4437.140) (-4439.464) [-4436.976] (-4436.693) -- 0:10:02 221500 -- (-4439.240) (-4444.625) [-4434.329] (-4435.614) * (-4438.916) (-4448.016) [-4427.947] (-4432.339) -- 0:10:01 222000 -- [-4433.564] (-4447.643) (-4449.349) (-4431.689) * [-4438.528] (-4435.752) (-4440.740) (-4442.995) -- 0:10:02 222500 -- (-4438.809) (-4442.318) (-4442.084) [-4429.707] * (-4434.616) [-4433.002] (-4444.710) (-4441.268) -- 0:10:01 223000 -- (-4434.823) (-4437.050) (-4452.425) [-4429.515] * (-4439.159) (-4437.174) (-4450.711) [-4435.791] -- 0:09:59 223500 -- [-4428.979] (-4432.016) (-4438.367) (-4438.577) * (-4439.489) [-4430.730] (-4441.325) (-4433.581) -- 0:10:01 224000 -- (-4436.422) [-4436.016] (-4443.155) (-4439.602) * (-4434.240) (-4447.713) (-4444.544) [-4437.392] -- 0:09:59 224500 -- (-4434.407) [-4431.573] (-4433.695) (-4443.856) * [-4432.267] (-4439.850) (-4439.358) (-4439.444) -- 0:09:57 225000 -- (-4433.160) (-4436.308) [-4435.328] (-4437.311) * (-4441.778) (-4446.019) (-4434.047) [-4440.237] -- 0:09:59 Average standard deviation of split frequencies: 0.006536 225500 -- [-4432.722] (-4435.357) (-4434.654) (-4433.481) * (-4443.616) (-4443.064) (-4437.376) [-4434.805] -- 0:09:57 226000 -- (-4435.500) [-4437.496] (-4443.033) (-4447.216) * (-4436.001) (-4432.133) (-4436.994) [-4435.170] -- 0:09:59 226500 -- [-4430.348] (-4440.352) (-4443.184) (-4436.713) * (-4435.023) [-4435.001] (-4441.343) (-4449.496) -- 0:09:57 227000 -- [-4437.295] (-4441.420) (-4439.314) (-4434.873) * (-4437.202) [-4432.731] (-4434.485) (-4437.359) -- 0:09:55 227500 -- (-4433.549) (-4444.319) [-4437.834] (-4448.599) * (-4446.905) [-4430.375] (-4441.653) (-4435.583) -- 0:09:57 228000 -- (-4446.410) (-4440.395) [-4431.048] (-4437.712) * (-4436.715) [-4437.021] (-4438.433) (-4438.433) -- 0:09:55 228500 -- (-4446.860) (-4438.739) (-4436.617) [-4435.396] * (-4431.791) [-4442.032] (-4433.831) (-4433.436) -- 0:09:57 229000 -- (-4439.109) (-4438.448) (-4450.684) [-4433.233] * (-4437.161) [-4425.988] (-4445.956) (-4443.405) -- 0:09:55 229500 -- (-4445.994) (-4450.043) [-4444.494] (-4432.733) * [-4433.506] (-4443.508) (-4433.344) (-4442.480) -- 0:09:54 230000 -- [-4438.758] (-4443.786) (-4441.442) (-4444.427) * (-4434.719) (-4437.406) [-4436.590] (-4442.861) -- 0:09:55 Average standard deviation of split frequencies: 0.007221 230500 -- (-4437.429) [-4439.424] (-4443.540) (-4442.500) * (-4446.560) (-4447.500) [-4431.897] (-4440.428) -- 0:09:54 231000 -- (-4439.839) (-4435.240) (-4450.021) [-4431.311] * [-4438.891] (-4449.736) (-4440.694) (-4442.757) -- 0:09:52 231500 -- (-4440.583) [-4432.442] (-4443.274) (-4438.702) * [-4434.618] (-4441.111) (-4439.295) (-4439.860) -- 0:09:54 232000 -- [-4435.906] (-4427.083) (-4439.187) (-4443.971) * (-4441.202) [-4441.943] (-4447.542) (-4435.777) -- 0:09:52 232500 -- (-4435.187) [-4436.363] (-4442.055) (-4442.376) * [-4442.509] (-4431.546) (-4436.572) (-4448.115) -- 0:09:54 233000 -- (-4442.801) (-4444.348) (-4432.823) [-4437.090] * (-4442.556) (-4434.531) [-4430.537] (-4440.551) -- 0:09:52 233500 -- [-4440.975] (-4428.349) (-4432.762) (-4439.344) * (-4439.142) (-4440.011) [-4432.231] (-4439.210) -- 0:09:50 234000 -- (-4438.974) (-4442.915) [-4435.991] (-4443.887) * (-4440.561) (-4434.631) (-4435.676) [-4435.190] -- 0:09:52 234500 -- (-4441.291) (-4435.171) (-4443.235) [-4436.190] * (-4433.565) (-4431.228) [-4441.063] (-4446.611) -- 0:09:50 235000 -- [-4436.555] (-4436.419) (-4446.575) (-4443.288) * (-4436.731) (-4434.372) [-4437.016] (-4444.505) -- 0:09:52 Average standard deviation of split frequencies: 0.006706 235500 -- [-4433.396] (-4438.832) (-4442.435) (-4435.660) * (-4430.619) (-4431.399) (-4442.402) [-4434.017] -- 0:09:50 236000 -- [-4444.022] (-4441.488) (-4441.196) (-4431.883) * (-4434.771) [-4437.260] (-4446.992) (-4430.941) -- 0:09:49 236500 -- [-4435.602] (-4443.285) (-4440.997) (-4438.710) * (-4456.637) (-4436.555) (-4448.710) [-4441.246] -- 0:09:50 237000 -- (-4437.529) (-4438.923) [-4438.988] (-4431.603) * (-4447.788) [-4438.365] (-4449.572) (-4446.835) -- 0:09:49 237500 -- (-4433.063) (-4439.064) [-4432.576] (-4437.972) * (-4432.169) (-4451.438) (-4442.617) [-4433.923] -- 0:09:47 238000 -- (-4435.286) [-4436.334] (-4439.479) (-4443.219) * (-4430.838) (-4449.236) [-4429.930] (-4445.285) -- 0:09:49 238500 -- (-4432.474) (-4442.625) (-4432.378) [-4438.064] * (-4427.422) (-4451.818) [-4439.032] (-4438.203) -- 0:09:47 239000 -- [-4434.022] (-4441.267) (-4435.298) (-4447.356) * (-4443.916) (-4436.560) [-4434.846] (-4440.183) -- 0:09:49 239500 -- (-4446.622) (-4440.010) [-4436.885] (-4444.074) * [-4437.694] (-4443.016) (-4436.400) (-4440.766) -- 0:09:47 240000 -- (-4438.487) (-4442.923) (-4436.700) [-4434.067] * [-4438.276] (-4443.185) (-4448.927) (-4437.618) -- 0:09:49 Average standard deviation of split frequencies: 0.006996 240500 -- (-4438.581) (-4456.214) [-4436.524] (-4442.419) * (-4442.891) (-4445.731) [-4436.804] (-4439.256) -- 0:09:47 241000 -- (-4451.310) [-4437.992] (-4432.285) (-4442.485) * [-4435.763] (-4434.108) (-4438.982) (-4434.810) -- 0:09:45 241500 -- (-4452.527) [-4436.117] (-4434.921) (-4443.813) * (-4449.765) (-4444.345) (-4440.521) [-4436.536] -- 0:09:47 242000 -- (-4440.443) [-4432.952] (-4433.417) (-4441.704) * (-4440.529) (-4440.009) (-4438.934) [-4432.327] -- 0:09:45 242500 -- (-4438.466) (-4438.669) [-4434.370] (-4439.468) * (-4433.492) (-4445.547) [-4432.141] (-4433.792) -- 0:09:47 243000 -- (-4441.655) (-4438.059) [-4432.803] (-4434.477) * (-4439.731) (-4445.352) (-4437.923) [-4433.255] -- 0:09:45 243500 -- (-4439.139) [-4442.943] (-4443.458) (-4438.191) * (-4440.568) (-4427.811) [-4432.862] (-4440.535) -- 0:09:44 244000 -- (-4447.530) (-4437.859) (-4453.595) [-4445.277] * [-4437.853] (-4444.833) (-4439.182) (-4443.678) -- 0:09:45 244500 -- (-4442.129) (-4439.191) (-4443.091) [-4441.338] * [-4431.853] (-4440.497) (-4444.317) (-4444.842) -- 0:09:44 245000 -- (-4440.106) (-4447.282) (-4439.429) [-4439.866] * (-4433.674) (-4437.199) [-4435.412] (-4442.566) -- 0:09:45 Average standard deviation of split frequencies: 0.007802 245500 -- [-4431.560] (-4443.703) (-4443.380) (-4440.289) * (-4444.859) (-4439.948) [-4439.055] (-4443.768) -- 0:09:43 246000 -- (-4441.880) [-4436.730] (-4437.169) (-4435.027) * (-4435.220) (-4435.103) [-4438.493] (-4440.461) -- 0:09:42 246500 -- (-4436.697) (-4441.927) (-4435.609) [-4437.165] * (-4434.201) [-4436.198] (-4437.858) (-4439.408) -- 0:09:43 247000 -- (-4444.750) (-4436.965) (-4433.146) [-4440.204] * (-4439.756) [-4432.647] (-4438.653) (-4438.452) -- 0:09:42 247500 -- (-4453.106) (-4438.880) [-4435.690] (-4438.540) * [-4439.901] (-4438.873) (-4438.970) (-4436.268) -- 0:09:40 248000 -- (-4445.134) [-4440.386] (-4438.559) (-4430.723) * (-4442.153) [-4431.188] (-4443.109) (-4433.378) -- 0:09:42 248500 -- (-4433.538) (-4439.883) [-4438.230] (-4443.038) * (-4444.616) (-4430.241) [-4430.327] (-4434.799) -- 0:09:40 249000 -- (-4437.868) (-4434.325) (-4443.890) [-4433.987] * (-4448.496) (-4446.960) (-4435.098) [-4436.673] -- 0:09:42 249500 -- (-4439.862) (-4434.801) [-4436.098] (-4434.766) * [-4444.036] (-4445.039) (-4436.879) (-4434.564) -- 0:09:40 250000 -- (-4440.737) [-4431.724] (-4435.617) (-4438.857) * (-4439.621) (-4449.923) [-4436.870] (-4442.844) -- 0:09:39 Average standard deviation of split frequencies: 0.007088 250500 -- (-4440.289) (-4441.055) (-4434.625) [-4438.014] * (-4436.847) [-4442.896] (-4439.885) (-4454.087) -- 0:09:40 251000 -- (-4445.621) (-4440.876) [-4426.212] (-4433.104) * (-4431.180) (-4434.516) (-4443.031) [-4438.787] -- 0:09:38 251500 -- (-4451.293) [-4434.166] (-4441.392) (-4435.441) * (-4439.050) [-4444.789] (-4453.456) (-4433.468) -- 0:09:40 252000 -- (-4442.932) (-4436.066) (-4434.363) [-4430.612] * (-4439.209) (-4438.182) (-4441.332) [-4436.900] -- 0:09:38 252500 -- (-4440.490) (-4435.125) [-4437.069] (-4434.647) * (-4442.260) (-4437.591) (-4441.577) [-4438.213] -- 0:09:40 253000 -- (-4436.691) (-4443.711) (-4435.032) [-4438.918] * [-4436.539] (-4440.304) (-4440.480) (-4445.748) -- 0:09:38 253500 -- (-4447.310) [-4433.127] (-4438.133) (-4433.860) * [-4434.512] (-4443.061) (-4438.337) (-4441.626) -- 0:09:37 254000 -- (-4450.843) [-4428.649] (-4435.617) (-4446.185) * [-4436.733] (-4437.175) (-4433.191) (-4436.477) -- 0:09:38 254500 -- (-4449.938) (-4443.475) [-4435.147] (-4439.992) * [-4432.037] (-4432.919) (-4437.916) (-4439.542) -- 0:09:37 255000 -- (-4453.385) (-4453.562) (-4432.639) [-4426.725] * (-4432.628) [-4436.105] (-4438.769) (-4449.513) -- 0:09:38 Average standard deviation of split frequencies: 0.008499 255500 -- (-4439.277) (-4432.073) [-4439.401] (-4439.625) * (-4439.270) [-4435.499] (-4436.509) (-4452.685) -- 0:09:36 256000 -- (-4441.551) (-4439.936) [-4433.438] (-4429.944) * (-4444.487) (-4442.769) [-4439.580] (-4434.842) -- 0:09:35 256500 -- (-4449.167) [-4443.687] (-4439.090) (-4443.925) * (-4439.087) (-4436.285) [-4432.975] (-4434.967) -- 0:09:36 257000 -- (-4441.621) (-4437.996) (-4443.525) [-4433.447] * [-4434.378] (-4435.375) (-4438.567) (-4435.861) -- 0:09:35 257500 -- (-4437.466) (-4436.544) (-4436.219) [-4438.611] * [-4430.468] (-4440.830) (-4442.461) (-4435.081) -- 0:09:33 258000 -- [-4436.680] (-4439.506) (-4451.286) (-4435.489) * (-4437.711) [-4431.961] (-4438.963) (-4432.871) -- 0:09:35 258500 -- (-4437.253) [-4438.961] (-4445.657) (-4439.072) * [-4433.848] (-4440.086) (-4451.626) (-4436.085) -- 0:09:33 259000 -- (-4439.918) [-4433.725] (-4444.005) (-4438.889) * (-4436.296) (-4440.166) (-4447.699) [-4433.306] -- 0:09:35 259500 -- (-4436.395) (-4441.000) [-4434.747] (-4440.624) * (-4435.543) [-4432.910] (-4452.061) (-4440.683) -- 0:09:33 260000 -- (-4439.111) (-4444.543) [-4440.033] (-4440.262) * [-4441.549] (-4444.422) (-4441.397) (-4441.789) -- 0:09:32 Average standard deviation of split frequencies: 0.008903 260500 -- (-4438.491) [-4440.250] (-4435.601) (-4439.558) * (-4440.887) (-4432.143) (-4447.321) [-4438.012] -- 0:09:33 261000 -- (-4442.448) (-4437.334) [-4432.569] (-4447.558) * [-4431.843] (-4446.266) (-4449.638) (-4433.022) -- 0:09:31 261500 -- (-4436.894) (-4447.370) (-4431.882) [-4428.168] * [-4430.126] (-4440.681) (-4443.399) (-4435.133) -- 0:09:30 262000 -- (-4439.836) (-4434.231) (-4431.765) [-4441.264] * (-4440.382) (-4431.813) (-4450.846) [-4432.289] -- 0:09:31 262500 -- (-4438.498) (-4445.255) [-4432.762] (-4439.559) * (-4442.952) [-4437.955] (-4447.837) (-4444.489) -- 0:09:30 263000 -- (-4441.636) (-4438.338) (-4441.949) [-4443.675] * (-4453.740) [-4440.733] (-4442.888) (-4449.707) -- 0:09:31 263500 -- (-4435.824) (-4447.611) [-4454.829] (-4449.332) * [-4440.578] (-4446.146) (-4439.324) (-4450.843) -- 0:09:30 264000 -- (-4443.954) (-4450.219) [-4437.574] (-4441.781) * (-4436.634) [-4439.682] (-4441.021) (-4439.134) -- 0:09:28 264500 -- (-4436.222) (-4443.367) (-4445.361) [-4435.304] * (-4436.290) [-4440.464] (-4443.099) (-4446.627) -- 0:09:30 265000 -- [-4433.566] (-4444.271) (-4441.523) (-4438.590) * (-4437.936) [-4437.515] (-4435.512) (-4457.318) -- 0:09:28 Average standard deviation of split frequencies: 0.008861 265500 -- [-4438.071] (-4459.854) (-4442.040) (-4438.024) * (-4441.971) (-4442.805) (-4432.730) [-4433.697] -- 0:09:29 266000 -- [-4441.130] (-4447.805) (-4438.683) (-4434.433) * (-4442.997) (-4446.196) [-4436.805] (-4431.601) -- 0:09:28 266500 -- (-4441.464) [-4437.776] (-4434.839) (-4447.200) * [-4438.685] (-4455.953) (-4433.543) (-4437.502) -- 0:09:26 267000 -- (-4448.318) (-4443.222) (-4440.070) [-4432.839] * [-4435.791] (-4441.260) (-4451.822) (-4436.723) -- 0:09:28 267500 -- (-4445.278) (-4438.522) [-4433.999] (-4433.927) * (-4441.488) (-4434.787) (-4438.260) [-4431.565] -- 0:09:26 268000 -- (-4446.985) (-4433.848) [-4444.936] (-4448.306) * (-4437.818) [-4437.803] (-4444.293) (-4437.403) -- 0:09:25 268500 -- (-4450.761) (-4431.169) [-4433.591] (-4439.629) * [-4436.553] (-4444.761) (-4430.721) (-4437.973) -- 0:09:26 269000 -- [-4445.841] (-4434.990) (-4432.517) (-4435.158) * (-4432.279) (-4442.914) [-4444.770] (-4439.286) -- 0:09:25 269500 -- (-4446.220) (-4429.210) [-4441.124] (-4444.240) * (-4440.852) (-4442.358) [-4436.421] (-4439.982) -- 0:09:26 270000 -- (-4443.592) [-4435.370] (-4441.813) (-4439.263) * (-4442.035) (-4439.128) (-4437.690) [-4438.227] -- 0:09:25 Average standard deviation of split frequencies: 0.009110 270500 -- (-4442.778) (-4434.844) (-4438.325) [-4437.885] * [-4436.450] (-4437.584) (-4447.200) (-4440.071) -- 0:09:23 271000 -- [-4436.772] (-4449.627) (-4434.991) (-4431.722) * (-4443.993) (-4439.894) [-4436.961] (-4440.117) -- 0:09:24 271500 -- (-4444.318) (-4444.921) [-4437.230] (-4432.527) * [-4444.367] (-4443.396) (-4436.115) (-4439.859) -- 0:09:23 272000 -- (-4441.181) [-4433.503] (-4442.907) (-4450.230) * (-4444.420) [-4435.954] (-4440.372) (-4441.580) -- 0:09:22 272500 -- (-4447.606) (-4440.005) (-4437.386) [-4434.623] * [-4437.354] (-4443.185) (-4438.600) (-4447.089) -- 0:09:23 273000 -- (-4438.679) [-4437.422] (-4441.526) (-4443.277) * (-4440.710) (-4439.364) (-4434.564) [-4441.511] -- 0:09:21 273500 -- (-4438.652) (-4444.025) [-4433.879] (-4434.062) * (-4446.926) (-4450.337) (-4433.438) [-4433.430] -- 0:09:23 274000 -- (-4447.104) (-4449.468) (-4434.198) [-4436.653] * (-4436.570) [-4442.580] (-4444.829) (-4438.931) -- 0:09:21 274500 -- (-4440.038) (-4450.398) (-4437.090) [-4431.455] * [-4435.332] (-4442.693) (-4436.983) (-4436.630) -- 0:09:20 275000 -- [-4438.366] (-4453.065) (-4444.793) (-4433.982) * (-4440.812) (-4443.008) [-4433.729] (-4443.239) -- 0:09:21 Average standard deviation of split frequencies: 0.009065 275500 -- [-4439.792] (-4450.202) (-4437.123) (-4443.498) * (-4430.544) (-4435.262) [-4443.357] (-4439.361) -- 0:09:20 276000 -- [-4437.720] (-4440.766) (-4433.365) (-4435.322) * (-4445.154) (-4437.476) (-4437.360) [-4438.909] -- 0:09:18 276500 -- [-4434.524] (-4442.115) (-4441.931) (-4429.600) * (-4445.491) (-4435.520) (-4434.243) [-4438.415] -- 0:09:19 277000 -- (-4440.732) [-4436.250] (-4435.839) (-4439.552) * (-4438.684) (-4439.330) (-4448.456) [-4436.249] -- 0:09:18 277500 -- (-4440.691) (-4431.253) (-4445.014) [-4436.267] * (-4444.662) (-4436.488) [-4438.016] (-4437.511) -- 0:09:19 278000 -- (-4442.784) (-4434.336) [-4434.343] (-4448.760) * [-4436.845] (-4435.828) (-4436.918) (-4435.897) -- 0:09:18 278500 -- [-4434.504] (-4434.288) (-4430.906) (-4438.374) * (-4437.411) [-4430.657] (-4437.026) (-4438.929) -- 0:09:16 279000 -- (-4437.425) (-4446.305) [-4430.124] (-4431.216) * (-4435.225) (-4437.032) [-4430.483] (-4441.736) -- 0:09:18 279500 -- [-4432.454] (-4444.663) (-4430.677) (-4434.629) * [-4430.086] (-4446.036) (-4439.587) (-4443.813) -- 0:09:16 280000 -- [-4432.102] (-4444.993) (-4443.860) (-4436.572) * (-4430.291) (-4435.867) (-4437.817) [-4437.155] -- 0:09:18 Average standard deviation of split frequencies: 0.010465 280500 -- (-4435.832) (-4433.901) (-4440.249) [-4436.017] * [-4433.896] (-4443.986) (-4437.226) (-4446.328) -- 0:09:16 281000 -- (-4438.342) [-4432.381] (-4432.141) (-4453.675) * [-4429.631] (-4439.754) (-4443.625) (-4438.008) -- 0:09:15 281500 -- (-4451.072) [-4437.372] (-4434.576) (-4443.750) * (-4436.639) [-4433.952] (-4442.266) (-4433.522) -- 0:09:16 282000 -- (-4445.549) [-4443.597] (-4439.002) (-4432.040) * (-4444.971) [-4432.333] (-4441.107) (-4449.864) -- 0:09:15 282500 -- (-4433.364) (-4446.946) (-4448.235) [-4441.507] * (-4450.182) (-4426.729) [-4437.024] (-4450.862) -- 0:09:13 283000 -- (-4431.798) (-4441.498) [-4437.020] (-4437.220) * (-4440.626) (-4441.886) (-4435.299) [-4435.936] -- 0:09:14 283500 -- [-4439.799] (-4452.650) (-4435.487) (-4436.136) * (-4445.236) (-4443.907) (-4446.676) [-4440.351] -- 0:09:13 284000 -- (-4434.881) (-4436.370) (-4437.292) [-4435.415] * (-4457.515) [-4438.397] (-4446.740) (-4442.763) -- 0:09:14 284500 -- [-4434.025] (-4436.715) (-4437.644) (-4438.767) * (-4447.345) [-4438.930] (-4440.013) (-4440.504) -- 0:09:13 285000 -- (-4437.735) [-4433.467] (-4447.397) (-4437.246) * [-4430.748] (-4445.546) (-4446.578) (-4441.328) -- 0:09:11 Average standard deviation of split frequencies: 0.012045 285500 -- (-4446.027) [-4428.546] (-4436.840) (-4431.697) * [-4436.002] (-4437.712) (-4445.043) (-4433.448) -- 0:09:13 286000 -- [-4439.474] (-4435.864) (-4437.102) (-4434.540) * [-4430.022] (-4433.943) (-4439.437) (-4437.841) -- 0:09:11 286500 -- (-4441.880) [-4434.830] (-4438.306) (-4441.311) * (-4438.583) (-4444.481) (-4439.756) [-4432.283] -- 0:09:10 287000 -- (-4455.896) [-4428.807] (-4438.448) (-4443.916) * [-4440.307] (-4428.751) (-4445.968) (-4445.522) -- 0:09:11 287500 -- (-4441.523) [-4433.693] (-4443.186) (-4436.677) * (-4447.396) [-4433.000] (-4432.759) (-4444.178) -- 0:09:10 288000 -- (-4446.745) [-4434.742] (-4444.511) (-4438.084) * (-4437.596) [-4435.909] (-4446.645) (-4447.958) -- 0:09:11 288500 -- (-4440.283) (-4436.814) (-4436.609) [-4434.393] * (-4445.044) (-4441.391) (-4442.634) [-4442.741] -- 0:09:09 289000 -- (-4433.115) (-4446.295) [-4437.290] (-4448.186) * (-4437.117) (-4453.885) [-4433.791] (-4434.884) -- 0:09:08 289500 -- (-4439.725) (-4443.484) (-4436.674) [-4437.179] * [-4429.353] (-4440.936) (-4442.632) (-4439.828) -- 0:09:09 290000 -- (-4437.201) [-4434.454] (-4445.067) (-4442.863) * (-4430.153) (-4443.340) (-4442.085) [-4432.508] -- 0:09:08 Average standard deviation of split frequencies: 0.012101 290500 -- (-4443.936) [-4438.397] (-4440.506) (-4438.293) * (-4433.433) (-4452.480) (-4432.682) [-4439.104] -- 0:09:09 291000 -- (-4441.437) [-4444.681] (-4453.610) (-4432.760) * (-4443.882) (-4449.462) (-4432.975) [-4431.345] -- 0:09:08 291500 -- (-4435.589) (-4447.676) [-4440.702] (-4433.244) * (-4447.104) (-4441.037) [-4437.247] (-4431.815) -- 0:09:06 292000 -- (-4437.038) (-4437.238) [-4438.778] (-4435.941) * (-4437.784) [-4437.450] (-4438.794) (-4433.297) -- 0:09:07 292500 -- (-4445.040) [-4437.767] (-4438.726) (-4436.551) * [-4434.094] (-4453.063) (-4435.073) (-4445.076) -- 0:09:06 293000 -- (-4455.173) (-4436.849) (-4439.568) [-4436.137] * (-4434.119) (-4445.624) (-4440.005) [-4437.160] -- 0:09:07 293500 -- (-4434.786) (-4435.319) (-4439.847) [-4434.718] * (-4453.297) (-4440.349) (-4436.874) [-4432.663] -- 0:09:06 294000 -- (-4438.482) (-4431.217) (-4441.889) [-4435.643] * (-4437.956) (-4444.041) (-4440.011) [-4439.645] -- 0:09:05 294500 -- (-4432.794) (-4433.125) (-4452.640) [-4432.783] * (-4438.057) [-4434.483] (-4433.538) (-4433.119) -- 0:09:06 295000 -- (-4437.166) [-4432.880] (-4436.437) (-4439.771) * (-4431.805) (-4432.993) (-4440.649) [-4431.497] -- 0:09:04 Average standard deviation of split frequencies: 0.012128 295500 -- (-4438.296) (-4434.734) (-4436.620) [-4430.038] * [-4441.731] (-4440.925) (-4441.665) (-4433.894) -- 0:09:05 296000 -- (-4437.439) (-4444.175) (-4436.453) [-4434.289] * (-4434.256) (-4439.780) [-4433.957] (-4436.469) -- 0:09:04 296500 -- [-4430.118] (-4434.419) (-4441.661) (-4431.320) * (-4424.098) [-4434.848] (-4436.583) (-4440.840) -- 0:09:03 297000 -- (-4432.608) [-4438.869] (-4445.594) (-4434.045) * (-4436.485) [-4435.467] (-4440.933) (-4452.864) -- 0:09:04 297500 -- (-4437.704) [-4435.686] (-4434.240) (-4444.822) * [-4440.521] (-4444.368) (-4438.373) (-4442.568) -- 0:09:03 298000 -- (-4433.621) (-4438.999) (-4444.139) [-4434.297] * [-4438.874] (-4434.140) (-4430.265) (-4435.450) -- 0:09:01 298500 -- (-4443.122) (-4437.227) (-4448.121) [-4436.891] * (-4435.868) (-4430.097) [-4432.360] (-4434.405) -- 0:09:02 299000 -- (-4435.817) (-4434.044) (-4444.448) [-4436.324] * (-4434.599) [-4439.891] (-4446.792) (-4432.349) -- 0:09:01 299500 -- [-4433.185] (-4434.060) (-4443.246) (-4449.774) * (-4438.763) (-4435.664) (-4430.296) [-4437.696] -- 0:09:02 300000 -- (-4435.335) (-4453.723) [-4442.053] (-4459.229) * (-4443.810) [-4440.226] (-4434.774) (-4445.617) -- 0:09:01 Average standard deviation of split frequencies: 0.010010 300500 -- (-4442.684) [-4431.836] (-4451.696) (-4442.937) * [-4428.745] (-4437.781) (-4434.574) (-4445.612) -- 0:09:02 301000 -- (-4443.681) (-4436.872) (-4435.796) [-4440.893] * (-4435.823) [-4447.605] (-4439.089) (-4450.902) -- 0:09:01 301500 -- [-4435.446] (-4439.165) (-4441.788) (-4437.690) * (-4443.260) [-4437.277] (-4439.350) (-4441.343) -- 0:08:59 302000 -- [-4435.914] (-4443.646) (-4442.048) (-4428.952) * (-4439.195) (-4441.649) (-4453.143) [-4442.205] -- 0:09:00 302500 -- [-4429.633] (-4445.206) (-4451.145) (-4432.290) * [-4435.847] (-4433.699) (-4451.144) (-4437.859) -- 0:08:59 303000 -- [-4435.774] (-4452.716) (-4431.965) (-4440.639) * (-4438.536) [-4431.310] (-4444.238) (-4448.083) -- 0:08:58 303500 -- (-4442.560) (-4450.741) [-4439.921] (-4434.408) * [-4431.249] (-4451.109) (-4432.811) (-4453.315) -- 0:08:59 304000 -- (-4447.400) (-4443.793) (-4433.653) [-4441.802] * (-4434.273) (-4437.229) (-4440.035) [-4431.315] -- 0:08:58 304500 -- [-4437.441] (-4440.204) (-4439.433) (-4433.787) * (-4437.345) (-4433.183) [-4444.514] (-4443.144) -- 0:08:59 305000 -- [-4433.396] (-4440.862) (-4438.847) (-4442.306) * (-4437.563) (-4443.533) (-4436.287) [-4445.577] -- 0:08:57 Average standard deviation of split frequencies: 0.010191 305500 -- [-4436.813] (-4444.549) (-4436.340) (-4431.401) * (-4443.514) [-4431.631] (-4443.889) (-4443.017) -- 0:08:56 306000 -- (-4433.718) (-4452.867) [-4435.873] (-4441.244) * (-4430.406) [-4431.147] (-4451.914) (-4436.993) -- 0:08:57 306500 -- (-4446.837) (-4444.448) [-4434.342] (-4432.768) * (-4441.474) [-4443.848] (-4439.986) (-4437.348) -- 0:08:56 307000 -- (-4442.267) (-4438.019) [-4442.128] (-4442.906) * (-4440.263) (-4457.238) [-4437.914] (-4432.737) -- 0:08:57 307500 -- (-4442.285) (-4437.907) [-4440.210] (-4439.785) * (-4436.502) (-4439.902) (-4440.350) [-4441.351] -- 0:08:55 308000 -- (-4436.492) [-4434.178] (-4440.759) (-4444.147) * (-4439.919) [-4433.446] (-4435.122) (-4444.155) -- 0:08:56 308500 -- (-4440.447) (-4434.962) (-4441.066) [-4440.208] * (-4441.908) (-4446.883) (-4433.463) [-4441.276] -- 0:08:55 309000 -- [-4440.822] (-4438.088) (-4435.468) (-4453.453) * (-4447.203) (-4435.332) [-4434.780] (-4438.350) -- 0:08:54 309500 -- (-4443.016) (-4449.114) [-4452.880] (-4436.248) * (-4434.373) [-4436.588] (-4431.769) (-4438.538) -- 0:08:55 310000 -- (-4436.584) (-4439.443) [-4436.606] (-4437.736) * (-4433.424) (-4440.036) (-4451.176) [-4433.104] -- 0:08:54 Average standard deviation of split frequencies: 0.011272 310500 -- (-4455.522) [-4438.845] (-4439.633) (-4447.459) * (-4432.730) (-4441.456) (-4447.433) [-4440.899] -- 0:08:55 311000 -- (-4440.230) (-4441.999) [-4431.756] (-4438.190) * (-4437.499) (-4444.294) [-4438.741] (-4443.139) -- 0:08:53 311500 -- (-4442.906) [-4429.943] (-4438.795) (-4441.027) * (-4439.842) [-4437.774] (-4443.336) (-4460.842) -- 0:08:52 312000 -- (-4447.867) (-4435.680) [-4434.125] (-4446.292) * (-4437.938) (-4437.519) [-4435.156] (-4432.799) -- 0:08:53 312500 -- (-4441.043) (-4438.164) [-4432.479] (-4445.878) * (-4441.428) (-4437.574) [-4442.115] (-4437.660) -- 0:08:52 313000 -- (-4442.289) [-4438.907] (-4447.126) (-4444.806) * (-4428.694) [-4437.150] (-4439.071) (-4440.285) -- 0:08:53 313500 -- [-4443.494] (-4442.908) (-4438.823) (-4434.469) * [-4430.138] (-4452.922) (-4443.274) (-4438.240) -- 0:08:52 314000 -- (-4438.213) [-4426.761] (-4443.052) (-4427.459) * (-4433.770) (-4439.628) (-4437.121) [-4434.038] -- 0:08:50 314500 -- (-4456.079) (-4434.291) [-4436.988] (-4432.454) * (-4429.413) (-4431.974) (-4439.862) [-4434.493] -- 0:08:51 315000 -- (-4444.000) [-4437.286] (-4436.791) (-4428.116) * (-4428.789) (-4440.573) [-4435.031] (-4438.854) -- 0:08:50 Average standard deviation of split frequencies: 0.010443 315500 -- (-4441.254) [-4434.009] (-4433.567) (-4432.733) * [-4438.361] (-4439.340) (-4452.519) (-4440.754) -- 0:08:49 316000 -- [-4434.446] (-4439.236) (-4435.351) (-4443.427) * [-4436.346] (-4434.322) (-4440.888) (-4431.397) -- 0:08:50 316500 -- [-4431.889] (-4442.837) (-4446.988) (-4439.733) * [-4429.645] (-4439.549) (-4435.925) (-4437.277) -- 0:08:49 317000 -- (-4433.548) [-4435.263] (-4435.396) (-4436.480) * (-4432.643) [-4434.835] (-4446.800) (-4443.121) -- 0:08:50 317500 -- [-4435.427] (-4439.724) (-4438.542) (-4440.953) * (-4436.080) (-4441.885) (-4434.255) [-4433.117] -- 0:08:48 318000 -- (-4431.863) (-4447.475) [-4427.499] (-4435.689) * (-4433.472) (-4438.147) (-4443.761) [-4441.739] -- 0:08:47 318500 -- (-4438.092) [-4437.323] (-4431.871) (-4429.935) * (-4430.308) [-4440.413] (-4436.128) (-4436.807) -- 0:08:48 319000 -- (-4441.120) (-4440.660) [-4430.909] (-4440.688) * [-4445.399] (-4434.249) (-4447.040) (-4434.595) -- 0:08:47 319500 -- [-4436.334] (-4442.053) (-4436.978) (-4439.955) * (-4431.325) (-4434.479) [-4435.503] (-4436.355) -- 0:08:48 320000 -- (-4450.487) (-4440.913) [-4434.981] (-4440.063) * (-4430.920) (-4441.932) (-4432.053) [-4436.292] -- 0:08:47 Average standard deviation of split frequencies: 0.009612 320500 -- (-4437.593) (-4433.785) (-4434.124) [-4438.183] * (-4439.161) (-4437.026) (-4440.645) [-4447.394] -- 0:08:45 321000 -- (-4440.489) (-4436.728) [-4435.918] (-4449.493) * (-4439.867) (-4440.236) (-4438.473) [-4430.984] -- 0:08:46 321500 -- [-4438.511] (-4433.143) (-4433.297) (-4445.003) * (-4435.394) (-4436.722) [-4434.577] (-4437.162) -- 0:08:45 322000 -- (-4436.249) (-4445.836) [-4433.371] (-4440.084) * (-4441.031) [-4435.533] (-4431.138) (-4440.190) -- 0:08:46 322500 -- (-4433.560) (-4441.602) (-4445.393) [-4439.116] * (-4446.589) (-4440.147) [-4431.752] (-4434.436) -- 0:08:45 323000 -- (-4444.150) [-4432.781] (-4439.199) (-4441.862) * [-4435.660] (-4435.449) (-4430.018) (-4442.201) -- 0:08:43 323500 -- [-4440.578] (-4439.629) (-4440.773) (-4437.117) * [-4433.515] (-4432.529) (-4434.645) (-4439.574) -- 0:08:44 324000 -- (-4434.189) (-4439.706) [-4430.780] (-4443.986) * (-4429.340) (-4442.819) [-4429.774] (-4436.621) -- 0:08:43 324500 -- [-4429.634] (-4435.159) (-4438.514) (-4430.763) * (-4441.366) (-4440.073) (-4435.283) [-4431.515] -- 0:08:42 325000 -- (-4435.348) (-4436.604) (-4441.814) [-4431.344] * (-4439.498) (-4433.630) (-4437.069) [-4438.602] -- 0:08:43 Average standard deviation of split frequencies: 0.010567 325500 -- (-4431.736) (-4444.056) (-4437.957) [-4431.135] * (-4435.190) (-4439.566) (-4438.008) [-4434.118] -- 0:08:42 326000 -- (-4437.721) (-4440.743) (-4450.760) [-4438.619] * (-4438.367) [-4435.494] (-4434.950) (-4438.282) -- 0:08:43 326500 -- (-4436.105) (-4447.206) [-4437.279] (-4442.176) * (-4438.058) (-4434.711) [-4436.453] (-4439.188) -- 0:08:41 327000 -- [-4438.780] (-4443.510) (-4446.047) (-4440.238) * (-4442.014) (-4441.265) (-4440.632) [-4430.568] -- 0:08:40 327500 -- (-4442.724) (-4439.723) (-4443.669) [-4436.685] * (-4435.395) (-4435.304) (-4442.494) [-4441.120] -- 0:08:41 328000 -- (-4442.603) (-4437.339) [-4437.332] (-4442.956) * (-4448.866) [-4442.868] (-4441.321) (-4439.710) -- 0:08:40 328500 -- (-4443.335) (-4438.891) [-4441.243] (-4442.621) * (-4433.860) (-4434.084) [-4438.630] (-4450.487) -- 0:08:39 329000 -- (-4439.516) (-4437.154) [-4432.957] (-4437.194) * (-4436.983) (-4434.748) (-4433.409) [-4436.517] -- 0:08:40 329500 -- (-4432.956) [-4435.507] (-4436.402) (-4441.551) * (-4436.420) [-4432.009] (-4437.357) (-4433.277) -- 0:08:38 330000 -- (-4435.392) [-4432.491] (-4450.264) (-4436.933) * [-4440.561] (-4433.720) (-4432.190) (-4445.693) -- 0:08:39 Average standard deviation of split frequencies: 0.011076 330500 -- (-4440.675) (-4441.601) (-4438.063) [-4433.933] * (-4448.098) [-4432.846] (-4437.394) (-4435.741) -- 0:08:38 331000 -- (-4438.227) (-4446.474) [-4440.187] (-4441.035) * (-4457.389) [-4437.166] (-4441.751) (-4437.650) -- 0:08:37 331500 -- (-4438.760) (-4441.653) [-4431.046] (-4440.473) * (-4441.951) (-4429.515) (-4432.011) [-4436.530] -- 0:08:38 332000 -- (-4442.077) [-4439.416] (-4441.327) (-4442.422) * (-4449.082) (-4440.972) [-4442.253] (-4449.048) -- 0:08:37 332500 -- (-4437.930) [-4438.256] (-4437.149) (-4439.387) * (-4439.128) [-4430.053] (-4438.324) (-4440.184) -- 0:08:37 333000 -- [-4433.140] (-4431.321) (-4435.517) (-4436.965) * (-4437.000) (-4441.832) (-4435.997) [-4437.901] -- 0:08:36 333500 -- (-4433.112) [-4431.575] (-4442.064) (-4442.566) * [-4430.969] (-4437.020) (-4441.960) (-4437.768) -- 0:08:35 334000 -- [-4427.899] (-4438.406) (-4445.519) (-4436.331) * (-4438.485) (-4441.175) (-4437.986) [-4433.449] -- 0:08:36 334500 -- [-4425.032] (-4435.493) (-4437.917) (-4440.520) * [-4437.851] (-4439.482) (-4437.841) (-4430.784) -- 0:08:35 335000 -- (-4439.763) (-4441.579) (-4439.317) [-4437.057] * [-4435.644] (-4445.208) (-4453.183) (-4433.666) -- 0:08:34 Average standard deviation of split frequencies: 0.011440 335500 -- (-4432.119) (-4438.767) (-4442.536) [-4440.282] * (-4429.615) (-4433.060) (-4441.066) [-4433.494] -- 0:08:34 336000 -- (-4428.424) (-4431.483) [-4427.827] (-4439.849) * (-4439.815) (-4439.432) (-4437.093) [-4436.049] -- 0:08:33 336500 -- (-4453.173) (-4439.149) (-4437.933) [-4445.623] * (-4445.374) (-4443.116) (-4437.075) [-4434.190] -- 0:08:34 337000 -- (-4441.519) (-4430.397) (-4440.724) [-4437.350] * [-4439.297] (-4429.784) (-4443.984) (-4436.627) -- 0:08:33 337500 -- (-4444.006) (-4434.839) [-4440.521] (-4443.954) * (-4436.514) [-4432.743] (-4440.653) (-4437.447) -- 0:08:32 338000 -- (-4442.722) [-4435.565] (-4432.119) (-4434.123) * [-4437.042] (-4431.265) (-4430.268) (-4438.085) -- 0:08:33 338500 -- (-4428.456) [-4442.769] (-4434.993) (-4438.380) * (-4441.548) [-4431.983] (-4438.533) (-4436.012) -- 0:08:32 339000 -- (-4439.814) (-4437.824) [-4431.897] (-4439.901) * [-4433.062] (-4442.432) (-4437.242) (-4459.738) -- 0:08:30 339500 -- [-4433.498] (-4435.760) (-4436.792) (-4439.710) * (-4434.679) (-4438.781) [-4435.374] (-4456.289) -- 0:08:31 340000 -- [-4436.332] (-4441.360) (-4450.759) (-4451.385) * (-4442.400) (-4436.962) (-4430.393) [-4433.224] -- 0:08:30 Average standard deviation of split frequencies: 0.010112 340500 -- (-4429.272) [-4437.250] (-4440.749) (-4440.579) * (-4443.893) (-4444.452) (-4435.018) [-4444.479] -- 0:08:31 341000 -- (-4434.957) (-4439.901) (-4435.795) [-4438.932] * (-4439.497) (-4432.557) [-4440.988] (-4440.340) -- 0:08:30 341500 -- (-4432.799) (-4443.444) (-4440.591) [-4441.755] * (-4431.491) [-4433.429] (-4446.202) (-4435.308) -- 0:08:29 342000 -- (-4438.390) (-4443.471) (-4438.213) [-4427.250] * (-4437.626) (-4438.980) [-4437.535] (-4440.133) -- 0:08:29 342500 -- (-4439.815) (-4439.452) [-4438.105] (-4442.675) * (-4436.472) (-4440.975) [-4431.513] (-4435.604) -- 0:08:28 343000 -- (-4443.679) [-4428.308] (-4443.499) (-4435.992) * (-4442.178) (-4443.231) [-4431.275] (-4436.150) -- 0:08:29 343500 -- (-4444.741) [-4432.763] (-4438.544) (-4449.799) * (-4435.130) [-4442.046] (-4434.725) (-4447.213) -- 0:08:28 344000 -- (-4451.689) [-4431.271] (-4435.982) (-4434.708) * (-4445.938) (-4437.380) (-4439.466) [-4445.195] -- 0:08:27 344500 -- (-4450.149) (-4437.495) (-4438.801) [-4438.560] * (-4436.835) (-4436.593) (-4439.906) [-4430.357] -- 0:08:28 345000 -- (-4437.861) (-4438.514) [-4439.599] (-4447.167) * [-4439.146] (-4430.567) (-4443.846) (-4433.122) -- 0:08:26 Average standard deviation of split frequencies: 0.009926 345500 -- [-4441.682] (-4443.186) (-4438.371) (-4433.092) * (-4435.052) (-4434.709) [-4430.165] (-4429.509) -- 0:08:25 346000 -- (-4440.845) (-4440.144) [-4436.949] (-4436.284) * [-4435.191] (-4435.362) (-4440.588) (-4436.600) -- 0:08:26 346500 -- (-4436.918) (-4434.049) (-4448.821) [-4434.740] * (-4443.258) (-4438.338) [-4436.699] (-4451.811) -- 0:08:25 347000 -- (-4440.970) (-4439.513) (-4442.903) [-4432.381] * (-4435.405) [-4435.798] (-4433.086) (-4447.521) -- 0:08:26 347500 -- (-4440.665) (-4435.137) [-4438.224] (-4439.119) * [-4432.673] (-4441.764) (-4441.623) (-4444.149) -- 0:08:25 348000 -- (-4431.903) (-4438.931) (-4453.328) [-4437.471] * [-4431.588] (-4438.660) (-4435.509) (-4434.021) -- 0:08:23 348500 -- (-4440.050) [-4431.917] (-4448.373) (-4446.783) * (-4436.419) [-4431.371] (-4432.533) (-4429.814) -- 0:08:24 349000 -- (-4447.536) (-4442.348) [-4440.182] (-4442.881) * (-4441.695) (-4440.292) (-4432.281) [-4433.805] -- 0:08:23 349500 -- (-4442.732) (-4438.366) [-4432.400] (-4457.610) * [-4433.048] (-4434.783) (-4435.672) (-4436.895) -- 0:08:24 350000 -- (-4448.126) (-4428.678) [-4432.486] (-4453.517) * (-4438.531) (-4446.534) [-4433.838] (-4436.150) -- 0:08:23 Average standard deviation of split frequencies: 0.009122 350500 -- [-4441.755] (-4434.113) (-4436.151) (-4448.757) * (-4442.998) (-4435.099) (-4454.860) [-4433.802] -- 0:08:22 351000 -- (-4433.579) [-4439.491] (-4438.200) (-4441.216) * (-4436.288) (-4451.437) (-4439.852) [-4437.346] -- 0:08:22 351500 -- [-4432.092] (-4431.922) (-4433.697) (-4437.511) * (-4439.421) [-4433.158] (-4444.740) (-4441.608) -- 0:08:21 352000 -- (-4438.008) (-4442.185) [-4433.956] (-4434.534) * [-4438.198] (-4442.520) (-4448.357) (-4431.818) -- 0:08:20 352500 -- (-4435.469) [-4432.499] (-4430.562) (-4435.184) * (-4443.385) [-4432.512] (-4455.558) (-4438.053) -- 0:08:21 353000 -- [-4445.276] (-4435.586) (-4442.350) (-4437.903) * [-4441.031] (-4439.017) (-4437.153) (-4440.990) -- 0:08:20 353500 -- (-4434.937) [-4430.707] (-4442.868) (-4440.083) * (-4441.540) [-4435.664] (-4450.045) (-4436.648) -- 0:08:21 354000 -- (-4430.305) (-4437.458) [-4435.450] (-4449.196) * (-4458.940) (-4436.608) [-4442.082] (-4433.648) -- 0:08:20 354500 -- [-4429.303] (-4447.662) (-4445.779) (-4443.329) * (-4439.709) (-4442.817) (-4444.124) [-4436.921] -- 0:08:18 355000 -- (-4439.068) [-4435.723] (-4451.782) (-4433.693) * (-4435.202) (-4444.367) [-4446.096] (-4445.779) -- 0:08:19 Average standard deviation of split frequencies: 0.008891 355500 -- [-4428.555] (-4431.203) (-4444.159) (-4438.499) * (-4435.696) (-4441.657) [-4443.157] (-4435.926) -- 0:08:18 356000 -- [-4429.665] (-4433.467) (-4452.541) (-4440.893) * [-4434.601] (-4440.641) (-4442.587) (-4440.503) -- 0:08:17 356500 -- [-4427.436] (-4434.916) (-4446.127) (-4447.600) * (-4434.640) [-4429.754] (-4452.259) (-4436.303) -- 0:08:18 357000 -- (-4442.438) (-4445.175) (-4449.168) [-4433.897] * [-4433.736] (-4436.825) (-4439.820) (-4434.310) -- 0:08:17 357500 -- (-4438.907) (-4439.184) [-4436.239] (-4441.444) * (-4437.417) (-4433.443) (-4435.936) [-4441.579] -- 0:08:17 358000 -- (-4438.459) [-4433.265] (-4438.942) (-4434.771) * (-4430.158) (-4437.979) [-4441.299] (-4443.830) -- 0:08:16 358500 -- (-4442.472) (-4431.226) (-4438.796) [-4438.815] * (-4432.556) [-4443.805] (-4440.140) (-4442.850) -- 0:08:15 359000 -- (-4449.981) (-4432.505) [-4440.939] (-4434.175) * (-4432.730) [-4442.156] (-4443.623) (-4441.478) -- 0:08:16 359500 -- (-4438.970) (-4437.522) (-4429.224) [-4430.262] * (-4433.825) (-4436.238) (-4441.461) [-4439.884] -- 0:08:15 360000 -- (-4442.570) (-4439.499) [-4437.333] (-4438.452) * (-4440.537) (-4437.284) (-4444.278) [-4433.534] -- 0:08:16 Average standard deviation of split frequencies: 0.008589 360500 -- (-4446.854) (-4438.139) (-4441.078) [-4448.103] * (-4441.555) [-4448.912] (-4435.985) (-4442.984) -- 0:08:14 361000 -- (-4433.723) (-4436.168) [-4429.550] (-4444.136) * (-4426.238) [-4438.263] (-4445.367) (-4434.293) -- 0:08:13 361500 -- [-4431.530] (-4437.604) (-4433.025) (-4444.836) * [-4433.568] (-4431.204) (-4443.694) (-4436.140) -- 0:08:14 362000 -- [-4430.812] (-4437.325) (-4438.228) (-4451.079) * [-4429.068] (-4432.633) (-4448.790) (-4442.488) -- 0:08:13 362500 -- (-4431.186) [-4431.290] (-4437.277) (-4448.140) * [-4436.042] (-4438.927) (-4438.506) (-4441.627) -- 0:08:14 363000 -- (-4439.193) (-4431.291) (-4443.380) [-4437.763] * (-4444.469) [-4435.510] (-4440.751) (-4433.333) -- 0:08:13 363500 -- (-4444.457) [-4437.065] (-4439.783) (-4440.630) * [-4438.972] (-4435.090) (-4456.203) (-4436.350) -- 0:08:12 364000 -- (-4439.417) (-4434.915) (-4443.015) [-4426.672] * [-4434.364] (-4435.061) (-4428.141) (-4431.783) -- 0:08:12 364500 -- [-4434.023] (-4441.174) (-4444.712) (-4435.300) * (-4443.961) (-4439.085) [-4433.633] (-4434.171) -- 0:08:11 365000 -- (-4435.114) [-4430.697] (-4433.043) (-4442.657) * (-4433.675) (-4437.490) (-4443.779) [-4433.757] -- 0:08:10 Average standard deviation of split frequencies: 0.008188 365500 -- (-4435.319) [-4436.602] (-4432.415) (-4438.373) * (-4449.949) (-4438.995) (-4445.624) [-4433.094] -- 0:08:11 366000 -- [-4440.927] (-4435.909) (-4433.736) (-4433.421) * (-4440.735) (-4440.853) [-4433.589] (-4447.901) -- 0:08:10 366500 -- (-4430.603) (-4437.099) (-4438.924) [-4434.560] * (-4441.175) [-4443.782] (-4447.096) (-4438.516) -- 0:08:10 367000 -- [-4444.443] (-4436.690) (-4439.467) (-4443.169) * (-4440.622) (-4435.977) (-4442.293) [-4438.746] -- 0:08:09 367500 -- (-4446.978) (-4432.913) [-4434.862] (-4440.425) * [-4435.308] (-4435.524) (-4441.988) (-4434.568) -- 0:08:08 368000 -- (-4441.002) (-4435.773) [-4434.226] (-4440.194) * [-4435.368] (-4432.544) (-4435.435) (-4436.840) -- 0:08:09 368500 -- [-4439.916] (-4438.807) (-4443.292) (-4440.808) * (-4438.506) (-4434.285) (-4441.788) [-4436.651] -- 0:08:08 369000 -- (-4433.618) [-4439.479] (-4449.415) (-4457.669) * (-4447.079) [-4431.846] (-4447.886) (-4443.705) -- 0:08:07 369500 -- [-4432.690] (-4447.306) (-4440.847) (-4437.905) * [-4431.093] (-4437.940) (-4440.048) (-4443.408) -- 0:08:08 370000 -- (-4441.980) (-4441.430) (-4435.928) [-4430.932] * (-4433.295) (-4437.519) (-4444.474) [-4439.365] -- 0:08:06 Average standard deviation of split frequencies: 0.007903 370500 -- (-4439.145) (-4443.328) [-4437.704] (-4439.132) * [-4434.971] (-4439.490) (-4444.210) (-4457.968) -- 0:08:07 371000 -- (-4436.421) [-4440.991] (-4440.849) (-4453.890) * (-4439.820) (-4447.230) [-4429.106] (-4448.607) -- 0:08:06 371500 -- [-4440.292] (-4442.054) (-4439.959) (-4434.712) * (-4442.674) [-4429.707] (-4438.029) (-4432.354) -- 0:08:05 372000 -- (-4439.570) [-4434.295] (-4445.427) (-4438.934) * (-4440.900) [-4429.789] (-4435.806) (-4434.792) -- 0:08:06 372500 -- (-4438.159) [-4438.515] (-4432.785) (-4441.615) * (-4433.736) (-4450.884) (-4443.594) [-4441.611] -- 0:08:05 373000 -- (-4434.809) (-4442.897) [-4432.116] (-4437.657) * (-4445.358) [-4430.649] (-4438.916) (-4436.099) -- 0:08:05 373500 -- (-4434.187) (-4444.190) [-4442.777] (-4441.159) * (-4441.337) [-4432.149] (-4436.697) (-4436.538) -- 0:08:04 374000 -- (-4437.651) (-4458.504) [-4433.182] (-4439.163) * (-4440.598) (-4433.457) (-4443.164) [-4439.657] -- 0:08:03 374500 -- (-4436.850) [-4443.859] (-4433.127) (-4440.091) * (-4434.035) [-4432.851] (-4434.606) (-4432.778) -- 0:08:04 375000 -- [-4431.141] (-4460.536) (-4444.136) (-4434.826) * [-4435.029] (-4440.273) (-4442.612) (-4434.080) -- 0:08:03 Average standard deviation of split frequencies: 0.007522 375500 -- (-4452.666) (-4448.097) (-4436.013) [-4438.818] * (-4430.473) [-4436.344] (-4439.262) (-4435.003) -- 0:08:02 376000 -- (-4447.937) (-4446.508) (-4433.410) [-4435.921] * (-4439.470) (-4445.216) (-4444.862) [-4439.959] -- 0:08:02 376500 -- (-4437.925) [-4432.944] (-4433.197) (-4432.223) * (-4434.913) (-4442.637) (-4445.569) [-4430.472] -- 0:08:01 377000 -- (-4438.896) (-4433.816) [-4435.882] (-4433.920) * (-4440.245) (-4441.016) (-4434.698) [-4428.896] -- 0:08:02 377500 -- [-4431.050] (-4439.253) (-4446.009) (-4443.335) * (-4440.251) (-4455.230) [-4438.917] (-4432.345) -- 0:08:01 378000 -- (-4430.332) [-4431.421] (-4443.351) (-4438.971) * (-4444.318) (-4437.105) (-4440.563) [-4434.355] -- 0:08:00 378500 -- (-4445.180) (-4433.045) [-4433.053] (-4431.110) * (-4445.739) (-4432.536) [-4434.942] (-4448.730) -- 0:08:01 379000 -- (-4433.632) (-4435.635) (-4435.287) [-4430.751] * (-4438.742) [-4439.001] (-4438.229) (-4448.829) -- 0:08:00 379500 -- (-4436.953) (-4441.208) [-4432.387] (-4432.483) * (-4441.763) (-4444.032) [-4431.298] (-4435.978) -- 0:08:00 380000 -- [-4434.301] (-4448.144) (-4437.820) (-4439.467) * [-4446.145] (-4455.081) (-4436.181) (-4433.075) -- 0:07:59 Average standard deviation of split frequencies: 0.006668 380500 -- (-4440.105) [-4443.188] (-4448.855) (-4442.872) * (-4443.193) (-4441.178) (-4433.011) [-4435.318] -- 0:07:58 381000 -- (-4443.224) (-4439.895) (-4438.892) [-4433.863] * (-4439.682) [-4441.373] (-4439.808) (-4448.257) -- 0:07:59 381500 -- [-4426.247] (-4437.562) (-4435.905) (-4438.964) * (-4433.067) [-4432.710] (-4431.151) (-4439.859) -- 0:07:58 382000 -- [-4436.909] (-4436.696) (-4435.800) (-4440.976) * (-4439.186) (-4435.229) [-4434.027] (-4448.830) -- 0:07:57 382500 -- (-4446.078) (-4439.301) (-4443.832) [-4436.577] * (-4431.399) (-4436.793) [-4439.820] (-4429.494) -- 0:07:57 383000 -- (-4450.252) (-4431.049) [-4440.380] (-4442.247) * (-4428.039) (-4438.118) [-4429.850] (-4443.051) -- 0:07:56 383500 -- (-4436.407) [-4434.534] (-4433.704) (-4435.335) * [-4426.534] (-4438.110) (-4443.429) (-4433.150) -- 0:07:57 384000 -- (-4441.181) (-4442.157) (-4430.882) [-4440.458] * (-4434.694) [-4440.257] (-4444.861) (-4452.662) -- 0:07:56 384500 -- (-4426.256) (-4441.959) (-4441.895) [-4446.597] * (-4437.452) [-4436.040] (-4449.631) (-4443.580) -- 0:07:55 385000 -- (-4437.204) (-4440.502) (-4444.418) [-4435.979] * [-4436.214] (-4431.058) (-4446.147) (-4433.295) -- 0:07:56 Average standard deviation of split frequencies: 0.005824 385500 -- (-4441.971) [-4442.987] (-4457.489) (-4436.076) * [-4435.207] (-4437.421) (-4445.335) (-4437.122) -- 0:07:55 386000 -- [-4444.234] (-4436.774) (-4442.829) (-4440.887) * (-4432.510) (-4445.003) (-4434.558) [-4432.479] -- 0:07:55 386500 -- (-4443.197) [-4440.006] (-4440.300) (-4442.273) * (-4432.462) [-4438.600] (-4446.514) (-4429.719) -- 0:07:54 387000 -- (-4435.470) (-4434.738) (-4445.091) [-4435.949] * [-4437.062] (-4443.059) (-4447.674) (-4433.399) -- 0:07:53 387500 -- [-4437.801] (-4437.794) (-4441.971) (-4437.404) * [-4433.805] (-4443.456) (-4436.587) (-4436.235) -- 0:07:54 388000 -- [-4434.497] (-4443.693) (-4441.160) (-4434.391) * (-4433.073) (-4433.991) [-4439.819] (-4440.971) -- 0:07:53 388500 -- [-4434.158] (-4438.837) (-4442.310) (-4434.829) * (-4436.844) [-4431.767] (-4430.421) (-4434.598) -- 0:07:52 389000 -- (-4441.929) (-4442.488) [-4440.228] (-4443.826) * (-4429.668) [-4432.775] (-4433.980) (-4441.913) -- 0:07:52 389500 -- [-4437.591] (-4444.517) (-4435.504) (-4439.228) * (-4440.128) (-4442.919) (-4435.789) [-4428.580] -- 0:07:51 390000 -- [-4431.810] (-4436.277) (-4440.823) (-4434.329) * (-4430.643) [-4431.339] (-4438.360) (-4434.967) -- 0:07:52 Average standard deviation of split frequencies: 0.005384 390500 -- (-4438.966) (-4438.854) (-4432.670) [-4433.256] * (-4440.507) [-4430.283] (-4438.649) (-4441.964) -- 0:07:51 391000 -- (-4435.468) (-4444.213) (-4441.109) [-4438.662] * (-4449.483) [-4432.236] (-4449.893) (-4431.203) -- 0:07:50 391500 -- (-4447.239) [-4432.737] (-4437.970) (-4433.812) * [-4435.731] (-4434.370) (-4438.656) (-4441.364) -- 0:07:50 392000 -- (-4446.760) (-4441.432) (-4435.380) [-4436.293] * (-4442.060) (-4443.666) (-4439.581) [-4439.488] -- 0:07:49 392500 -- [-4439.041] (-4437.978) (-4455.784) (-4440.430) * (-4439.009) (-4432.132) (-4439.536) [-4435.931] -- 0:07:50 393000 -- (-4443.391) [-4434.158] (-4432.871) (-4433.668) * (-4444.199) (-4426.483) (-4438.960) [-4435.167] -- 0:07:49 393500 -- (-4445.048) [-4439.373] (-4437.765) (-4434.701) * (-4440.296) (-4426.978) (-4440.006) [-4436.934] -- 0:07:48 394000 -- [-4431.875] (-4441.967) (-4440.003) (-4426.110) * [-4433.092] (-4432.164) (-4444.688) (-4434.418) -- 0:07:49 394500 -- (-4441.794) (-4449.136) (-4438.538) [-4434.115] * (-4436.604) [-4432.019] (-4443.919) (-4433.298) -- 0:07:48 395000 -- (-4436.114) (-4442.436) (-4436.154) [-4431.907] * (-4443.155) (-4435.132) (-4441.318) [-4433.038] -- 0:07:47 Average standard deviation of split frequencies: 0.006037 395500 -- (-4445.231) (-4439.831) [-4436.915] (-4438.200) * [-4442.520] (-4439.609) (-4439.934) (-4438.035) -- 0:07:47 396000 -- (-4433.613) (-4441.085) (-4441.283) [-4441.837] * (-4438.855) (-4448.670) (-4438.263) [-4436.391] -- 0:07:46 396500 -- [-4440.489] (-4440.405) (-4443.569) (-4434.452) * (-4443.590) (-4437.173) [-4433.254] (-4434.238) -- 0:07:47 397000 -- (-4444.298) (-4449.189) (-4429.932) [-4442.226] * (-4438.470) (-4446.737) (-4431.733) [-4434.755] -- 0:07:46 397500 -- [-4442.518] (-4437.338) (-4429.292) (-4434.883) * [-4436.369] (-4437.995) (-4446.734) (-4446.569) -- 0:07:45 398000 -- [-4429.503] (-4442.677) (-4434.989) (-4435.323) * (-4438.966) (-4433.294) [-4435.613] (-4431.492) -- 0:07:45 398500 -- [-4438.266] (-4440.872) (-4434.808) (-4466.155) * [-4433.258] (-4434.384) (-4433.194) (-4437.994) -- 0:07:44 399000 -- (-4446.653) [-4436.413] (-4437.171) (-4438.268) * [-4427.494] (-4443.191) (-4442.546) (-4439.007) -- 0:07:43 399500 -- [-4434.490] (-4437.443) (-4440.269) (-4443.641) * [-4430.118] (-4434.276) (-4434.047) (-4453.272) -- 0:07:44 400000 -- [-4431.704] (-4434.253) (-4439.115) (-4445.077) * [-4440.242] (-4448.898) (-4435.545) (-4447.981) -- 0:07:43 Average standard deviation of split frequencies: 0.006303 400500 -- (-4450.540) (-4437.800) [-4436.838] (-4434.440) * (-4440.350) (-4454.971) (-4437.013) [-4439.216] -- 0:07:44 401000 -- (-4448.640) (-4435.458) [-4441.375] (-4443.270) * (-4433.078) (-4447.717) (-4434.569) [-4435.252] -- 0:07:43 401500 -- (-4449.314) (-4431.379) [-4441.428] (-4434.732) * (-4438.115) (-4445.096) (-4434.031) [-4433.727] -- 0:07:42 402000 -- (-4449.905) (-4433.447) (-4437.946) [-4430.996] * [-4430.929] (-4441.041) (-4439.599) (-4436.127) -- 0:07:42 402500 -- (-4440.557) (-4436.564) (-4438.622) [-4426.697] * (-4434.451) (-4444.545) [-4434.534] (-4444.819) -- 0:07:41 403000 -- (-4441.806) [-4445.313] (-4439.944) (-4445.020) * (-4442.457) (-4438.785) [-4434.476] (-4443.159) -- 0:07:42 403500 -- (-4446.683) [-4440.517] (-4433.625) (-4444.619) * (-4431.774) (-4434.423) (-4432.344) [-4432.553] -- 0:07:41 404000 -- [-4440.682] (-4434.566) (-4435.459) (-4442.918) * (-4436.330) [-4433.513] (-4435.334) (-4436.408) -- 0:07:40 404500 -- (-4452.721) (-4434.749) (-4433.360) [-4441.097] * (-4432.929) (-4439.022) (-4430.999) [-4438.152] -- 0:07:40 405000 -- [-4432.483] (-4435.748) (-4449.385) (-4441.407) * [-4435.651] (-4431.343) (-4437.563) (-4450.332) -- 0:07:39 Average standard deviation of split frequencies: 0.006469 405500 -- [-4436.270] (-4445.894) (-4446.842) (-4435.196) * [-4430.112] (-4443.078) (-4435.433) (-4437.631) -- 0:07:38 406000 -- [-4431.972] (-4436.879) (-4441.449) (-4431.740) * [-4434.816] (-4436.810) (-4438.488) (-4433.210) -- 0:07:39 406500 -- (-4444.959) (-4436.322) (-4436.789) [-4432.259] * (-4440.361) (-4436.452) [-4438.336] (-4439.744) -- 0:07:38 407000 -- (-4446.621) [-4431.685] (-4433.981) (-4447.727) * (-4436.552) [-4440.809] (-4439.438) (-4436.085) -- 0:07:38 407500 -- (-4450.949) (-4433.475) [-4434.103] (-4431.310) * [-4446.723] (-4435.324) (-4448.955) (-4439.128) -- 0:07:38 408000 -- [-4435.758] (-4442.583) (-4440.358) (-4443.441) * [-4438.912] (-4445.122) (-4443.095) (-4430.941) -- 0:07:37 408500 -- (-4447.374) (-4446.194) (-4450.972) [-4439.368] * (-4436.183) (-4443.394) [-4441.080] (-4437.748) -- 0:07:37 409000 -- (-4440.573) (-4436.428) [-4434.598] (-4438.255) * (-4440.869) [-4438.224] (-4430.252) (-4441.254) -- 0:07:36 409500 -- (-4447.172) (-4437.104) [-4433.053] (-4437.679) * (-4442.137) (-4444.576) [-4435.538] (-4442.313) -- 0:07:35 410000 -- (-4451.271) (-4444.213) (-4438.268) [-4431.940] * (-4435.142) (-4451.656) (-4439.117) [-4434.450] -- 0:07:36 Average standard deviation of split frequencies: 0.007953 410500 -- (-4447.942) [-4436.450] (-4445.022) (-4444.260) * (-4442.655) (-4450.424) (-4437.492) [-4434.777] -- 0:07:35 411000 -- [-4440.923] (-4444.286) (-4444.124) (-4451.668) * (-4442.453) [-4440.428] (-4439.361) (-4432.931) -- 0:07:35 411500 -- (-4442.963) [-4434.035] (-4437.964) (-4443.591) * (-4431.801) (-4440.429) [-4441.809] (-4448.095) -- 0:07:34 412000 -- (-4445.210) (-4434.611) (-4435.005) [-4430.534] * (-4439.568) [-4441.305] (-4441.455) (-4442.245) -- 0:07:33 412500 -- [-4436.067] (-4433.985) (-4435.973) (-4433.191) * (-4454.662) (-4442.785) [-4431.905] (-4437.108) -- 0:07:34 413000 -- (-4442.312) [-4434.378] (-4431.747) (-4444.457) * [-4433.752] (-4447.363) (-4434.509) (-4439.537) -- 0:07:33 413500 -- (-4433.991) [-4434.385] (-4450.470) (-4438.109) * (-4438.280) (-4441.518) (-4440.683) [-4428.254] -- 0:07:33 414000 -- [-4436.422] (-4438.772) (-4438.698) (-4432.322) * (-4436.094) (-4458.078) [-4440.900] (-4433.357) -- 0:07:32 414500 -- (-4436.057) [-4436.305] (-4441.950) (-4433.518) * [-4434.175] (-4438.547) (-4431.593) (-4439.052) -- 0:07:32 415000 -- (-4445.638) [-4434.199] (-4449.138) (-4442.493) * (-4433.725) [-4439.936] (-4430.130) (-4446.576) -- 0:07:32 Average standard deviation of split frequencies: 0.007770 415500 -- (-4438.226) (-4437.668) (-4437.389) [-4433.728] * (-4427.078) (-4443.888) [-4429.660] (-4445.354) -- 0:07:31 416000 -- (-4441.552) (-4435.787) (-4437.837) [-4435.423] * (-4437.419) (-4443.458) (-4440.782) [-4439.569] -- 0:07:30 416500 -- (-4439.302) (-4431.503) (-4429.943) [-4432.848] * (-4427.809) [-4440.286] (-4449.361) (-4430.647) -- 0:07:31 417000 -- (-4434.706) (-4438.978) (-4436.629) [-4442.613] * (-4436.329) [-4431.095] (-4446.516) (-4436.197) -- 0:07:30 417500 -- (-4433.644) [-4433.517] (-4430.351) (-4441.804) * (-4438.314) (-4428.567) [-4439.215] (-4439.435) -- 0:07:30 418000 -- (-4438.388) (-4453.202) (-4452.729) [-4433.486] * (-4430.560) [-4434.340] (-4437.358) (-4444.147) -- 0:07:29 418500 -- (-4439.117) (-4444.689) (-4438.178) [-4434.469] * (-4435.244) [-4434.481] (-4439.892) (-4441.973) -- 0:07:28 419000 -- (-4444.032) [-4437.907] (-4441.252) (-4433.548) * (-4437.803) (-4430.949) [-4437.200] (-4443.189) -- 0:07:29 419500 -- (-4435.448) (-4443.907) [-4436.620] (-4445.695) * (-4447.992) (-4428.645) [-4436.048] (-4445.537) -- 0:07:28 420000 -- (-4446.019) (-4440.655) (-4436.397) [-4436.801] * (-4436.219) [-4424.572] (-4442.370) (-4446.304) -- 0:07:28 Average standard deviation of split frequencies: 0.008645 420500 -- (-4447.024) (-4449.325) [-4436.399] (-4426.850) * (-4444.906) [-4431.724] (-4436.425) (-4443.047) -- 0:07:27 421000 -- (-4447.167) (-4438.861) [-4443.307] (-4443.834) * (-4437.826) (-4435.309) (-4435.729) [-4430.878] -- 0:07:26 421500 -- (-4433.439) (-4433.122) (-4453.205) [-4441.697] * (-4433.304) (-4443.285) (-4436.924) [-4433.768] -- 0:07:27 422000 -- (-4437.696) (-4433.431) [-4443.597] (-4436.097) * (-4432.795) (-4433.158) [-4434.535] (-4435.362) -- 0:07:26 422500 -- [-4436.885] (-4432.775) (-4446.978) (-4446.330) * [-4433.917] (-4433.882) (-4454.177) (-4437.849) -- 0:07:25 423000 -- (-4441.392) (-4442.642) (-4437.901) [-4431.230] * [-4434.735] (-4433.063) (-4435.547) (-4445.291) -- 0:07:26 423500 -- (-4437.645) (-4450.400) [-4434.140] (-4433.750) * (-4433.361) (-4439.803) [-4437.903] (-4445.073) -- 0:07:25 424000 -- (-4437.193) (-4446.435) [-4441.137] (-4433.113) * (-4431.533) [-4436.168] (-4438.887) (-4436.991) -- 0:07:25 424500 -- (-4436.540) [-4436.108] (-4449.879) (-4447.180) * (-4432.352) (-4432.361) [-4443.393] (-4445.268) -- 0:07:24 425000 -- [-4438.859] (-4433.909) (-4446.390) (-4437.787) * (-4440.657) (-4441.927) [-4435.913] (-4454.431) -- 0:07:23 Average standard deviation of split frequencies: 0.008853 425500 -- [-4432.236] (-4438.173) (-4446.283) (-4444.352) * [-4442.100] (-4443.835) (-4441.713) (-4445.643) -- 0:07:24 426000 -- (-4449.364) (-4438.619) (-4461.974) [-4437.548] * (-4442.123) [-4431.025] (-4439.792) (-4437.112) -- 0:07:23 426500 -- (-4444.651) [-4435.390] (-4454.714) (-4436.781) * [-4436.910] (-4434.021) (-4451.579) (-4443.929) -- 0:07:22 427000 -- (-4431.735) [-4435.606] (-4443.473) (-4446.683) * (-4435.257) [-4432.699] (-4437.936) (-4437.743) -- 0:07:22 427500 -- (-4428.651) (-4430.837) [-4436.609] (-4439.529) * (-4440.609) [-4430.595] (-4440.244) (-4440.305) -- 0:07:21 428000 -- (-4442.146) (-4445.045) [-4435.468] (-4432.342) * (-4428.753) (-4437.549) [-4435.440] (-4434.768) -- 0:07:22 428500 -- [-4435.798] (-4447.187) (-4437.546) (-4441.133) * (-4441.481) (-4432.570) (-4431.522) [-4439.506] -- 0:07:21 429000 -- (-4443.021) [-4436.550] (-4431.373) (-4439.521) * (-4447.474) (-4427.571) [-4434.637] (-4444.205) -- 0:07:20 429500 -- (-4430.707) (-4437.004) [-4433.772] (-4436.351) * (-4445.011) [-4439.158] (-4440.124) (-4433.365) -- 0:07:20 430000 -- (-4434.697) (-4444.995) (-4435.151) [-4432.398] * (-4433.366) (-4439.645) (-4440.152) [-4436.573] -- 0:07:20 Average standard deviation of split frequencies: 0.008679 430500 -- (-4437.274) (-4439.128) (-4442.488) [-4442.645] * (-4435.160) [-4439.316] (-4446.076) (-4432.069) -- 0:07:20 431000 -- (-4442.524) [-4441.306] (-4449.973) (-4438.090) * [-4437.867] (-4432.777) (-4440.220) (-4437.794) -- 0:07:19 431500 -- (-4437.382) [-4436.141] (-4438.899) (-4441.327) * [-4436.282] (-4445.418) (-4435.245) (-4446.551) -- 0:07:18 432000 -- [-4433.092] (-4454.641) (-4440.174) (-4441.075) * (-4439.479) [-4442.341] (-4441.025) (-4441.743) -- 0:07:19 432500 -- (-4441.649) (-4449.533) (-4438.504) [-4437.792] * (-4438.207) (-4442.819) (-4442.024) [-4440.494] -- 0:07:18 433000 -- (-4435.692) [-4435.322] (-4444.441) (-4434.923) * (-4442.729) [-4451.767] (-4432.946) (-4438.849) -- 0:07:17 433500 -- (-4441.531) (-4426.848) (-4445.473) [-4432.865] * (-4439.165) (-4434.000) (-4437.634) [-4436.054] -- 0:07:17 434000 -- (-4444.838) (-4436.496) [-4447.754] (-4441.646) * [-4447.123] (-4440.404) (-4434.436) (-4433.052) -- 0:07:16 434500 -- [-4432.289] (-4447.663) (-4443.354) (-4442.720) * (-4443.290) [-4442.510] (-4435.923) (-4446.032) -- 0:07:17 435000 -- (-4439.900) [-4441.780] (-4447.123) (-4431.154) * (-4446.197) (-4456.060) [-4434.822] (-4459.737) -- 0:07:16 Average standard deviation of split frequencies: 0.007955 435500 -- (-4438.964) (-4436.894) (-4440.317) [-4435.108] * (-4434.860) (-4452.509) [-4441.161] (-4438.109) -- 0:07:15 436000 -- (-4436.473) (-4438.571) (-4439.370) [-4440.873] * [-4430.963] (-4449.323) (-4443.278) (-4440.375) -- 0:07:15 436500 -- (-4443.099) (-4445.828) (-4445.797) [-4437.806] * (-4435.560) [-4442.348] (-4440.370) (-4441.349) -- 0:07:15 437000 -- [-4435.546] (-4448.671) (-4441.743) (-4450.789) * (-4431.430) (-4435.680) (-4434.608) [-4436.835] -- 0:07:14 437500 -- [-4431.314] (-4438.648) (-4430.948) (-4439.864) * (-4430.864) (-4430.156) (-4438.125) [-4441.187] -- 0:07:14 438000 -- (-4439.623) [-4432.768] (-4441.967) (-4439.612) * (-4432.664) (-4435.084) (-4438.827) [-4434.823] -- 0:07:13 438500 -- (-4449.542) (-4450.106) (-4444.689) [-4437.020] * (-4440.946) (-4440.883) (-4440.155) [-4435.342] -- 0:07:14 439000 -- (-4443.923) (-4439.913) (-4442.058) [-4429.056] * [-4442.870] (-4435.210) (-4431.004) (-4436.797) -- 0:07:13 439500 -- (-4445.538) [-4436.070] (-4437.066) (-4451.726) * (-4434.103) [-4438.297] (-4438.604) (-4436.163) -- 0:07:12 440000 -- (-4437.194) (-4441.873) [-4435.306] (-4448.241) * (-4443.499) (-4446.001) [-4429.071] (-4433.676) -- 0:07:12 Average standard deviation of split frequencies: 0.008864 440500 -- [-4435.394] (-4445.725) (-4438.525) (-4451.350) * [-4432.288] (-4439.706) (-4439.973) (-4427.835) -- 0:07:11 441000 -- (-4433.189) (-4438.227) (-4433.929) [-4430.313] * [-4428.828] (-4431.428) (-4433.961) (-4430.961) -- 0:07:12 441500 -- (-4434.010) (-4447.792) [-4436.221] (-4442.297) * (-4434.784) (-4434.823) (-4438.598) [-4435.526] -- 0:07:11 442000 -- (-4441.620) [-4441.173] (-4437.952) (-4440.601) * [-4434.422] (-4443.451) (-4437.901) (-4443.323) -- 0:07:10 442500 -- [-4430.474] (-4434.635) (-4435.673) (-4439.563) * [-4431.213] (-4433.762) (-4438.641) (-4436.698) -- 0:07:10 443000 -- (-4439.803) [-4431.156] (-4433.193) (-4452.275) * (-4433.461) (-4432.771) [-4431.591] (-4440.289) -- 0:07:10 443500 -- (-4451.563) [-4427.415] (-4431.059) (-4439.675) * (-4439.910) (-4440.528) (-4440.546) [-4438.429] -- 0:07:09 444000 -- (-4449.465) [-4447.572] (-4429.216) (-4448.036) * (-4449.358) (-4441.157) (-4429.202) [-4438.598] -- 0:07:09 444500 -- (-4441.847) (-4439.447) [-4430.908] (-4432.357) * (-4440.735) [-4432.767] (-4439.654) (-4432.562) -- 0:07:08 445000 -- [-4433.496] (-4439.127) (-4435.879) (-4437.777) * [-4437.153] (-4442.504) (-4438.223) (-4438.221) -- 0:07:09 Average standard deviation of split frequencies: 0.009664 445500 -- (-4434.417) [-4442.074] (-4454.326) (-4436.276) * (-4440.906) (-4431.218) [-4439.454] (-4433.036) -- 0:07:08 446000 -- (-4439.742) [-4430.111] (-4455.573) (-4440.109) * (-4443.373) [-4438.704] (-4454.404) (-4439.753) -- 0:07:07 446500 -- [-4436.354] (-4446.348) (-4459.865) (-4446.967) * (-4438.644) (-4439.519) [-4442.356] (-4438.818) -- 0:07:07 447000 -- (-4443.948) [-4438.434] (-4452.501) (-4437.222) * [-4432.576] (-4447.798) (-4443.143) (-4448.971) -- 0:07:06 447500 -- (-4435.537) [-4435.968] (-4438.529) (-4436.731) * (-4441.127) (-4442.312) (-4454.409) [-4433.621] -- 0:07:05 448000 -- [-4433.756] (-4431.129) (-4442.094) (-4446.958) * (-4444.121) [-4432.194] (-4442.236) (-4444.686) -- 0:07:06 448500 -- [-4428.006] (-4434.300) (-4436.169) (-4437.545) * (-4437.035) (-4432.344) (-4436.721) [-4438.161] -- 0:07:05 449000 -- (-4431.844) (-4442.513) [-4441.666] (-4443.356) * [-4437.849] (-4437.559) (-4442.385) (-4447.068) -- 0:07:05 449500 -- [-4437.771] (-4444.162) (-4438.825) (-4445.268) * (-4439.810) (-4444.984) [-4443.023] (-4440.859) -- 0:07:04 450000 -- [-4440.846] (-4448.421) (-4435.481) (-4446.889) * (-4441.019) (-4438.817) [-4437.017] (-4439.700) -- 0:07:04 Average standard deviation of split frequencies: 0.009489 450500 -- [-4439.623] (-4442.298) (-4452.985) (-4442.883) * (-4434.092) (-4440.315) (-4432.320) [-4429.350] -- 0:07:04 451000 -- (-4438.539) (-4437.038) [-4431.672] (-4440.032) * [-4440.825] (-4434.020) (-4436.580) (-4435.371) -- 0:07:03 451500 -- (-4451.885) [-4429.915] (-4436.329) (-4432.216) * [-4436.698] (-4448.000) (-4431.573) (-4438.967) -- 0:07:03 452000 -- (-4440.876) (-4436.475) [-4439.088] (-4444.738) * (-4439.623) (-4439.103) [-4433.854] (-4434.168) -- 0:07:03 452500 -- [-4428.502] (-4434.419) (-4436.555) (-4439.927) * (-4436.696) (-4439.749) (-4450.925) [-4439.068] -- 0:07:02 453000 -- (-4443.177) [-4433.185] (-4448.692) (-4456.768) * [-4434.297] (-4439.531) (-4432.335) (-4440.734) -- 0:07:02 453500 -- (-4437.686) [-4447.641] (-4433.570) (-4435.149) * (-4436.410) (-4444.424) (-4449.255) [-4431.455] -- 0:07:01 454000 -- [-4436.502] (-4446.130) (-4438.194) (-4441.540) * [-4438.872] (-4438.423) (-4452.606) (-4437.819) -- 0:07:00 454500 -- (-4440.505) (-4437.022) (-4433.894) [-4427.211] * [-4434.279] (-4441.172) (-4438.073) (-4438.132) -- 0:07:01 455000 -- (-4444.949) (-4439.836) (-4429.271) [-4437.450] * (-4436.384) [-4438.216] (-4442.704) (-4427.273) -- 0:07:00 Average standard deviation of split frequencies: 0.009083 455500 -- (-4436.083) (-4445.060) (-4443.498) [-4435.666] * [-4426.921] (-4434.570) (-4443.320) (-4442.536) -- 0:07:00 456000 -- (-4435.402) (-4444.247) (-4436.084) [-4427.860] * (-4435.777) (-4432.080) [-4439.751] (-4442.918) -- 0:06:59 456500 -- (-4432.689) [-4431.518] (-4440.371) (-4429.727) * (-4427.232) (-4437.844) (-4443.966) [-4434.559] -- 0:06:59 457000 -- [-4431.144] (-4438.540) (-4435.300) (-4441.572) * (-4439.185) (-4431.393) (-4438.739) [-4436.110] -- 0:06:59 457500 -- (-4430.264) (-4444.946) [-4440.605] (-4444.430) * (-4430.814) [-4426.706] (-4436.746) (-4445.559) -- 0:06:58 458000 -- (-4439.214) (-4431.488) (-4434.308) [-4436.082] * (-4440.501) (-4432.631) (-4450.469) [-4435.943] -- 0:06:58 458500 -- (-4447.470) [-4442.850] (-4441.936) (-4438.768) * (-4444.585) [-4430.793] (-4445.422) (-4445.605) -- 0:06:58 459000 -- (-4434.095) (-4435.427) [-4439.808] (-4436.433) * (-4430.997) (-4439.988) (-4437.364) [-4440.329] -- 0:06:57 459500 -- (-4437.673) (-4444.271) (-4438.755) [-4439.588] * [-4429.123] (-4440.632) (-4433.177) (-4440.192) -- 0:06:57 460000 -- [-4441.408] (-4439.157) (-4437.822) (-4445.603) * (-4437.740) (-4431.904) [-4435.641] (-4449.292) -- 0:06:56 Average standard deviation of split frequencies: 0.009283 460500 -- (-4439.488) (-4438.038) (-4430.914) [-4433.412] * [-4436.469] (-4435.198) (-4439.719) (-4446.645) -- 0:06:55 461000 -- (-4439.592) (-4431.148) (-4441.413) [-4435.068] * [-4436.373] (-4435.605) (-4437.381) (-4442.591) -- 0:06:56 461500 -- (-4438.755) (-4440.233) [-4437.528] (-4435.803) * (-4442.202) [-4430.068] (-4444.327) (-4431.659) -- 0:06:55 462000 -- [-4441.490] (-4437.112) (-4447.651) (-4439.729) * (-4446.148) (-4439.610) (-4444.751) [-4434.576] -- 0:06:55 462500 -- (-4434.937) (-4433.327) (-4440.598) [-4433.318] * [-4434.637] (-4443.827) (-4443.362) (-4439.362) -- 0:06:54 463000 -- (-4438.679) [-4433.512] (-4443.958) (-4440.613) * (-4442.544) (-4436.299) (-4441.983) [-4439.053] -- 0:06:54 463500 -- (-4435.822) (-4445.346) [-4438.403] (-4451.627) * (-4437.023) (-4439.784) [-4438.189] (-4439.872) -- 0:06:54 464000 -- (-4443.941) (-4439.171) [-4434.139] (-4449.753) * (-4439.537) (-4442.594) [-4440.769] (-4443.266) -- 0:06:53 464500 -- (-4433.561) (-4439.148) (-4442.166) [-4442.109] * [-4439.383] (-4436.377) (-4440.676) (-4457.634) -- 0:06:52 465000 -- (-4438.866) (-4444.391) (-4437.968) [-4434.073] * [-4438.604] (-4437.074) (-4438.021) (-4441.027) -- 0:06:53 Average standard deviation of split frequencies: 0.009321 465500 -- (-4442.770) [-4435.462] (-4442.846) (-4433.367) * (-4439.472) [-4442.306] (-4442.467) (-4431.210) -- 0:06:52 466000 -- (-4446.845) [-4428.821] (-4440.408) (-4431.832) * (-4447.013) (-4436.095) (-4437.034) [-4434.783] -- 0:06:52 466500 -- (-4437.097) (-4446.999) (-4443.722) [-4437.619] * (-4439.955) (-4432.556) [-4428.305] (-4439.199) -- 0:06:51 467000 -- (-4448.750) [-4435.521] (-4439.006) (-4440.275) * [-4434.239] (-4433.433) (-4449.042) (-4433.857) -- 0:06:50 467500 -- (-4447.765) [-4429.795] (-4442.081) (-4443.003) * [-4439.510] (-4440.488) (-4431.882) (-4434.434) -- 0:06:51 468000 -- (-4444.390) [-4432.264] (-4433.889) (-4439.248) * (-4435.044) (-4438.407) [-4432.851] (-4450.129) -- 0:06:50 468500 -- [-4433.391] (-4440.610) (-4437.967) (-4439.710) * (-4439.920) (-4432.562) [-4437.517] (-4447.866) -- 0:06:50 469000 -- [-4436.734] (-4434.096) (-4443.061) (-4433.896) * (-4437.816) [-4435.936] (-4439.094) (-4435.543) -- 0:06:49 469500 -- (-4439.580) (-4444.307) [-4440.037] (-4451.544) * [-4435.023] (-4434.514) (-4432.153) (-4436.123) -- 0:06:49 470000 -- (-4436.952) (-4440.849) [-4432.671] (-4437.382) * (-4432.067) (-4434.731) [-4429.385] (-4444.020) -- 0:06:49 Average standard deviation of split frequencies: 0.009300 470500 -- (-4439.083) [-4438.914] (-4441.249) (-4439.934) * (-4433.786) [-4429.593] (-4438.929) (-4433.703) -- 0:06:48 471000 -- (-4447.539) [-4438.834] (-4433.835) (-4433.732) * (-4436.217) (-4434.336) (-4436.975) [-4431.998] -- 0:06:47 471500 -- (-4443.563) [-4440.642] (-4442.423) (-4434.399) * [-4443.762] (-4442.241) (-4441.985) (-4437.720) -- 0:06:48 472000 -- [-4433.361] (-4436.985) (-4449.079) (-4439.742) * [-4437.656] (-4437.613) (-4434.329) (-4434.624) -- 0:06:47 472500 -- [-4434.487] (-4441.795) (-4451.429) (-4435.827) * [-4440.432] (-4443.463) (-4430.688) (-4440.734) -- 0:06:47 473000 -- (-4437.919) (-4434.821) [-4435.385] (-4440.522) * (-4447.828) (-4440.499) [-4436.050] (-4435.833) -- 0:06:46 473500 -- (-4438.389) (-4435.749) [-4436.866] (-4442.210) * (-4448.710) (-4434.116) (-4432.579) [-4440.912] -- 0:06:45 474000 -- (-4447.938) (-4430.957) [-4434.065] (-4436.661) * (-4443.141) (-4451.394) (-4429.848) [-4435.586] -- 0:06:46 474500 -- (-4449.846) [-4428.450] (-4439.460) (-4437.780) * (-4440.536) (-4450.637) (-4438.555) [-4434.106] -- 0:06:45 475000 -- [-4432.641] (-4432.588) (-4431.468) (-4431.387) * (-4441.061) (-4449.718) [-4437.340] (-4438.467) -- 0:06:44 Average standard deviation of split frequencies: 0.009125 475500 -- (-4442.833) [-4432.651] (-4432.434) (-4443.967) * (-4440.773) [-4445.267] (-4438.154) (-4446.711) -- 0:06:44 476000 -- (-4443.112) [-4429.593] (-4436.168) (-4434.023) * (-4444.158) (-4446.758) (-4436.185) [-4437.416] -- 0:06:44 476500 -- (-4440.881) (-4441.982) [-4436.407] (-4447.559) * (-4435.849) (-4440.242) (-4438.700) [-4435.860] -- 0:06:44 477000 -- (-4441.539) (-4433.110) [-4434.155] (-4449.025) * (-4440.243) (-4444.268) [-4432.138] (-4437.228) -- 0:06:43 477500 -- (-4439.164) [-4441.249] (-4440.674) (-4437.786) * (-4442.448) [-4441.524] (-4445.117) (-4440.625) -- 0:06:42 478000 -- [-4436.163] (-4446.193) (-4447.610) (-4445.717) * (-4440.713) (-4441.577) [-4433.021] (-4440.249) -- 0:06:42 478500 -- (-4437.465) (-4432.510) [-4445.449] (-4438.640) * [-4434.789] (-4438.198) (-4435.541) (-4435.508) -- 0:06:42 479000 -- (-4436.552) (-4442.538) [-4434.638] (-4433.556) * [-4445.272] (-4439.325) (-4433.238) (-4432.651) -- 0:06:42 479500 -- [-4432.784] (-4442.946) (-4440.232) (-4433.241) * (-4437.835) (-4431.010) [-4441.961] (-4435.093) -- 0:06:41 480000 -- [-4445.303] (-4436.347) (-4438.371) (-4438.633) * (-4438.536) (-4443.632) [-4434.734] (-4442.891) -- 0:06:40 Average standard deviation of split frequencies: 0.008827 480500 -- [-4439.069] (-4432.355) (-4438.888) (-4439.852) * (-4441.745) [-4434.318] (-4435.931) (-4442.661) -- 0:06:41 481000 -- [-4433.880] (-4437.214) (-4444.711) (-4436.787) * [-4443.110] (-4430.993) (-4436.586) (-4434.212) -- 0:06:40 481500 -- [-4441.714] (-4439.565) (-4441.115) (-4442.239) * (-4435.872) [-4433.401] (-4431.909) (-4444.154) -- 0:06:39 482000 -- (-4443.769) [-4432.103] (-4441.843) (-4437.656) * (-4436.236) [-4431.764] (-4434.687) (-4439.870) -- 0:06:39 482500 -- (-4437.771) (-4440.104) (-4442.187) [-4438.801] * (-4439.001) (-4436.827) (-4443.520) [-4438.469] -- 0:06:38 483000 -- (-4436.136) (-4435.512) (-4448.559) [-4435.643] * (-4441.274) (-4436.883) (-4450.484) [-4439.004] -- 0:06:39 483500 -- (-4436.953) [-4435.189] (-4443.872) (-4437.799) * (-4438.064) (-4443.460) [-4439.980] (-4436.622) -- 0:06:38 484000 -- (-4438.108) [-4436.250] (-4443.155) (-4438.048) * (-4431.473) (-4438.459) [-4437.618] (-4432.065) -- 0:06:37 484500 -- [-4439.640] (-4436.130) (-4444.802) (-4443.827) * [-4429.315] (-4435.454) (-4438.083) (-4434.756) -- 0:06:37 485000 -- [-4432.475] (-4432.641) (-4432.988) (-4436.738) * (-4437.799) (-4442.234) [-4439.875] (-4435.097) -- 0:06:37 Average standard deviation of split frequencies: 0.008522 485500 -- (-4437.161) [-4432.121] (-4433.335) (-4447.017) * [-4445.310] (-4440.459) (-4439.835) (-4440.247) -- 0:06:36 486000 -- (-4433.828) (-4431.725) (-4438.626) [-4440.075] * (-4424.571) (-4451.329) (-4433.252) [-4436.814] -- 0:06:36 486500 -- [-4429.970] (-4428.016) (-4434.768) (-4440.098) * [-4436.294] (-4444.646) (-4439.253) (-4435.930) -- 0:06:35 487000 -- (-4440.891) [-4432.098] (-4444.511) (-4434.845) * (-4433.699) (-4446.218) (-4439.498) [-4430.891] -- 0:06:36 487500 -- (-4443.683) (-4440.589) (-4431.444) [-4435.592] * [-4443.038] (-4445.926) (-4452.109) (-4430.250) -- 0:06:35 488000 -- (-4438.578) [-4434.020] (-4439.445) (-4435.242) * [-4440.444] (-4438.756) (-4441.950) (-4438.597) -- 0:06:34 488500 -- (-4436.166) (-4433.924) [-4439.523] (-4436.786) * (-4455.060) (-4438.283) (-4449.623) [-4434.876] -- 0:06:34 489000 -- (-4441.454) (-4434.032) (-4435.373) [-4436.935] * (-4443.372) (-4451.088) [-4435.357] (-4440.275) -- 0:06:33 489500 -- [-4442.302] (-4438.597) (-4434.010) (-4439.712) * [-4435.992] (-4438.728) (-4439.200) (-4444.600) -- 0:06:34 490000 -- (-4436.683) (-4446.226) [-4439.952] (-4435.736) * (-4441.620) (-4442.321) [-4441.460] (-4439.955) -- 0:06:33 Average standard deviation of split frequencies: 0.008990 490500 -- [-4435.736] (-4447.017) (-4431.718) (-4452.201) * (-4433.879) (-4450.763) (-4434.739) [-4431.159] -- 0:06:32 491000 -- [-4429.521] (-4444.469) (-4455.268) (-4429.169) * (-4438.652) (-4442.826) (-4434.708) [-4431.635] -- 0:06:32 491500 -- (-4432.224) (-4436.900) [-4440.409] (-4430.294) * (-4444.694) [-4436.546] (-4434.867) (-4435.356) -- 0:06:32 492000 -- [-4437.604] (-4445.765) (-4446.524) (-4437.643) * (-4437.374) [-4433.891] (-4430.347) (-4444.330) -- 0:06:31 492500 -- (-4440.985) [-4444.134] (-4433.732) (-4435.423) * (-4441.487) (-4445.373) (-4439.820) [-4436.620] -- 0:06:31 493000 -- (-4444.850) (-4443.814) [-4432.077] (-4434.113) * [-4438.939] (-4433.699) (-4445.885) (-4443.104) -- 0:06:30 493500 -- (-4445.130) [-4432.584] (-4440.289) (-4436.563) * (-4432.836) [-4432.838] (-4438.929) (-4438.179) -- 0:06:31 494000 -- (-4436.893) (-4445.057) [-4429.588] (-4445.865) * (-4437.314) (-4430.937) [-4437.515] (-4448.353) -- 0:06:30 494500 -- (-4430.861) (-4436.378) (-4437.858) [-4435.344] * (-4438.665) (-4442.251) [-4433.076] (-4438.288) -- 0:06:29 495000 -- [-4430.611] (-4434.693) (-4443.984) (-4438.700) * (-4425.601) [-4436.264] (-4443.647) (-4433.009) -- 0:06:29 Average standard deviation of split frequencies: 0.008757 495500 -- (-4431.563) (-4430.560) (-4447.287) [-4431.832] * [-4430.734] (-4433.235) (-4446.755) (-4437.138) -- 0:06:28 496000 -- (-4436.356) (-4443.449) (-4431.834) [-4433.717] * (-4447.072) [-4438.073] (-4439.786) (-4430.256) -- 0:06:29 496500 -- (-4433.155) [-4440.550] (-4432.817) (-4437.558) * (-4437.196) (-4438.491) [-4431.508] (-4436.938) -- 0:06:28 497000 -- [-4444.685] (-4443.204) (-4442.501) (-4442.994) * (-4439.209) [-4438.016] (-4432.729) (-4442.915) -- 0:06:27 497500 -- (-4435.455) (-4441.133) [-4437.978] (-4441.022) * [-4442.213] (-4434.817) (-4437.283) (-4438.306) -- 0:06:27 498000 -- (-4442.993) [-4440.444] (-4446.887) (-4444.310) * (-4433.973) (-4437.292) [-4441.428] (-4444.642) -- 0:06:27 498500 -- (-4445.766) (-4446.429) [-4432.155] (-4450.658) * [-4434.748] (-4439.025) (-4445.838) (-4439.616) -- 0:06:26 499000 -- (-4437.300) (-4443.305) (-4439.153) [-4436.538] * (-4448.824) (-4437.489) [-4438.799] (-4446.121) -- 0:06:26 499500 -- (-4437.721) (-4434.523) [-4431.810] (-4444.289) * [-4432.193] (-4436.037) (-4436.176) (-4439.774) -- 0:06:25 500000 -- [-4436.216] (-4436.434) (-4435.884) (-4439.346) * (-4450.558) [-4437.650] (-4433.462) (-4438.022) -- 0:06:26 Average standard deviation of split frequencies: 0.008743 500500 -- (-4440.679) (-4441.913) [-4428.241] (-4436.956) * (-4436.984) [-4427.723] (-4439.075) (-4447.039) -- 0:06:25 501000 -- (-4446.708) (-4435.990) [-4432.706] (-4431.406) * (-4440.857) (-4438.431) (-4443.571) [-4438.353] -- 0:06:24 501500 -- (-4440.420) [-4433.547] (-4438.889) (-4439.153) * [-4450.132] (-4447.740) (-4437.948) (-4439.928) -- 0:06:24 502000 -- (-4434.521) (-4444.081) [-4441.135] (-4438.861) * (-4442.663) [-4441.210] (-4436.908) (-4436.926) -- 0:06:23 502500 -- (-4429.549) (-4443.402) (-4444.364) [-4439.295] * (-4444.201) [-4439.788] (-4442.836) (-4431.311) -- 0:06:24 503000 -- (-4434.495) (-4443.284) (-4443.914) [-4432.886] * [-4437.595] (-4435.125) (-4445.528) (-4436.103) -- 0:06:23 503500 -- (-4450.338) [-4436.135] (-4440.471) (-4431.217) * (-4445.539) (-4429.830) (-4440.695) [-4431.261] -- 0:06:22 504000 -- (-4436.726) [-4434.093] (-4443.441) (-4436.969) * (-4444.955) (-4427.042) (-4447.100) [-4439.665] -- 0:06:22 504500 -- (-4445.861) [-4434.178] (-4431.773) (-4439.898) * (-4442.311) [-4433.016] (-4444.062) (-4438.470) -- 0:06:22 505000 -- (-4435.992) [-4445.104] (-4438.205) (-4441.001) * (-4437.686) (-4435.488) [-4431.411] (-4443.192) -- 0:06:21 Average standard deviation of split frequencies: 0.009183 505500 -- (-4435.166) [-4424.814] (-4437.117) (-4435.281) * (-4436.826) (-4442.276) [-4430.278] (-4433.496) -- 0:06:21 506000 -- (-4440.343) (-4434.304) (-4426.248) [-4429.661] * (-4440.497) (-4433.594) [-4444.074] (-4433.889) -- 0:06:20 506500 -- [-4435.622] (-4436.688) (-4438.549) (-4433.423) * [-4437.093] (-4437.175) (-4440.901) (-4438.959) -- 0:06:20 507000 -- (-4441.287) (-4440.039) [-4441.668] (-4439.004) * [-4440.450] (-4438.388) (-4441.524) (-4433.280) -- 0:06:20 507500 -- (-4438.687) (-4435.491) [-4435.375] (-4441.587) * (-4434.709) [-4438.056] (-4432.842) (-4451.056) -- 0:06:19 508000 -- (-4438.122) (-4441.099) (-4449.009) [-4438.627] * [-4430.440] (-4432.523) (-4434.531) (-4441.807) -- 0:06:19 508500 -- (-4443.080) (-4438.680) [-4432.245] (-4435.731) * [-4436.145] (-4443.772) (-4437.916) (-4443.390) -- 0:06:18 509000 -- (-4442.099) [-4431.394] (-4437.212) (-4434.019) * [-4441.839] (-4434.477) (-4440.074) (-4437.980) -- 0:06:18 509500 -- [-4437.910] (-4441.711) (-4437.507) (-4443.366) * (-4448.536) (-4435.156) [-4433.741] (-4439.092) -- 0:06:18 510000 -- (-4440.818) (-4433.861) (-4439.145) [-4434.776] * (-4449.705) (-4435.595) (-4437.541) [-4436.646] -- 0:06:17 Average standard deviation of split frequencies: 0.009165 510500 -- (-4442.655) [-4440.080] (-4437.498) (-4434.008) * (-4446.510) (-4449.840) (-4439.328) [-4437.977] -- 0:06:17 511000 -- (-4437.610) (-4442.476) [-4434.342] (-4441.625) * (-4438.261) (-4444.472) (-4440.920) [-4434.506] -- 0:06:17 511500 -- (-4437.841) [-4440.564] (-4431.180) (-4444.768) * (-4440.020) (-4438.669) (-4435.851) [-4432.728] -- 0:06:16 512000 -- (-4446.774) (-4434.402) [-4435.087] (-4442.672) * [-4438.207] (-4438.467) (-4441.482) (-4439.221) -- 0:06:16 512500 -- (-4443.387) (-4440.866) [-4432.201] (-4447.866) * (-4439.198) [-4438.602] (-4435.941) (-4443.948) -- 0:06:15 513000 -- [-4435.075] (-4437.276) (-4433.770) (-4439.282) * (-4432.893) [-4432.901] (-4431.293) (-4447.432) -- 0:06:15 513500 -- (-4433.106) [-4433.996] (-4434.145) (-4440.169) * (-4436.837) (-4443.566) [-4428.991] (-4443.292) -- 0:06:15 514000 -- (-4436.289) (-4443.723) (-4434.083) [-4435.347] * (-4440.023) (-4433.215) (-4447.007) [-4433.910] -- 0:06:14 514500 -- (-4448.701) [-4438.894] (-4443.154) (-4440.587) * (-4439.430) (-4439.411) (-4439.727) [-4438.723] -- 0:06:14 515000 -- (-4432.530) (-4443.059) [-4436.201] (-4433.107) * (-4433.139) (-4429.381) (-4437.907) [-4435.786] -- 0:06:13 Average standard deviation of split frequencies: 0.009332 515500 -- (-4446.607) (-4437.124) [-4433.283] (-4445.231) * (-4441.699) [-4430.573] (-4435.248) (-4433.985) -- 0:06:13 516000 -- (-4430.916) (-4444.151) (-4443.486) [-4436.441] * (-4449.538) (-4437.689) (-4437.322) [-4438.596] -- 0:06:13 516500 -- (-4434.715) [-4436.380] (-4438.973) (-4438.546) * (-4443.429) [-4429.396] (-4448.869) (-4434.334) -- 0:06:12 517000 -- (-4437.884) [-4436.274] (-4440.456) (-4444.233) * (-4440.983) (-4448.962) (-4443.803) [-4434.642] -- 0:06:12 517500 -- (-4443.912) (-4434.504) (-4441.994) [-4439.203] * (-4445.318) (-4441.697) [-4433.287] (-4437.140) -- 0:06:12 518000 -- (-4451.949) [-4432.436] (-4442.222) (-4430.899) * (-4435.858) (-4435.927) [-4432.538] (-4438.756) -- 0:06:11 518500 -- (-4450.008) (-4447.591) [-4430.623] (-4444.721) * (-4439.842) (-4431.481) (-4437.266) [-4433.440] -- 0:06:11 519000 -- (-4445.141) (-4435.223) [-4429.675] (-4445.048) * (-4442.742) (-4437.496) (-4435.932) [-4434.008] -- 0:06:10 519500 -- (-4440.178) (-4440.033) [-4429.908] (-4436.461) * (-4441.301) [-4435.409] (-4442.711) (-4438.762) -- 0:06:10 520000 -- (-4435.556) (-4438.883) (-4431.660) [-4442.452] * (-4433.282) (-4434.886) [-4443.056] (-4441.884) -- 0:06:10 Average standard deviation of split frequencies: 0.009830 520500 -- (-4435.829) [-4436.917] (-4433.201) (-4443.083) * (-4440.723) (-4444.084) (-4438.627) [-4431.565] -- 0:06:09 521000 -- (-4436.619) (-4440.849) [-4434.534] (-4449.838) * (-4434.277) (-4435.371) (-4441.885) [-4425.577] -- 0:06:09 521500 -- [-4430.613] (-4436.913) (-4440.622) (-4441.557) * (-4443.436) [-4439.237] (-4445.358) (-4436.417) -- 0:06:08 522000 -- (-4427.898) (-4432.803) [-4435.896] (-4439.486) * (-4434.226) (-4444.202) (-4441.464) [-4439.977] -- 0:06:08 522500 -- (-4430.671) [-4430.646] (-4444.851) (-4437.943) * (-4435.366) (-4445.950) [-4433.677] (-4433.627) -- 0:06:08 523000 -- (-4429.811) (-4436.032) (-4435.524) [-4434.180] * [-4435.131] (-4439.329) (-4436.255) (-4430.201) -- 0:06:07 523500 -- (-4433.677) (-4432.729) [-4430.080] (-4434.741) * (-4456.981) (-4442.100) (-4440.188) [-4436.106] -- 0:06:07 524000 -- (-4428.766) [-4432.078] (-4434.878) (-4439.796) * (-4447.000) (-4438.391) (-4432.443) [-4431.040] -- 0:06:06 524500 -- [-4444.182] (-4446.638) (-4441.328) (-4440.444) * [-4437.207] (-4440.436) (-4433.803) (-4435.250) -- 0:06:06 525000 -- (-4436.331) (-4434.473) (-4432.302) [-4432.175] * [-4437.542] (-4446.611) (-4439.952) (-4444.989) -- 0:06:06 Average standard deviation of split frequencies: 0.009602 525500 -- (-4436.951) (-4432.339) (-4433.784) [-4434.446] * (-4437.370) [-4430.439] (-4438.248) (-4433.050) -- 0:06:05 526000 -- (-4444.352) (-4436.563) (-4438.315) [-4437.370] * (-4434.489) [-4436.739] (-4442.251) (-4438.827) -- 0:06:04 526500 -- (-4445.702) (-4438.040) (-4435.413) [-4432.687] * (-4440.927) (-4433.105) [-4445.586] (-4449.748) -- 0:06:05 527000 -- (-4437.898) (-4448.110) [-4436.296] (-4438.519) * (-4447.316) (-4430.168) [-4433.916] (-4442.651) -- 0:06:04 527500 -- (-4430.622) [-4437.800] (-4449.395) (-4440.394) * (-4435.792) (-4432.477) [-4431.721] (-4437.924) -- 0:06:04 528000 -- [-4427.220] (-4444.872) (-4437.721) (-4441.265) * (-4430.633) (-4433.411) [-4429.586] (-4435.168) -- 0:06:03 528500 -- (-4439.244) [-4434.320] (-4454.682) (-4438.422) * (-4440.483) [-4435.622] (-4430.450) (-4433.055) -- 0:06:03 529000 -- (-4435.609) [-4434.893] (-4446.982) (-4444.026) * (-4453.018) (-4435.274) (-4432.394) [-4428.757] -- 0:06:03 529500 -- (-4444.187) (-4430.401) [-4442.256] (-4436.441) * (-4446.945) (-4439.998) (-4433.923) [-4432.740] -- 0:06:02 530000 -- (-4449.172) (-4435.818) (-4436.503) [-4441.950] * (-4445.298) (-4439.378) [-4428.171] (-4434.352) -- 0:06:02 Average standard deviation of split frequencies: 0.009391 530500 -- [-4434.507] (-4437.898) (-4446.340) (-4438.437) * (-4446.610) [-4435.491] (-4444.112) (-4438.331) -- 0:06:01 531000 -- (-4437.004) [-4437.372] (-4452.991) (-4442.952) * [-4438.054] (-4450.553) (-4447.146) (-4440.715) -- 0:06:01 531500 -- [-4432.089] (-4437.349) (-4435.682) (-4439.133) * [-4436.405] (-4438.637) (-4438.457) (-4439.344) -- 0:06:01 532000 -- (-4434.684) [-4433.280] (-4439.820) (-4439.293) * (-4432.096) [-4437.710] (-4434.228) (-4442.256) -- 0:06:00 532500 -- (-4435.852) (-4445.337) [-4434.231] (-4443.559) * [-4427.532] (-4440.127) (-4447.946) (-4437.436) -- 0:05:59 533000 -- (-4430.557) [-4431.609] (-4441.801) (-4439.345) * (-4430.142) [-4434.204] (-4440.272) (-4446.365) -- 0:06:00 533500 -- [-4432.471] (-4434.520) (-4441.516) (-4446.194) * (-4435.422) [-4435.806] (-4435.572) (-4435.346) -- 0:05:59 534000 -- (-4433.365) (-4435.248) [-4433.024] (-4439.958) * (-4441.495) (-4433.493) (-4443.934) [-4441.408] -- 0:05:59 534500 -- (-4440.867) (-4445.748) [-4429.941] (-4442.053) * (-4436.770) (-4439.591) (-4441.459) [-4438.103] -- 0:05:58 535000 -- [-4436.170] (-4432.409) (-4450.215) (-4437.727) * (-4434.173) (-4446.169) [-4441.051] (-4447.347) -- 0:05:58 Average standard deviation of split frequencies: 0.009612 535500 -- [-4438.236] (-4436.725) (-4439.749) (-4435.527) * [-4430.321] (-4443.211) (-4438.833) (-4439.468) -- 0:05:58 536000 -- (-4440.946) [-4435.567] (-4453.200) (-4434.446) * (-4435.531) (-4437.795) (-4434.222) [-4439.097] -- 0:05:57 536500 -- [-4438.904] (-4433.435) (-4449.291) (-4443.881) * (-4434.201) [-4439.155] (-4446.196) (-4448.848) -- 0:05:56 537000 -- (-4439.520) [-4437.082] (-4456.570) (-4437.122) * [-4435.519] (-4438.685) (-4437.549) (-4436.804) -- 0:05:56 537500 -- (-4428.947) (-4444.188) [-4440.273] (-4440.480) * [-4436.567] (-4431.445) (-4442.641) (-4444.988) -- 0:05:56 538000 -- [-4433.154] (-4435.424) (-4436.747) (-4438.191) * (-4443.730) (-4440.797) [-4436.908] (-4446.169) -- 0:05:56 538500 -- (-4436.513) (-4438.367) (-4438.071) [-4434.682] * [-4430.864] (-4437.965) (-4441.617) (-4431.808) -- 0:05:55 539000 -- [-4434.029] (-4437.188) (-4446.616) (-4436.727) * (-4440.609) (-4434.877) [-4431.873] (-4433.462) -- 0:05:54 539500 -- (-4452.111) (-4434.803) (-4442.944) [-4437.807] * (-4437.722) (-4442.159) (-4443.355) [-4434.736] -- 0:05:55 540000 -- (-4436.083) [-4433.073] (-4436.820) (-4442.874) * [-4429.759] (-4441.830) (-4445.769) (-4438.276) -- 0:05:54 Average standard deviation of split frequencies: 0.010400 540500 -- (-4434.629) [-4436.789] (-4441.701) (-4442.573) * (-4444.064) (-4444.923) [-4436.806] (-4437.649) -- 0:05:54 541000 -- [-4431.157] (-4437.896) (-4451.395) (-4448.202) * (-4436.083) (-4444.925) [-4440.806] (-4434.727) -- 0:05:53 541500 -- (-4432.944) (-4432.572) (-4438.977) [-4430.371] * [-4444.214] (-4435.559) (-4442.656) (-4438.072) -- 0:05:53 542000 -- (-4448.004) (-4435.517) (-4433.428) [-4426.648] * (-4443.189) [-4433.869] (-4435.074) (-4439.415) -- 0:05:53 542500 -- (-4440.913) [-4444.338] (-4436.889) (-4432.940) * (-4442.896) [-4433.543] (-4439.151) (-4443.370) -- 0:05:52 543000 -- (-4432.916) (-4448.199) [-4436.523] (-4434.653) * (-4450.821) (-4438.827) [-4433.830] (-4432.368) -- 0:05:51 543500 -- [-4433.117] (-4440.989) (-4442.861) (-4437.666) * (-4431.287) (-4433.394) [-4432.171] (-4459.952) -- 0:05:51 544000 -- (-4435.291) (-4436.425) (-4446.526) [-4433.026] * [-4435.694] (-4435.961) (-4439.121) (-4442.772) -- 0:05:51 544500 -- (-4437.889) (-4438.134) [-4441.179] (-4435.149) * (-4439.923) [-4444.736] (-4435.530) (-4447.193) -- 0:05:51 545000 -- [-4436.327] (-4451.528) (-4440.237) (-4435.755) * [-4427.583] (-4433.538) (-4434.025) (-4453.558) -- 0:05:50 Average standard deviation of split frequencies: 0.010422 545500 -- (-4443.122) (-4452.055) (-4439.253) [-4434.696] * [-4430.798] (-4442.173) (-4434.891) (-4438.783) -- 0:05:49 546000 -- (-4442.853) (-4441.962) [-4442.605] (-4438.273) * [-4436.516] (-4439.298) (-4436.474) (-4440.417) -- 0:05:50 546500 -- (-4442.317) (-4441.654) [-4434.175] (-4444.528) * (-4445.318) [-4442.571] (-4442.473) (-4444.144) -- 0:05:49 547000 -- (-4437.383) (-4453.525) [-4430.073] (-4444.521) * [-4437.420] (-4437.056) (-4444.432) (-4449.644) -- 0:05:48 547500 -- [-4427.798] (-4439.541) (-4436.263) (-4438.806) * [-4435.675] (-4439.079) (-4438.074) (-4441.373) -- 0:05:48 548000 -- (-4444.181) (-4438.328) [-4430.724] (-4440.627) * (-4437.548) (-4438.968) [-4440.987] (-4444.595) -- 0:05:48 548500 -- [-4432.018] (-4430.648) (-4438.528) (-4438.729) * [-4438.194] (-4435.561) (-4443.129) (-4438.585) -- 0:05:48 549000 -- [-4428.352] (-4441.005) (-4440.211) (-4428.565) * [-4441.459] (-4431.107) (-4442.679) (-4434.247) -- 0:05:47 549500 -- (-4432.463) (-4432.018) [-4438.214] (-4436.987) * (-4437.540) (-4438.502) (-4451.836) [-4428.642] -- 0:05:46 550000 -- [-4424.611] (-4433.259) (-4437.294) (-4438.602) * (-4437.303) (-4454.754) [-4434.778] (-4432.833) -- 0:05:46 Average standard deviation of split frequencies: 0.010456 550500 -- [-4428.667] (-4434.908) (-4437.020) (-4437.440) * (-4433.804) [-4440.743] (-4439.425) (-4440.172) -- 0:05:46 551000 -- [-4433.276] (-4435.898) (-4449.188) (-4437.321) * [-4437.101] (-4443.617) (-4431.349) (-4454.766) -- 0:05:46 551500 -- (-4437.486) (-4442.306) [-4432.901] (-4440.738) * (-4432.264) (-4443.775) (-4436.990) [-4447.518] -- 0:05:45 552000 -- (-4453.226) (-4441.348) [-4437.299] (-4444.538) * (-4437.711) (-4437.856) (-4437.379) [-4434.280] -- 0:05:44 552500 -- (-4437.792) [-4431.597] (-4433.683) (-4438.662) * [-4436.316] (-4435.302) (-4451.111) (-4436.039) -- 0:05:45 553000 -- (-4439.958) (-4439.582) [-4431.589] (-4440.534) * (-4439.688) [-4441.596] (-4442.146) (-4440.512) -- 0:05:44 553500 -- (-4432.460) (-4434.172) [-4436.234] (-4449.640) * (-4440.580) (-4436.652) (-4442.717) [-4434.190] -- 0:05:43 554000 -- [-4433.608] (-4436.176) (-4439.318) (-4432.251) * (-4442.585) [-4429.074] (-4445.717) (-4438.799) -- 0:05:43 554500 -- (-4434.529) (-4446.904) [-4430.504] (-4432.957) * (-4430.766) [-4438.518] (-4438.012) (-4441.825) -- 0:05:43 555000 -- (-4444.627) (-4446.035) [-4435.022] (-4433.555) * (-4434.949) (-4440.251) [-4440.727] (-4447.454) -- 0:05:43 Average standard deviation of split frequencies: 0.009932 555500 -- [-4431.948] (-4436.380) (-4431.390) (-4440.498) * (-4432.664) (-4437.849) [-4440.433] (-4445.808) -- 0:05:42 556000 -- (-4436.328) [-4434.304] (-4433.413) (-4434.719) * (-4435.776) (-4438.869) [-4433.866] (-4433.815) -- 0:05:41 556500 -- (-4435.611) (-4435.266) (-4438.803) [-4437.802] * (-4443.035) [-4438.284] (-4441.340) (-4441.723) -- 0:05:41 557000 -- (-4442.025) [-4439.400] (-4433.301) (-4438.060) * (-4445.833) (-4437.177) (-4429.119) [-4438.716] -- 0:05:41 557500 -- (-4440.056) (-4440.414) (-4439.613) [-4438.647] * [-4438.897] (-4438.312) (-4436.954) (-4440.554) -- 0:05:40 558000 -- (-4434.498) [-4441.098] (-4443.609) (-4444.984) * [-4437.627] (-4440.480) (-4438.993) (-4440.169) -- 0:05:40 558500 -- [-4435.994] (-4446.674) (-4441.920) (-4443.657) * (-4440.459) [-4434.702] (-4445.618) (-4441.324) -- 0:05:39 559000 -- [-4429.656] (-4449.888) (-4446.827) (-4441.898) * (-4433.206) (-4434.837) (-4438.116) [-4432.585] -- 0:05:40 559500 -- (-4434.884) (-4438.767) (-4444.390) [-4439.014] * (-4442.497) (-4434.343) [-4439.708] (-4437.348) -- 0:05:39 560000 -- (-4440.605) (-4441.324) [-4438.931] (-4457.310) * (-4432.054) (-4435.443) (-4436.015) [-4428.797] -- 0:05:38 Average standard deviation of split frequencies: 0.009369 560500 -- (-4434.375) (-4445.990) (-4443.616) [-4451.261] * [-4430.577] (-4442.923) (-4437.174) (-4432.784) -- 0:05:38 561000 -- (-4433.051) (-4435.876) [-4437.280] (-4455.212) * [-4431.711] (-4436.420) (-4439.262) (-4434.468) -- 0:05:38 561500 -- (-4452.243) [-4436.434] (-4441.781) (-4436.182) * (-4436.066) [-4433.788] (-4434.097) (-4447.703) -- 0:05:38 562000 -- (-4441.636) (-4438.299) (-4441.199) [-4435.036] * [-4436.905] (-4438.396) (-4436.790) (-4449.610) -- 0:05:37 562500 -- [-4436.821] (-4433.605) (-4443.339) (-4442.436) * (-4439.784) (-4438.568) [-4444.264] (-4442.584) -- 0:05:36 563000 -- (-4446.120) [-4436.638] (-4436.607) (-4445.442) * (-4440.498) (-4435.526) (-4442.876) [-4440.585] -- 0:05:36 563500 -- (-4439.932) (-4438.871) (-4436.383) [-4440.162] * (-4439.190) (-4434.859) [-4439.573] (-4434.070) -- 0:05:36 564000 -- [-4436.235] (-4440.256) (-4443.162) (-4439.940) * (-4437.039) [-4429.076] (-4435.380) (-4442.603) -- 0:05:35 564500 -- (-4432.605) [-4439.708] (-4437.183) (-4444.905) * (-4443.115) (-4435.193) [-4430.097] (-4436.419) -- 0:05:35 565000 -- (-4437.592) [-4437.870] (-4438.978) (-4452.377) * (-4434.455) (-4433.608) [-4427.314] (-4446.162) -- 0:05:34 Average standard deviation of split frequencies: 0.009578 565500 -- (-4441.726) [-4437.258] (-4438.055) (-4445.921) * (-4444.071) (-4437.005) [-4433.470] (-4437.610) -- 0:05:34 566000 -- (-4435.132) (-4440.004) (-4436.021) [-4443.591] * (-4436.628) (-4433.397) (-4430.476) [-4442.670] -- 0:05:34 566500 -- (-4443.046) (-4441.613) (-4432.750) [-4435.785] * (-4433.815) [-4437.371] (-4444.803) (-4442.104) -- 0:05:33 567000 -- (-4433.930) (-4434.729) [-4433.270] (-4436.671) * (-4442.575) (-4434.778) [-4437.148] (-4443.606) -- 0:05:33 567500 -- (-4436.756) (-4431.492) [-4436.304] (-4445.953) * [-4439.796] (-4436.493) (-4437.857) (-4450.014) -- 0:05:33 568000 -- (-4441.114) (-4436.480) [-4431.442] (-4436.464) * (-4440.395) [-4432.577] (-4439.986) (-4441.842) -- 0:05:33 568500 -- (-4443.198) (-4455.581) (-4431.555) [-4438.525] * [-4446.073] (-4443.736) (-4430.720) (-4439.841) -- 0:05:32 569000 -- (-4438.509) [-4435.332] (-4442.958) (-4437.042) * (-4443.959) (-4432.949) [-4432.835] (-4439.080) -- 0:05:31 569500 -- (-4444.414) (-4441.780) [-4435.476] (-4440.560) * [-4443.428] (-4429.379) (-4439.313) (-4436.100) -- 0:05:31 570000 -- (-4429.960) (-4442.774) (-4437.590) [-4443.002] * (-4436.811) [-4432.134] (-4439.803) (-4443.109) -- 0:05:31 Average standard deviation of split frequencies: 0.009677 570500 -- [-4431.802] (-4438.760) (-4443.842) (-4436.725) * (-4437.911) [-4442.914] (-4434.189) (-4445.101) -- 0:05:30 571000 -- [-4433.935] (-4438.623) (-4451.109) (-4441.841) * (-4436.850) (-4442.512) (-4433.953) [-4445.313] -- 0:05:30 571500 -- (-4440.417) [-4439.692] (-4441.975) (-4438.875) * (-4438.672) [-4437.217] (-4438.636) (-4446.200) -- 0:05:29 572000 -- [-4435.854] (-4432.409) (-4446.327) (-4442.413) * (-4429.790) (-4435.296) (-4436.851) [-4439.621] -- 0:05:29 572500 -- (-4449.662) [-4434.620] (-4441.345) (-4434.004) * (-4453.497) (-4448.771) (-4439.637) [-4436.724] -- 0:05:29 573000 -- (-4442.998) (-4434.733) [-4438.212] (-4437.176) * [-4432.627] (-4439.137) (-4444.342) (-4447.330) -- 0:05:28 573500 -- [-4440.096] (-4439.040) (-4444.538) (-4440.767) * (-4439.901) (-4438.807) (-4447.659) [-4438.738] -- 0:05:28 574000 -- [-4428.389] (-4440.920) (-4441.514) (-4435.144) * (-4430.834) (-4440.885) [-4433.383] (-4440.058) -- 0:05:28 574500 -- (-4436.191) (-4441.048) [-4443.662] (-4437.002) * (-4446.118) (-4432.580) (-4434.896) [-4438.679] -- 0:05:27 575000 -- (-4449.795) [-4439.388] (-4448.669) (-4436.239) * (-4456.404) (-4441.008) [-4445.908] (-4438.994) -- 0:05:27 Average standard deviation of split frequencies: 0.009470 575500 -- (-4450.194) (-4439.965) [-4435.524] (-4443.508) * (-4437.243) (-4450.146) (-4430.527) [-4433.906] -- 0:05:26 576000 -- (-4440.652) [-4436.814] (-4441.081) (-4455.773) * (-4437.183) (-4442.826) (-4435.444) [-4437.108] -- 0:05:26 576500 -- (-4445.203) (-4433.736) (-4444.637) [-4446.542] * (-4434.625) [-4432.471] (-4448.595) (-4433.543) -- 0:05:26 577000 -- [-4434.944] (-4434.961) (-4452.256) (-4442.166) * (-4433.118) [-4439.022] (-4447.885) (-4449.850) -- 0:05:25 577500 -- (-4433.244) (-4435.436) [-4445.624] (-4438.442) * [-4429.381] (-4431.720) (-4451.732) (-4446.052) -- 0:05:25 578000 -- (-4437.236) [-4440.033] (-4444.854) (-4441.995) * (-4437.752) (-4447.771) [-4426.906] (-4435.312) -- 0:05:24 578500 -- [-4434.486] (-4440.261) (-4431.230) (-4437.085) * (-4448.046) (-4437.024) [-4436.114] (-4436.056) -- 0:05:24 579000 -- (-4439.284) (-4435.368) [-4437.832] (-4439.811) * (-4441.236) (-4442.203) (-4449.133) [-4434.089] -- 0:05:24 579500 -- (-4440.650) (-4439.604) [-4435.820] (-4433.871) * (-4438.257) (-4439.595) (-4442.824) [-4429.695] -- 0:05:23 580000 -- [-4430.054] (-4430.466) (-4442.136) (-4434.716) * (-4436.357) [-4437.052] (-4435.435) (-4441.340) -- 0:05:23 Average standard deviation of split frequencies: 0.009278 580500 -- (-4432.707) [-4432.739] (-4443.482) (-4437.779) * [-4433.642] (-4440.142) (-4433.602) (-4440.219) -- 0:05:23 581000 -- (-4438.586) [-4435.597] (-4436.837) (-4433.641) * (-4436.307) [-4436.153] (-4437.170) (-4442.070) -- 0:05:22 581500 -- [-4433.617] (-4432.731) (-4440.060) (-4432.865) * (-4437.450) [-4437.262] (-4438.330) (-4447.385) -- 0:05:22 582000 -- (-4437.968) (-4443.896) (-4441.686) [-4434.595] * (-4443.309) [-4432.826] (-4448.196) (-4442.266) -- 0:05:21 582500 -- (-4434.614) [-4433.404] (-4440.522) (-4436.247) * (-4430.311) (-4431.750) [-4434.932] (-4432.148) -- 0:05:21 583000 -- (-4435.065) (-4443.191) [-4434.528] (-4440.915) * (-4447.159) (-4446.416) (-4440.812) [-4429.048] -- 0:05:21 583500 -- (-4434.217) (-4439.404) (-4437.938) [-4431.522] * [-4445.714] (-4432.588) (-4434.185) (-4439.561) -- 0:05:20 584000 -- (-4436.108) (-4443.277) (-4441.982) [-4435.053] * (-4432.340) (-4438.385) [-4428.358] (-4436.996) -- 0:05:20 584500 -- (-4437.591) (-4434.842) [-4441.343] (-4435.533) * [-4433.833] (-4433.892) (-4439.511) (-4441.717) -- 0:05:19 585000 -- (-4431.866) [-4437.939] (-4439.601) (-4438.765) * (-4437.164) (-4440.311) (-4439.317) [-4441.635] -- 0:05:19 Average standard deviation of split frequencies: 0.009768 585500 -- [-4439.033] (-4438.344) (-4438.128) (-4436.498) * (-4433.138) (-4442.288) [-4440.144] (-4436.696) -- 0:05:19 586000 -- (-4433.072) (-4440.129) [-4435.116] (-4446.103) * (-4435.787) (-4444.421) [-4430.634] (-4438.974) -- 0:05:18 586500 -- (-4438.337) (-4445.064) [-4429.256] (-4440.240) * [-4433.154] (-4443.294) (-4436.110) (-4442.751) -- 0:05:18 587000 -- [-4440.658] (-4442.120) (-4435.397) (-4436.467) * (-4438.288) (-4434.758) [-4438.535] (-4439.214) -- 0:05:18 587500 -- (-4432.519) (-4443.164) (-4439.109) [-4433.895] * [-4435.424] (-4433.454) (-4440.115) (-4432.505) -- 0:05:17 588000 -- (-4438.438) (-4434.665) (-4442.159) [-4437.193] * (-4438.989) (-4432.666) [-4435.559] (-4443.104) -- 0:05:17 588500 -- (-4436.475) (-4437.684) [-4435.065] (-4436.168) * [-4436.735] (-4434.623) (-4449.824) (-4449.105) -- 0:05:16 589000 -- (-4440.988) (-4443.323) [-4436.097] (-4432.613) * (-4435.213) [-4431.540] (-4435.185) (-4444.883) -- 0:05:16 589500 -- (-4439.828) (-4442.461) (-4432.377) [-4434.326] * [-4436.682] (-4439.331) (-4433.152) (-4437.966) -- 0:05:16 590000 -- (-4442.970) [-4436.472] (-4438.636) (-4442.020) * (-4451.733) (-4438.137) [-4433.451] (-4454.691) -- 0:05:15 Average standard deviation of split frequencies: 0.009406 590500 -- (-4439.535) (-4439.552) [-4430.803] (-4440.976) * (-4452.513) (-4433.139) [-4433.758] (-4448.105) -- 0:05:15 591000 -- (-4434.766) [-4435.493] (-4441.996) (-4442.018) * [-4440.509] (-4433.565) (-4436.230) (-4440.981) -- 0:05:14 591500 -- [-4436.397] (-4429.601) (-4440.352) (-4436.115) * [-4433.809] (-4428.780) (-4435.799) (-4438.667) -- 0:05:14 592000 -- (-4444.210) (-4429.253) [-4439.947] (-4447.891) * (-4440.957) [-4432.281] (-4438.290) (-4439.012) -- 0:05:14 592500 -- (-4439.950) (-4433.644) (-4435.826) [-4440.996] * (-4437.416) [-4429.188] (-4436.091) (-4435.153) -- 0:05:13 593000 -- (-4444.150) (-4438.830) [-4430.839] (-4434.907) * [-4446.686] (-4434.991) (-4440.422) (-4436.024) -- 0:05:13 593500 -- [-4434.446] (-4440.613) (-4436.334) (-4431.821) * [-4436.583] (-4432.105) (-4444.803) (-4438.746) -- 0:05:13 594000 -- (-4433.537) [-4435.629] (-4435.266) (-4437.152) * (-4442.670) [-4430.794] (-4438.549) (-4438.125) -- 0:05:12 594500 -- (-4432.834) [-4430.610] (-4439.914) (-4452.737) * (-4446.189) (-4431.502) (-4438.185) [-4443.016] -- 0:05:12 595000 -- (-4443.523) (-4430.674) (-4444.728) [-4431.823] * (-4435.629) [-4433.156] (-4444.867) (-4444.248) -- 0:05:11 Average standard deviation of split frequencies: 0.009830 595500 -- (-4438.286) [-4440.156] (-4444.968) (-4438.611) * (-4440.208) [-4430.585] (-4437.081) (-4441.148) -- 0:05:11 596000 -- (-4441.934) (-4435.485) (-4446.952) [-4432.109] * [-4441.937] (-4434.365) (-4439.618) (-4436.567) -- 0:05:11 596500 -- [-4436.933] (-4434.655) (-4448.774) (-4441.446) * [-4436.419] (-4435.265) (-4440.452) (-4453.077) -- 0:05:11 597000 -- (-4438.029) [-4431.376] (-4436.250) (-4442.142) * (-4437.872) [-4441.423] (-4443.046) (-4447.759) -- 0:05:10 597500 -- (-4441.236) (-4429.009) (-4438.879) [-4436.595] * [-4434.632] (-4440.686) (-4441.522) (-4444.178) -- 0:05:09 598000 -- [-4436.241] (-4441.991) (-4443.778) (-4429.411) * [-4442.628] (-4449.145) (-4445.201) (-4434.001) -- 0:05:09 598500 -- (-4431.698) (-4445.100) (-4449.237) [-4435.375] * [-4437.525] (-4438.742) (-4440.803) (-4440.740) -- 0:05:09 599000 -- (-4434.490) [-4432.241] (-4439.467) (-4438.305) * [-4435.837] (-4443.703) (-4438.102) (-4432.253) -- 0:05:08 599500 -- (-4438.114) (-4434.125) [-4437.172] (-4440.358) * (-4436.651) (-4437.904) (-4440.103) [-4450.023] -- 0:05:08 600000 -- (-4440.611) [-4434.025] (-4450.950) (-4436.907) * (-4431.163) (-4435.623) [-4439.716] (-4438.423) -- 0:05:08 Average standard deviation of split frequencies: 0.009698 600500 -- (-4442.262) [-4435.247] (-4439.250) (-4434.202) * (-4440.033) (-4439.893) [-4444.702] (-4437.285) -- 0:05:08 601000 -- (-4448.747) [-4435.732] (-4438.723) (-4448.232) * (-4442.308) (-4438.059) [-4430.496] (-4439.228) -- 0:05:07 601500 -- (-4443.406) [-4434.524] (-4432.808) (-4433.757) * (-4444.449) (-4441.261) [-4429.744] (-4437.086) -- 0:05:06 602000 -- (-4447.022) (-4436.320) (-4435.556) [-4439.491] * (-4433.721) (-4436.417) [-4431.612] (-4443.202) -- 0:05:06 602500 -- (-4435.022) (-4434.933) [-4429.599] (-4448.090) * (-4443.372) (-4430.936) (-4448.153) [-4439.665] -- 0:05:06 603000 -- [-4432.070] (-4433.325) (-4438.837) (-4436.502) * (-4445.490) (-4439.865) (-4442.786) [-4436.752] -- 0:05:06 603500 -- (-4440.431) [-4436.616] (-4443.265) (-4438.728) * (-4442.843) (-4430.782) (-4443.587) [-4433.821] -- 0:05:05 604000 -- (-4436.063) (-4436.063) [-4443.489] (-4440.883) * (-4443.247) [-4440.220] (-4454.635) (-4432.013) -- 0:05:04 604500 -- [-4430.952] (-4438.322) (-4445.553) (-4437.584) * (-4441.749) [-4432.120] (-4450.192) (-4433.520) -- 0:05:04 605000 -- [-4442.149] (-4451.903) (-4434.485) (-4433.580) * (-4441.866) (-4436.755) (-4435.656) [-4436.280] -- 0:05:04 Average standard deviation of split frequencies: 0.009335 605500 -- [-4433.593] (-4441.993) (-4443.506) (-4432.262) * (-4439.504) (-4436.543) (-4429.543) [-4435.338] -- 0:05:03 606000 -- (-4435.937) (-4446.191) (-4439.606) [-4440.706] * (-4436.097) (-4431.441) [-4431.942] (-4431.894) -- 0:05:03 606500 -- (-4439.281) (-4450.613) [-4440.027] (-4447.150) * (-4441.257) [-4439.046] (-4435.273) (-4442.035) -- 0:05:02 607000 -- [-4433.732] (-4442.625) (-4440.797) (-4436.804) * (-4433.653) (-4435.759) (-4437.470) [-4436.010] -- 0:05:03 607500 -- (-4446.310) (-4447.762) [-4434.054] (-4430.188) * (-4446.655) [-4434.364] (-4435.963) (-4429.697) -- 0:05:02 608000 -- (-4436.229) [-4439.206] (-4450.483) (-4436.067) * (-4450.298) (-4444.868) (-4436.772) [-4429.949] -- 0:05:01 608500 -- (-4443.718) (-4434.616) (-4429.065) [-4438.665] * [-4439.222] (-4447.721) (-4431.304) (-4437.517) -- 0:05:01 609000 -- (-4436.989) [-4430.846] (-4434.192) (-4444.278) * (-4452.092) [-4440.419] (-4435.571) (-4441.586) -- 0:05:01 609500 -- [-4438.212] (-4435.879) (-4442.020) (-4437.777) * [-4433.820] (-4436.684) (-4432.455) (-4442.067) -- 0:05:00 610000 -- (-4443.129) (-4438.682) (-4438.273) [-4434.063] * (-4437.366) (-4438.548) [-4439.203] (-4440.064) -- 0:05:00 Average standard deviation of split frequencies: 0.009098 610500 -- (-4440.693) [-4432.677] (-4446.114) (-4441.806) * [-4432.018] (-4436.070) (-4443.219) (-4439.175) -- 0:04:59 611000 -- (-4437.638) (-4435.695) (-4438.151) [-4436.790] * (-4435.965) (-4434.782) [-4435.935] (-4438.770) -- 0:04:59 611500 -- [-4431.697] (-4449.946) (-4441.579) (-4435.827) * (-4437.508) (-4435.907) (-4436.784) [-4436.977] -- 0:04:59 612000 -- (-4447.196) (-4438.855) (-4448.665) [-4436.920] * [-4442.222] (-4435.152) (-4445.472) (-4431.817) -- 0:04:58 612500 -- (-4434.605) [-4433.884] (-4446.988) (-4446.682) * (-4438.353) [-4439.257] (-4441.636) (-4439.015) -- 0:04:58 613000 -- (-4444.755) [-4435.026] (-4443.532) (-4448.844) * [-4440.944] (-4439.055) (-4437.885) (-4437.864) -- 0:04:57 613500 -- (-4440.136) [-4444.769] (-4441.004) (-4439.336) * (-4440.300) (-4436.862) [-4436.759] (-4444.911) -- 0:04:57 614000 -- (-4449.268) (-4434.949) (-4439.171) [-4438.288] * (-4440.506) (-4444.867) (-4436.747) [-4434.079] -- 0:04:57 614500 -- (-4446.206) (-4444.648) [-4436.984] (-4442.938) * (-4438.589) (-4443.011) [-4438.073] (-4434.781) -- 0:04:56 615000 -- (-4445.765) (-4445.445) [-4433.876] (-4437.711) * (-4442.729) (-4446.968) (-4441.882) [-4435.581] -- 0:04:56 Average standard deviation of split frequencies: 0.008801 615500 -- (-4444.207) [-4438.804] (-4436.071) (-4440.701) * (-4439.831) (-4447.112) (-4439.435) [-4429.826] -- 0:04:56 616000 -- [-4440.766] (-4433.625) (-4442.560) (-4443.910) * (-4436.741) (-4437.313) (-4443.609) [-4439.962] -- 0:04:55 616500 -- (-4444.628) (-4442.519) (-4435.281) [-4435.436] * (-4436.679) [-4440.923] (-4439.309) (-4431.258) -- 0:04:55 617000 -- (-4432.780) (-4439.947) (-4435.917) [-4430.969] * (-4443.403) (-4440.554) (-4444.571) [-4430.081] -- 0:04:54 617500 -- (-4437.465) (-4433.008) (-4447.597) [-4434.358] * (-4445.931) [-4437.704] (-4439.335) (-4432.674) -- 0:04:54 618000 -- (-4445.074) [-4434.042] (-4443.166) (-4431.941) * (-4432.486) [-4443.321] (-4439.654) (-4439.890) -- 0:04:54 618500 -- (-4436.667) (-4444.278) (-4439.608) [-4438.911] * (-4440.034) [-4440.246] (-4442.153) (-4444.582) -- 0:04:53 619000 -- (-4441.470) [-4429.760] (-4437.976) (-4442.644) * [-4441.779] (-4441.255) (-4437.106) (-4436.811) -- 0:04:53 619500 -- (-4441.061) [-4442.095] (-4443.371) (-4440.228) * (-4444.209) (-4438.250) [-4435.392] (-4435.216) -- 0:04:52 620000 -- (-4448.090) [-4441.539] (-4441.891) (-4434.364) * (-4435.077) (-4443.389) [-4437.645] (-4426.292) -- 0:04:52 Average standard deviation of split frequencies: 0.009223 620500 -- (-4447.664) (-4435.756) [-4438.130] (-4435.336) * (-4435.420) (-4439.457) [-4428.886] (-4443.188) -- 0:04:52 621000 -- (-4442.816) [-4435.580] (-4440.235) (-4437.261) * (-4436.294) [-4437.710] (-4439.889) (-4434.603) -- 0:04:51 621500 -- (-4443.150) (-4440.368) [-4434.063] (-4447.706) * (-4442.632) [-4439.358] (-4448.989) (-4434.682) -- 0:04:51 622000 -- (-4436.852) (-4441.837) (-4441.999) [-4437.201] * [-4433.542] (-4435.335) (-4442.984) (-4428.107) -- 0:04:51 622500 -- (-4431.340) (-4438.538) [-4436.601] (-4445.277) * (-4442.239) [-4438.323] (-4447.076) (-4435.682) -- 0:04:50 623000 -- (-4433.465) (-4435.964) (-4431.536) [-4434.204] * [-4437.427] (-4435.190) (-4434.946) (-4439.013) -- 0:04:50 623500 -- [-4432.280] (-4437.975) (-4438.337) (-4441.236) * (-4436.345) (-4429.398) [-4437.526] (-4446.745) -- 0:04:49 624000 -- [-4434.883] (-4433.008) (-4433.869) (-4448.700) * (-4438.510) (-4436.211) [-4430.852] (-4458.889) -- 0:04:49 624500 -- (-4433.745) (-4435.616) (-4436.909) [-4443.686] * (-4451.794) (-4440.533) [-4446.249] (-4443.813) -- 0:04:49 625000 -- (-4441.959) [-4438.031] (-4438.434) (-4444.380) * [-4435.936] (-4446.026) (-4438.839) (-4441.050) -- 0:04:48 Average standard deviation of split frequencies: 0.008552 625500 -- [-4442.473] (-4433.706) (-4447.436) (-4434.898) * (-4438.978) (-4435.887) (-4431.172) [-4438.270] -- 0:04:48 626000 -- (-4452.789) (-4436.855) [-4437.587] (-4436.369) * (-4434.175) (-4432.908) (-4437.738) [-4443.749] -- 0:04:47 626500 -- (-4440.805) (-4430.329) (-4443.123) [-4433.502] * (-4433.817) (-4438.380) [-4436.919] (-4442.352) -- 0:04:47 627000 -- [-4441.162] (-4433.367) (-4437.792) (-4442.921) * [-4439.288] (-4429.504) (-4435.766) (-4447.200) -- 0:04:47 627500 -- [-4432.090] (-4440.070) (-4444.097) (-4445.952) * (-4437.462) [-4430.544] (-4432.576) (-4445.004) -- 0:04:46 628000 -- (-4434.791) (-4438.545) (-4446.200) [-4438.818] * (-4431.855) (-4439.867) [-4439.859] (-4440.926) -- 0:04:46 628500 -- [-4434.021] (-4434.304) (-4437.930) (-4436.013) * (-4440.254) (-4436.739) [-4434.524] (-4441.158) -- 0:04:46 629000 -- (-4450.292) (-4440.428) [-4443.549] (-4439.601) * (-4437.373) [-4433.373] (-4444.663) (-4438.982) -- 0:04:45 629500 -- (-4438.593) (-4433.961) [-4440.442] (-4434.126) * (-4444.731) (-4436.702) (-4437.911) [-4438.739] -- 0:04:45 630000 -- [-4439.365] (-4450.535) (-4447.629) (-4446.635) * (-4436.900) [-4435.592] (-4447.434) (-4430.800) -- 0:04:44 Average standard deviation of split frequencies: 0.008329 630500 -- (-4434.041) (-4442.088) (-4448.643) [-4434.427] * (-4438.642) [-4439.501] (-4445.286) (-4450.126) -- 0:04:44 631000 -- (-4437.087) (-4447.512) [-4437.707] (-4444.074) * (-4435.148) [-4432.717] (-4438.161) (-4442.477) -- 0:04:44 631500 -- [-4435.080] (-4436.629) (-4438.560) (-4430.629) * (-4440.485) (-4437.859) [-4445.486] (-4432.810) -- 0:04:43 632000 -- [-4439.770] (-4444.342) (-4443.474) (-4437.460) * (-4445.305) (-4437.540) [-4441.007] (-4440.781) -- 0:04:43 632500 -- (-4439.147) (-4443.060) (-4448.184) [-4436.912] * [-4438.284] (-4432.196) (-4439.717) (-4436.240) -- 0:04:42 633000 -- (-4439.562) (-4436.259) [-4428.982] (-4438.918) * (-4434.227) [-4431.745] (-4434.107) (-4431.628) -- 0:04:42 633500 -- (-4438.040) (-4437.224) [-4433.482] (-4446.054) * [-4439.441] (-4437.981) (-4432.594) (-4448.257) -- 0:04:42 634000 -- (-4442.716) (-4434.643) [-4435.494] (-4449.496) * (-4441.312) (-4431.983) (-4435.577) [-4435.281] -- 0:04:41 634500 -- [-4436.436] (-4442.150) (-4435.361) (-4442.236) * (-4438.700) [-4432.230] (-4432.971) (-4436.757) -- 0:04:41 635000 -- (-4432.875) (-4437.068) (-4433.116) [-4433.733] * (-4448.658) (-4433.006) [-4441.555] (-4438.539) -- 0:04:41 Average standard deviation of split frequencies: 0.008153 635500 -- [-4439.181] (-4439.223) (-4441.122) (-4435.909) * (-4444.216) [-4431.006] (-4447.917) (-4433.811) -- 0:04:40 636000 -- (-4440.585) [-4432.600] (-4434.084) (-4441.954) * [-4434.128] (-4436.175) (-4438.075) (-4436.448) -- 0:04:40 636500 -- (-4440.038) [-4431.510] (-4435.392) (-4436.052) * (-4435.506) [-4432.606] (-4445.341) (-4440.191) -- 0:04:39 637000 -- (-4439.670) [-4432.571] (-4429.421) (-4439.553) * (-4432.823) (-4446.082) (-4436.094) [-4433.315] -- 0:04:39 637500 -- (-4440.641) (-4431.647) [-4439.796] (-4460.603) * [-4431.080] (-4449.385) (-4458.951) (-4433.667) -- 0:04:39 638000 -- (-4442.275) (-4431.088) [-4436.341] (-4441.975) * (-4432.635) (-4439.354) [-4437.089] (-4440.233) -- 0:04:38 638500 -- (-4436.785) (-4434.975) [-4437.940] (-4433.736) * [-4437.871] (-4434.774) (-4448.880) (-4441.935) -- 0:04:38 639000 -- (-4438.744) (-4436.256) [-4437.936] (-4441.967) * (-4443.403) (-4437.925) (-4445.415) [-4433.369] -- 0:04:37 639500 -- [-4437.535] (-4437.841) (-4434.456) (-4450.324) * [-4435.533] (-4445.185) (-4445.842) (-4441.207) -- 0:04:37 640000 -- (-4431.975) (-4437.705) [-4443.666] (-4446.983) * (-4443.085) (-4436.571) (-4441.035) [-4439.505] -- 0:04:37 Average standard deviation of split frequencies: 0.008041 640500 -- [-4436.241] (-4430.494) (-4437.317) (-4445.925) * (-4431.378) [-4438.025] (-4443.735) (-4447.948) -- 0:04:36 641000 -- [-4436.985] (-4440.882) (-4431.441) (-4430.285) * (-4438.096) (-4439.014) [-4437.436] (-4450.934) -- 0:04:36 641500 -- (-4432.235) (-4443.245) (-4451.133) [-4439.746] * (-4437.625) (-4432.364) [-4436.626] (-4446.095) -- 0:04:36 642000 -- (-4433.350) [-4439.931] (-4444.608) (-4441.682) * [-4431.182] (-4432.878) (-4441.239) (-4447.094) -- 0:04:35 642500 -- [-4433.442] (-4439.612) (-4431.760) (-4438.892) * (-4441.133) [-4437.198] (-4443.459) (-4439.980) -- 0:04:35 643000 -- [-4429.750] (-4437.574) (-4431.966) (-4439.500) * [-4444.766] (-4435.682) (-4447.176) (-4439.888) -- 0:04:34 643500 -- (-4442.005) (-4434.977) [-4432.191] (-4447.224) * (-4439.503) (-4433.933) (-4443.818) [-4429.375] -- 0:04:34 644000 -- (-4439.994) (-4434.066) [-4438.067] (-4439.989) * [-4436.905] (-4438.709) (-4438.962) (-4429.703) -- 0:04:34 644500 -- (-4440.615) [-4435.891] (-4446.017) (-4433.330) * (-4433.762) (-4442.990) (-4434.312) [-4435.906] -- 0:04:33 645000 -- (-4437.098) (-4437.903) [-4435.792] (-4441.232) * (-4439.578) (-4451.921) (-4439.469) [-4432.377] -- 0:04:33 Average standard deviation of split frequencies: 0.007819 645500 -- (-4439.102) (-4442.844) [-4440.377] (-4435.702) * (-4448.847) [-4439.641] (-4430.136) (-4445.288) -- 0:04:32 646000 -- (-4448.281) (-4433.545) [-4437.228] (-4436.411) * (-4436.845) (-4433.567) [-4429.888] (-4442.717) -- 0:04:32 646500 -- [-4431.965] (-4441.431) (-4451.248) (-4443.094) * (-4438.005) (-4432.355) (-4429.317) [-4434.574] -- 0:04:32 647000 -- (-4440.076) (-4434.186) [-4442.501] (-4435.357) * (-4434.923) (-4434.164) [-4437.678] (-4437.915) -- 0:04:31 647500 -- (-4440.890) (-4443.440) (-4437.746) [-4435.353] * (-4442.628) [-4429.223] (-4438.370) (-4441.249) -- 0:04:31 648000 -- [-4439.419] (-4440.549) (-4442.263) (-4435.593) * (-4443.906) (-4435.129) [-4443.348] (-4448.060) -- 0:04:31 648500 -- (-4442.100) (-4445.187) [-4436.509] (-4438.049) * (-4449.655) [-4428.621] (-4439.286) (-4436.191) -- 0:04:30 649000 -- [-4437.792] (-4450.363) (-4439.492) (-4434.958) * (-4446.595) [-4433.479] (-4450.371) (-4437.090) -- 0:04:30 649500 -- (-4448.034) (-4439.491) (-4444.989) [-4434.830] * (-4442.814) (-4432.187) (-4447.264) [-4435.445] -- 0:04:29 650000 -- (-4443.551) [-4434.665] (-4450.121) (-4434.256) * (-4443.274) [-4429.708] (-4434.088) (-4447.721) -- 0:04:29 Average standard deviation of split frequencies: 0.007866 650500 -- [-4434.998] (-4432.246) (-4440.445) (-4433.610) * [-4440.769] (-4432.181) (-4435.798) (-4441.668) -- 0:04:29 651000 -- (-4440.909) (-4448.293) (-4436.152) [-4440.685] * (-4441.850) (-4436.941) [-4433.366] (-4446.765) -- 0:04:28 651500 -- (-4433.975) (-4442.594) (-4453.115) [-4431.447] * (-4438.120) (-4445.346) (-4437.091) [-4437.474] -- 0:04:27 652000 -- [-4439.836] (-4435.525) (-4448.101) (-4434.456) * (-4438.100) [-4437.074] (-4430.010) (-4434.816) -- 0:04:27 652500 -- (-4430.492) (-4447.689) (-4435.796) [-4447.689] * [-4435.511] (-4440.324) (-4434.158) (-4435.417) -- 0:04:27 653000 -- (-4435.087) (-4455.573) [-4433.431] (-4441.313) * (-4439.111) [-4446.848] (-4436.004) (-4443.070) -- 0:04:27 653500 -- (-4431.435) (-4443.690) (-4439.077) [-4438.754] * (-4438.620) (-4434.625) (-4432.823) [-4438.160] -- 0:04:26 654000 -- [-4428.065] (-4446.424) (-4435.250) (-4446.024) * (-4433.755) (-4437.386) (-4444.229) [-4439.876] -- 0:04:26 654500 -- (-4434.217) (-4444.322) [-4432.895] (-4442.873) * (-4441.786) (-4442.885) (-4432.090) [-4440.855] -- 0:04:26 655000 -- (-4443.145) [-4431.449] (-4439.562) (-4439.265) * (-4438.607) (-4439.880) [-4435.153] (-4449.128) -- 0:04:25 Average standard deviation of split frequencies: 0.008418 655500 -- (-4438.671) (-4430.703) (-4451.198) [-4447.918] * (-4439.021) (-4442.198) (-4445.572) [-4439.634] -- 0:04:25 656000 -- (-4435.948) [-4442.534] (-4434.715) (-4436.411) * [-4440.167] (-4440.663) (-4440.660) (-4437.079) -- 0:04:24 656500 -- (-4445.088) (-4441.061) (-4438.037) [-4429.323] * (-4443.980) (-4434.216) (-4439.625) [-4433.594] -- 0:04:24 657000 -- (-4439.100) (-4437.575) (-4439.130) [-4429.211] * (-4440.910) (-4436.787) [-4440.290] (-4439.514) -- 0:04:24 657500 -- (-4437.459) (-4441.561) (-4438.196) [-4442.063] * (-4442.689) [-4428.471] (-4438.469) (-4435.688) -- 0:04:23 658000 -- (-4435.190) (-4440.580) (-4442.746) [-4448.442] * (-4438.833) (-4436.045) (-4446.160) [-4436.444] -- 0:04:22 658500 -- [-4433.812] (-4433.797) (-4450.685) (-4438.456) * (-4442.414) [-4438.942] (-4436.495) (-4438.267) -- 0:04:22 659000 -- [-4432.847] (-4435.059) (-4440.114) (-4427.709) * (-4437.959) [-4431.468] (-4441.669) (-4432.037) -- 0:04:22 659500 -- (-4438.866) (-4442.727) [-4434.641] (-4433.153) * (-4444.891) (-4440.635) (-4440.969) [-4438.054] -- 0:04:22 660000 -- (-4432.359) (-4436.705) (-4433.789) [-4431.311] * [-4441.700] (-4438.072) (-4437.369) (-4442.140) -- 0:04:21 Average standard deviation of split frequencies: 0.008664 660500 -- (-4441.221) (-4436.896) [-4433.103] (-4433.389) * (-4441.094) (-4437.568) (-4445.292) [-4435.693] -- 0:04:21 661000 -- (-4448.235) (-4433.130) [-4436.581] (-4434.770) * (-4435.469) [-4441.154] (-4444.144) (-4441.887) -- 0:04:21 661500 -- [-4439.668] (-4429.136) (-4442.037) (-4437.844) * [-4431.272] (-4433.066) (-4435.923) (-4433.868) -- 0:04:20 662000 -- (-4435.198) (-4436.768) [-4434.142] (-4436.245) * (-4435.426) [-4441.816] (-4442.944) (-4430.372) -- 0:04:19 662500 -- (-4430.855) (-4439.630) (-4432.935) [-4439.717] * (-4443.410) (-4438.892) [-4431.541] (-4431.643) -- 0:04:19 663000 -- [-4434.381] (-4437.058) (-4439.494) (-4434.516) * [-4440.397] (-4438.573) (-4436.558) (-4438.614) -- 0:04:19 663500 -- (-4436.281) (-4441.024) (-4444.120) [-4433.394] * (-4432.934) [-4441.524] (-4437.854) (-4442.863) -- 0:04:19 664000 -- (-4439.423) [-4450.419] (-4440.253) (-4443.635) * [-4437.428] (-4438.464) (-4435.996) (-4441.157) -- 0:04:18 664500 -- (-4445.762) [-4433.854] (-4435.424) (-4438.189) * (-4430.804) [-4437.005] (-4431.935) (-4444.747) -- 0:04:17 665000 -- (-4443.303) (-4441.082) (-4438.455) [-4436.939] * (-4437.321) [-4437.110] (-4449.098) (-4435.182) -- 0:04:17 Average standard deviation of split frequencies: 0.008544 665500 -- [-4439.141] (-4442.230) (-4445.902) (-4432.870) * (-4437.709) [-4436.365] (-4437.937) (-4436.160) -- 0:04:17 666000 -- (-4435.858) (-4441.874) [-4433.122] (-4443.558) * (-4436.762) (-4449.594) (-4429.184) [-4433.105] -- 0:04:17 666500 -- (-4449.965) (-4445.052) [-4439.322] (-4446.539) * (-4435.634) (-4443.894) [-4436.712] (-4443.751) -- 0:04:16 667000 -- (-4431.393) (-4442.695) (-4435.135) [-4433.084] * (-4442.126) [-4440.577] (-4436.747) (-4444.072) -- 0:04:16 667500 -- [-4429.877] (-4437.781) (-4439.927) (-4430.927) * (-4435.125) (-4437.714) (-4434.049) [-4433.112] -- 0:04:16 668000 -- [-4429.279] (-4431.007) (-4436.205) (-4445.136) * (-4445.888) [-4431.183] (-4437.837) (-4442.062) -- 0:04:15 668500 -- [-4434.712] (-4443.717) (-4435.385) (-4443.700) * [-4433.979] (-4440.290) (-4443.862) (-4437.926) -- 0:04:14 669000 -- [-4435.454] (-4433.730) (-4432.911) (-4433.041) * (-4438.803) (-4435.884) [-4445.439] (-4437.760) -- 0:04:14 669500 -- (-4441.256) (-4446.455) (-4437.621) [-4432.949] * (-4445.698) (-4457.343) (-4439.497) [-4431.587] -- 0:04:14 670000 -- (-4445.305) (-4439.186) (-4437.893) [-4438.122] * (-4437.962) (-4440.594) (-4442.536) [-4441.446] -- 0:04:14 Average standard deviation of split frequencies: 0.008485 670500 -- (-4447.666) (-4439.439) (-4435.373) [-4435.327] * (-4432.395) [-4436.337] (-4434.056) (-4443.513) -- 0:04:13 671000 -- (-4441.015) (-4438.003) [-4436.695] (-4432.264) * (-4439.210) [-4435.110] (-4443.015) (-4440.497) -- 0:04:13 671500 -- (-4436.956) (-4442.596) (-4436.646) [-4438.622] * (-4441.128) [-4441.928] (-4434.944) (-4441.138) -- 0:04:12 672000 -- (-4440.590) (-4438.282) (-4437.856) [-4434.200] * (-4435.425) (-4436.736) (-4447.486) [-4434.943] -- 0:04:12 672500 -- (-4438.834) [-4435.638] (-4432.479) (-4436.696) * (-4437.758) [-4441.958] (-4447.177) (-4439.719) -- 0:04:12 673000 -- (-4438.459) [-4437.103] (-4437.618) (-4438.174) * (-4447.699) (-4444.169) [-4429.456] (-4440.668) -- 0:04:11 673500 -- [-4432.504] (-4447.424) (-4446.467) (-4444.783) * (-4447.341) [-4438.865] (-4438.069) (-4435.644) -- 0:04:11 674000 -- (-4446.920) (-4434.729) (-4440.369) [-4430.654] * (-4446.479) (-4437.763) (-4440.223) [-4433.755] -- 0:04:11 674500 -- (-4438.822) (-4430.388) (-4440.887) [-4434.469] * (-4447.268) [-4431.449] (-4441.158) (-4435.238) -- 0:04:10 675000 -- (-4436.521) (-4442.659) [-4439.721] (-4440.433) * (-4436.593) (-4442.409) (-4434.522) [-4428.421] -- 0:04:09 Average standard deviation of split frequencies: 0.008717 675500 -- (-4440.089) [-4432.943] (-4442.907) (-4432.580) * (-4439.235) (-4434.466) (-4438.157) [-4434.670] -- 0:04:09 676000 -- [-4434.046] (-4436.673) (-4435.745) (-4431.405) * (-4436.444) (-4443.173) [-4445.150] (-4439.230) -- 0:04:09 676500 -- (-4437.284) (-4433.751) (-4438.027) [-4435.870] * (-4433.690) (-4443.738) (-4437.958) [-4434.747] -- 0:04:09 677000 -- (-4441.153) (-4440.923) [-4436.688] (-4435.766) * (-4441.592) (-4437.020) (-4436.538) [-4434.414] -- 0:04:08 677500 -- (-4444.313) (-4438.976) (-4433.291) [-4434.176] * (-4440.660) [-4436.755] (-4438.420) (-4432.443) -- 0:04:08 678000 -- (-4439.006) (-4438.751) [-4435.032] (-4451.282) * (-4442.613) [-4431.734] (-4431.796) (-4436.146) -- 0:04:07 678500 -- [-4437.441] (-4443.524) (-4453.457) (-4438.011) * (-4431.480) [-4439.139] (-4439.502) (-4440.299) -- 0:04:07 679000 -- (-4438.477) (-4445.448) (-4439.660) [-4429.103] * (-4429.507) [-4448.643] (-4436.471) (-4432.960) -- 0:04:06 679500 -- (-4441.330) [-4447.990] (-4439.553) (-4439.452) * (-4437.350) (-4436.787) [-4437.455] (-4442.668) -- 0:04:06 680000 -- (-4439.851) (-4437.550) (-4437.085) [-4435.430] * (-4429.228) [-4435.847] (-4434.245) (-4435.827) -- 0:04:06 Average standard deviation of split frequencies: 0.008608 680500 -- [-4448.881] (-4438.858) (-4441.299) (-4440.777) * (-4440.020) (-4439.225) (-4433.649) [-4436.045] -- 0:04:06 681000 -- (-4441.551) (-4439.903) [-4433.049] (-4434.600) * (-4451.520) (-4446.774) [-4436.914] (-4433.236) -- 0:04:05 681500 -- (-4432.718) (-4437.759) (-4437.896) [-4433.785] * (-4438.225) (-4443.128) (-4437.357) [-4438.930] -- 0:04:04 682000 -- (-4438.450) (-4441.620) [-4430.700] (-4438.571) * (-4433.115) (-4438.512) (-4432.446) [-4443.219] -- 0:04:04 682500 -- (-4435.901) (-4437.084) [-4436.943] (-4433.337) * (-4453.426) (-4437.564) (-4439.946) [-4434.714] -- 0:04:04 683000 -- (-4429.208) (-4436.437) (-4443.887) [-4431.034] * (-4447.099) [-4431.737] (-4435.350) (-4449.812) -- 0:04:04 683500 -- [-4432.365] (-4436.062) (-4447.496) (-4433.810) * (-4439.424) (-4442.079) [-4432.867] (-4454.400) -- 0:04:03 684000 -- (-4443.183) [-4433.959] (-4439.516) (-4431.842) * (-4436.052) [-4439.992] (-4430.992) (-4436.150) -- 0:04:03 684500 -- (-4433.488) (-4432.809) (-4439.625) [-4431.847] * (-4428.988) [-4432.719] (-4435.273) (-4441.382) -- 0:04:02 685000 -- (-4446.001) [-4437.590] (-4449.631) (-4431.271) * (-4439.725) (-4444.402) [-4432.109] (-4433.707) -- 0:04:02 Average standard deviation of split frequencies: 0.008688 685500 -- (-4437.471) [-4432.647] (-4437.160) (-4441.777) * (-4431.071) (-4445.786) [-4431.622] (-4432.134) -- 0:04:01 686000 -- (-4440.221) (-4436.182) (-4444.680) [-4437.093] * (-4437.552) (-4444.919) [-4431.880] (-4433.936) -- 0:04:01 686500 -- (-4435.569) (-4430.824) (-4433.787) [-4439.002] * (-4433.683) (-4444.271) (-4455.052) [-4431.262] -- 0:04:01 687000 -- [-4437.235] (-4432.183) (-4444.014) (-4442.302) * [-4430.918] (-4435.394) (-4429.156) (-4440.807) -- 0:04:01 687500 -- (-4437.195) [-4439.585] (-4432.834) (-4440.344) * (-4442.924) (-4436.252) (-4438.467) [-4437.037] -- 0:04:00 688000 -- (-4442.295) (-4444.522) [-4433.915] (-4437.571) * (-4437.830) [-4436.489] (-4435.904) (-4435.998) -- 0:03:59 688500 -- [-4435.703] (-4434.498) (-4441.261) (-4441.147) * (-4436.821) [-4436.147] (-4441.115) (-4434.068) -- 0:03:59 689000 -- (-4446.221) (-4430.620) [-4438.220] (-4439.816) * (-4439.126) (-4432.099) [-4439.424] (-4437.712) -- 0:03:59 689500 -- (-4442.131) (-4433.956) (-4433.760) [-4440.967] * [-4432.054] (-4436.748) (-4435.890) (-4434.966) -- 0:03:58 690000 -- (-4451.322) [-4439.329] (-4453.296) (-4439.774) * (-4441.899) (-4447.550) (-4434.034) [-4434.401] -- 0:03:58 Average standard deviation of split frequencies: 0.008580 690500 -- (-4442.796) (-4445.157) [-4438.510] (-4436.596) * [-4431.114] (-4442.870) (-4438.354) (-4434.164) -- 0:03:58 691000 -- (-4436.542) (-4451.075) [-4437.280] (-4435.990) * (-4436.988) (-4451.353) (-4441.345) [-4433.219] -- 0:03:57 691500 -- (-4447.369) (-4446.265) [-4434.140] (-4441.292) * (-4440.031) (-4444.762) (-4459.384) [-4432.241] -- 0:03:57 692000 -- (-4441.223) (-4449.320) [-4435.044] (-4437.109) * (-4447.542) (-4435.979) (-4446.259) [-4446.368] -- 0:03:56 692500 -- (-4437.048) (-4436.331) (-4433.336) [-4442.485] * (-4437.743) [-4435.291] (-4433.757) (-4455.400) -- 0:03:56 693000 -- (-4441.790) (-4436.040) [-4442.790] (-4437.610) * (-4441.505) (-4440.209) [-4429.035] (-4460.042) -- 0:03:56 693500 -- (-4458.200) (-4439.393) (-4441.636) [-4443.914] * (-4436.920) [-4437.408] (-4438.167) (-4459.543) -- 0:03:56 694000 -- (-4455.298) [-4438.428] (-4443.280) (-4437.859) * (-4435.283) (-4431.305) [-4425.175] (-4454.138) -- 0:03:55 694500 -- (-4441.325) [-4430.733] (-4438.602) (-4433.754) * (-4433.025) [-4430.290] (-4433.313) (-4447.307) -- 0:03:54 695000 -- [-4436.334] (-4437.266) (-4449.682) (-4432.915) * [-4431.874] (-4446.784) (-4438.481) (-4430.086) -- 0:03:54 Average standard deviation of split frequencies: 0.007886 695500 -- (-4440.075) [-4435.763] (-4445.124) (-4433.077) * (-4439.758) (-4440.534) [-4430.269] (-4428.702) -- 0:03:54 696000 -- (-4434.069) (-4436.522) (-4444.772) [-4436.202] * [-4441.212] (-4441.850) (-4438.523) (-4438.017) -- 0:03:53 696500 -- [-4435.207] (-4437.463) (-4442.704) (-4440.440) * (-4443.029) (-4446.731) (-4436.630) [-4428.325] -- 0:03:53 697000 -- (-4433.154) [-4431.896] (-4434.078) (-4450.294) * [-4434.617] (-4430.451) (-4434.330) (-4433.020) -- 0:03:53 697500 -- (-4436.595) (-4435.010) (-4436.021) [-4436.617] * (-4437.623) [-4437.972] (-4436.206) (-4435.712) -- 0:03:52 698000 -- (-4430.779) [-4437.078] (-4439.996) (-4444.130) * (-4436.943) [-4435.421] (-4435.706) (-4442.256) -- 0:03:52 698500 -- (-4440.350) [-4444.383] (-4443.441) (-4445.976) * (-4440.782) [-4437.828] (-4442.779) (-4440.530) -- 0:03:51 699000 -- [-4444.240] (-4433.007) (-4440.180) (-4447.097) * (-4443.148) [-4434.924] (-4435.943) (-4437.622) -- 0:03:51 699500 -- (-4441.047) (-4443.971) (-4441.441) [-4432.653] * (-4431.507) [-4434.045] (-4445.587) (-4442.258) -- 0:03:51 700000 -- (-4439.944) [-4433.055] (-4433.586) (-4441.950) * [-4433.010] (-4433.757) (-4441.635) (-4435.016) -- 0:03:51 Average standard deviation of split frequencies: 0.008612 700500 -- (-4432.268) (-4436.522) (-4435.917) [-4434.318] * [-4433.412] (-4449.712) (-4437.527) (-4434.962) -- 0:03:50 701000 -- (-4443.298) (-4432.160) (-4444.434) [-4429.894] * [-4437.728] (-4439.408) (-4430.649) (-4430.370) -- 0:03:50 701500 -- (-4438.598) (-4440.342) (-4455.897) [-4433.637] * (-4448.631) (-4433.900) [-4442.230] (-4430.900) -- 0:03:49 702000 -- (-4443.930) [-4434.992] (-4436.547) (-4434.855) * [-4436.409] (-4440.185) (-4444.616) (-4438.160) -- 0:03:49 702500 -- (-4439.254) (-4432.966) [-4427.475] (-4448.784) * (-4433.211) (-4453.808) [-4431.870] (-4437.617) -- 0:03:49 703000 -- (-4435.500) [-4428.519] (-4434.928) (-4438.955) * (-4436.537) (-4446.640) [-4433.727] (-4442.383) -- 0:03:48 703500 -- (-4441.190) [-4432.629] (-4445.026) (-4438.941) * [-4437.693] (-4449.036) (-4442.697) (-4440.668) -- 0:03:48 704000 -- (-4432.729) (-4436.186) [-4438.463] (-4447.458) * (-4435.448) [-4435.352] (-4438.499) (-4446.274) -- 0:03:47 704500 -- (-4442.430) [-4432.203] (-4437.645) (-4436.458) * [-4437.240] (-4441.008) (-4441.228) (-4438.664) -- 0:03:47 705000 -- [-4430.701] (-4445.509) (-4442.598) (-4438.164) * (-4441.672) [-4438.311] (-4445.889) (-4437.809) -- 0:03:47 Average standard deviation of split frequencies: 0.008458 705500 -- (-4442.539) (-4451.187) [-4442.223] (-4436.813) * (-4434.115) [-4438.682] (-4431.668) (-4443.947) -- 0:03:46 706000 -- (-4441.076) (-4439.526) (-4439.520) [-4436.093] * (-4447.007) (-4448.077) [-4439.853] (-4439.552) -- 0:03:46 706500 -- (-4440.749) (-4436.217) (-4449.636) [-4429.691] * (-4439.320) (-4442.323) (-4437.058) [-4430.544] -- 0:03:45 707000 -- (-4438.410) (-4445.405) [-4434.901] (-4437.088) * (-4438.203) (-4446.062) [-4438.093] (-4437.511) -- 0:03:45 707500 -- [-4437.212] (-4441.967) (-4443.064) (-4441.766) * (-4446.294) (-4442.771) [-4439.492] (-4432.039) -- 0:03:45 708000 -- (-4434.586) [-4433.851] (-4441.733) (-4435.277) * (-4434.479) (-4441.995) [-4444.903] (-4432.016) -- 0:03:44 708500 -- (-4450.719) (-4438.520) [-4435.282] (-4438.000) * (-4444.776) [-4440.647] (-4448.670) (-4437.449) -- 0:03:44 709000 -- (-4435.292) (-4441.826) (-4455.294) [-4427.120] * (-4437.520) (-4435.239) [-4435.781] (-4435.573) -- 0:03:44 709500 -- [-4439.019] (-4446.958) (-4460.041) (-4442.784) * (-4435.138) (-4437.160) (-4434.876) [-4433.716] -- 0:03:43 710000 -- (-4436.870) (-4434.302) [-4438.876] (-4453.138) * (-4446.815) (-4431.178) [-4440.458] (-4441.521) -- 0:03:43 Average standard deviation of split frequencies: 0.007960 710500 -- (-4448.927) (-4443.439) [-4435.080] (-4441.461) * [-4440.338] (-4433.480) (-4446.107) (-4441.208) -- 0:03:42 711000 -- (-4437.930) (-4444.267) (-4434.293) [-4433.183] * (-4432.734) (-4442.732) (-4434.105) [-4439.402] -- 0:03:42 711500 -- [-4431.583] (-4445.460) (-4444.707) (-4445.977) * (-4440.525) [-4435.792] (-4432.605) (-4447.626) -- 0:03:42 712000 -- [-4436.170] (-4438.376) (-4442.078) (-4439.810) * [-4440.982] (-4444.134) (-4427.521) (-4440.092) -- 0:03:41 712500 -- (-4441.825) (-4434.655) [-4434.060] (-4438.021) * [-4441.123] (-4442.801) (-4435.087) (-4443.380) -- 0:03:41 713000 -- (-4442.964) (-4432.291) [-4432.512] (-4438.742) * (-4440.301) (-4436.508) [-4434.151] (-4432.977) -- 0:03:40 713500 -- (-4438.320) [-4436.367] (-4438.393) (-4452.023) * (-4437.425) (-4447.696) [-4442.859] (-4433.069) -- 0:03:40 714000 -- (-4446.708) (-4441.021) [-4449.003] (-4445.327) * [-4433.653] (-4436.030) (-4441.206) (-4438.962) -- 0:03:40 714500 -- (-4447.196) [-4440.368] (-4438.235) (-4443.170) * (-4436.660) (-4432.426) [-4434.431] (-4439.974) -- 0:03:39 715000 -- [-4445.145] (-4437.793) (-4432.679) (-4449.163) * (-4431.312) (-4449.880) (-4449.698) [-4434.984] -- 0:03:39 Average standard deviation of split frequencies: 0.008822 715500 -- (-4447.108) [-4440.195] (-4436.560) (-4437.662) * (-4432.772) (-4439.902) [-4431.318] (-4441.547) -- 0:03:39 716000 -- (-4435.527) (-4445.377) [-4430.340] (-4441.985) * (-4438.147) [-4440.908] (-4440.429) (-4444.746) -- 0:03:38 716500 -- (-4435.966) (-4433.781) (-4435.067) [-4433.023] * (-4453.725) (-4441.044) (-4437.819) [-4438.244] -- 0:03:38 717000 -- (-4461.373) [-4430.872] (-4441.397) (-4443.140) * (-4433.235) (-4443.454) [-4435.373] (-4440.858) -- 0:03:37 717500 -- [-4440.056] (-4429.477) (-4447.269) (-4438.719) * (-4440.990) (-4442.089) (-4435.837) [-4431.637] -- 0:03:37 718000 -- (-4437.109) [-4436.288] (-4439.897) (-4442.579) * [-4429.614] (-4444.308) (-4438.394) (-4436.843) -- 0:03:37 718500 -- (-4443.886) [-4430.633] (-4441.005) (-4433.598) * (-4443.733) (-4439.385) (-4440.373) [-4440.145] -- 0:03:36 719000 -- (-4445.625) (-4442.171) [-4435.016] (-4439.687) * (-4440.965) (-4449.769) (-4440.167) [-4434.267] -- 0:03:36 719500 -- (-4439.074) [-4442.072] (-4445.057) (-4445.629) * (-4438.802) [-4429.961] (-4439.741) (-4430.413) -- 0:03:35 720000 -- (-4446.687) (-4435.125) (-4436.893) [-4437.053] * (-4440.875) [-4437.989] (-4433.628) (-4437.480) -- 0:03:35 Average standard deviation of split frequencies: 0.008678 720500 -- (-4435.266) [-4438.396] (-4446.127) (-4440.075) * [-4439.717] (-4448.613) (-4438.135) (-4436.665) -- 0:03:35 721000 -- (-4437.546) [-4435.108] (-4449.872) (-4437.055) * (-4445.265) [-4434.363] (-4441.016) (-4430.439) -- 0:03:34 721500 -- (-4442.052) (-4442.549) (-4442.746) [-4431.818] * (-4449.018) (-4438.852) (-4435.681) [-4447.294] -- 0:03:34 722000 -- (-4443.575) (-4432.361) [-4436.344] (-4437.310) * (-4441.088) (-4441.793) [-4434.455] (-4442.596) -- 0:03:34 722500 -- (-4436.142) (-4444.381) (-4436.341) [-4436.879] * (-4430.040) (-4447.565) (-4432.845) [-4433.637] -- 0:03:33 723000 -- (-4434.021) [-4436.287] (-4436.183) (-4430.121) * [-4428.799] (-4438.356) (-4451.822) (-4439.989) -- 0:03:33 723500 -- [-4430.732] (-4437.593) (-4439.408) (-4428.074) * [-4443.571] (-4442.681) (-4441.871) (-4441.988) -- 0:03:32 724000 -- (-4433.869) [-4433.006] (-4444.375) (-4446.042) * (-4444.582) [-4433.166] (-4444.856) (-4440.749) -- 0:03:32 724500 -- (-4436.978) (-4429.159) (-4443.339) [-4437.023] * (-4439.614) (-4430.036) [-4430.243] (-4442.325) -- 0:03:32 725000 -- [-4435.716] (-4433.540) (-4444.342) (-4443.642) * (-4438.889) (-4440.796) (-4428.879) [-4447.228] -- 0:03:31 Average standard deviation of split frequencies: 0.009480 725500 -- (-4435.571) [-4435.512] (-4447.165) (-4439.037) * (-4442.314) [-4446.200] (-4444.570) (-4439.742) -- 0:03:31 726000 -- (-4446.419) (-4441.900) (-4435.912) [-4437.950] * (-4439.967) (-4434.994) [-4445.136] (-4439.187) -- 0:03:30 726500 -- (-4443.140) (-4440.047) (-4438.964) [-4431.473] * [-4431.937] (-4437.082) (-4438.489) (-4436.403) -- 0:03:30 727000 -- (-4447.358) (-4446.227) [-4440.195] (-4435.369) * [-4429.095] (-4438.625) (-4443.813) (-4444.582) -- 0:03:30 727500 -- (-4437.849) (-4444.591) (-4438.902) [-4439.960] * (-4441.691) (-4439.947) [-4429.459] (-4443.992) -- 0:03:29 728000 -- [-4443.995] (-4438.159) (-4432.764) (-4437.936) * (-4432.181) [-4433.470] (-4436.208) (-4440.526) -- 0:03:29 728500 -- (-4442.002) [-4431.761] (-4434.108) (-4434.094) * (-4441.702) [-4442.147] (-4443.437) (-4443.144) -- 0:03:29 729000 -- (-4440.481) (-4434.341) (-4430.227) [-4436.257] * (-4437.601) (-4438.718) (-4437.013) [-4437.921] -- 0:03:28 729500 -- (-4436.957) (-4438.968) [-4435.068] (-4442.337) * (-4434.073) (-4439.942) (-4433.762) [-4439.647] -- 0:03:28 730000 -- [-4432.115] (-4430.625) (-4447.743) (-4442.115) * (-4436.032) (-4433.032) [-4440.287] (-4439.815) -- 0:03:27 Average standard deviation of split frequencies: 0.009376 730500 -- (-4432.338) [-4439.979] (-4451.414) (-4442.583) * (-4447.571) (-4440.556) (-4435.534) [-4433.178] -- 0:03:27 731000 -- (-4436.087) (-4434.925) [-4443.263] (-4442.269) * (-4442.360) (-4433.946) [-4432.221] (-4441.239) -- 0:03:27 731500 -- [-4433.657] (-4438.534) (-4432.424) (-4449.356) * (-4451.125) (-4440.369) (-4440.134) [-4434.991] -- 0:03:26 732000 -- (-4444.533) [-4430.501] (-4436.590) (-4434.955) * (-4443.657) (-4438.462) [-4426.562] (-4439.166) -- 0:03:26 732500 -- [-4436.033] (-4432.422) (-4436.237) (-4436.714) * (-4431.854) (-4442.116) (-4444.000) [-4435.119] -- 0:03:25 733000 -- (-4431.629) [-4432.838] (-4436.558) (-4430.044) * (-4439.500) (-4439.086) (-4435.420) [-4441.210] -- 0:03:25 733500 -- (-4437.841) (-4439.056) [-4433.689] (-4439.099) * (-4432.550) [-4434.502] (-4432.632) (-4445.053) -- 0:03:25 734000 -- (-4433.265) (-4439.749) [-4434.479] (-4441.196) * (-4442.425) (-4436.942) (-4445.887) [-4448.246] -- 0:03:24 734500 -- (-4442.360) (-4435.647) [-4437.775] (-4445.934) * (-4439.465) [-4433.220] (-4443.436) (-4441.457) -- 0:03:24 735000 -- (-4442.399) (-4433.272) (-4442.936) [-4433.933] * (-4445.407) [-4438.090] (-4433.426) (-4442.614) -- 0:03:24 Average standard deviation of split frequencies: 0.009266 735500 -- (-4436.098) (-4440.515) (-4444.211) [-4430.340] * [-4438.199] (-4440.609) (-4438.995) (-4438.797) -- 0:03:23 736000 -- [-4434.625] (-4436.938) (-4455.929) (-4441.266) * (-4434.195) (-4438.806) [-4427.245] (-4441.429) -- 0:03:23 736500 -- (-4434.959) [-4435.253] (-4445.270) (-4435.816) * (-4435.065) [-4436.445] (-4432.263) (-4442.635) -- 0:03:22 737000 -- (-4436.658) (-4441.132) (-4436.501) [-4440.306] * (-4441.354) (-4448.063) [-4443.159] (-4448.295) -- 0:03:22 737500 -- (-4440.017) (-4433.470) (-4437.030) [-4442.265] * [-4431.924] (-4444.816) (-4440.869) (-4443.110) -- 0:03:22 738000 -- [-4429.210] (-4434.033) (-4433.588) (-4437.889) * (-4434.553) (-4440.021) (-4448.966) [-4439.449] -- 0:03:21 738500 -- (-4433.271) (-4440.750) [-4445.155] (-4434.707) * (-4436.007) (-4439.730) (-4437.480) [-4431.988] -- 0:03:21 739000 -- (-4443.277) (-4439.415) [-4433.906] (-4435.481) * [-4432.469] (-4452.224) (-4437.469) (-4437.038) -- 0:03:20 739500 -- [-4431.574] (-4440.774) (-4439.443) (-4450.748) * [-4437.077] (-4444.847) (-4431.987) (-4441.630) -- 0:03:20 740000 -- (-4441.553) (-4448.392) [-4434.119] (-4437.708) * (-4439.545) (-4441.720) (-4429.370) [-4436.472] -- 0:03:20 Average standard deviation of split frequencies: 0.009420 740500 -- (-4435.686) (-4440.102) [-4436.556] (-4442.218) * (-4435.660) (-4445.398) (-4440.002) [-4431.613] -- 0:03:19 741000 -- [-4436.307] (-4441.186) (-4450.309) (-4434.191) * [-4435.680] (-4437.597) (-4439.221) (-4454.750) -- 0:03:19 741500 -- (-4443.290) (-4442.410) (-4438.135) [-4432.509] * (-4435.697) (-4438.692) (-4441.765) [-4442.705] -- 0:03:19 742000 -- (-4437.968) (-4443.965) (-4444.632) [-4431.250] * (-4442.586) (-4438.448) (-4436.979) [-4438.254] -- 0:03:18 742500 -- (-4439.962) (-4426.030) [-4433.749] (-4441.541) * (-4440.639) [-4439.605] (-4444.652) (-4442.186) -- 0:03:18 743000 -- [-4436.430] (-4432.457) (-4444.631) (-4451.245) * [-4434.578] (-4430.701) (-4441.836) (-4439.482) -- 0:03:17 743500 -- (-4440.682) (-4431.351) [-4435.130] (-4446.663) * [-4435.391] (-4445.343) (-4447.659) (-4448.906) -- 0:03:17 744000 -- [-4438.022] (-4432.095) (-4439.931) (-4444.968) * (-4431.351) (-4440.388) (-4436.795) [-4436.402] -- 0:03:17 744500 -- (-4444.234) (-4437.012) (-4444.066) [-4443.311] * (-4433.352) (-4439.950) (-4435.856) [-4437.609] -- 0:03:16 745000 -- (-4436.625) (-4444.769) (-4436.252) [-4440.909] * [-4434.661] (-4439.572) (-4442.335) (-4443.208) -- 0:03:16 Average standard deviation of split frequencies: 0.009521 745500 -- (-4442.271) (-4439.110) (-4432.095) [-4437.911] * (-4436.800) (-4432.040) (-4440.546) [-4433.680] -- 0:03:15 746000 -- (-4441.489) [-4429.492] (-4447.073) (-4438.536) * (-4435.863) (-4431.467) [-4434.272] (-4443.805) -- 0:03:15 746500 -- [-4436.403] (-4442.661) (-4440.607) (-4435.665) * (-4437.104) (-4431.883) [-4433.884] (-4440.295) -- 0:03:15 747000 -- (-4437.581) (-4433.194) [-4433.327] (-4433.300) * [-4437.366] (-4436.317) (-4434.678) (-4438.243) -- 0:03:14 747500 -- (-4434.716) (-4439.322) [-4440.451] (-4442.827) * (-4452.644) (-4442.003) [-4431.032] (-4435.667) -- 0:03:14 748000 -- [-4428.328] (-4440.181) (-4437.965) (-4446.343) * (-4435.386) [-4435.691] (-4437.694) (-4437.912) -- 0:03:14 748500 -- (-4434.520) (-4447.299) [-4441.808] (-4441.024) * (-4444.792) [-4436.641] (-4432.660) (-4444.292) -- 0:03:13 749000 -- (-4434.374) [-4438.194] (-4435.651) (-4445.763) * (-4449.638) [-4443.658] (-4438.574) (-4437.230) -- 0:03:13 749500 -- (-4446.551) (-4442.429) (-4446.588) [-4442.550] * (-4437.999) (-4447.506) (-4444.274) [-4436.884] -- 0:03:12 750000 -- (-4442.462) (-4437.782) [-4437.562] (-4437.759) * (-4444.627) (-4439.041) [-4435.148] (-4425.623) -- 0:03:12 Average standard deviation of split frequencies: 0.009378 750500 -- (-4437.856) (-4433.950) (-4441.000) [-4442.264] * (-4435.195) (-4437.144) [-4442.686] (-4429.384) -- 0:03:12 751000 -- (-4439.119) [-4439.376] (-4444.428) (-4437.720) * (-4445.752) (-4440.968) (-4433.625) [-4432.176] -- 0:03:11 751500 -- (-4451.274) (-4441.121) [-4435.823] (-4434.109) * (-4431.805) (-4432.891) (-4439.154) [-4441.555] -- 0:03:11 752000 -- (-4438.791) (-4448.818) [-4435.222] (-4430.487) * (-4446.184) (-4433.614) [-4434.098] (-4438.888) -- 0:03:10 752500 -- (-4441.848) (-4447.939) [-4438.653] (-4436.600) * (-4443.600) (-4435.794) [-4430.761] (-4436.841) -- 0:03:10 753000 -- [-4431.374] (-4444.114) (-4434.027) (-4441.997) * (-4446.333) (-4437.351) (-4442.844) [-4440.408] -- 0:03:10 753500 -- [-4436.784] (-4439.062) (-4442.048) (-4433.042) * (-4441.336) (-4445.378) [-4434.870] (-4433.165) -- 0:03:09 754000 -- (-4433.222) (-4433.709) (-4437.011) [-4435.480] * (-4430.030) (-4434.487) [-4440.209] (-4435.063) -- 0:03:09 754500 -- [-4431.409] (-4434.628) (-4427.028) (-4437.882) * [-4429.128] (-4431.062) (-4446.078) (-4450.610) -- 0:03:09 755000 -- (-4445.736) (-4445.289) (-4447.027) [-4438.688] * (-4441.235) [-4429.733] (-4451.203) (-4443.732) -- 0:03:08 Average standard deviation of split frequencies: 0.009021 755500 -- (-4447.539) (-4433.397) (-4441.179) [-4431.647] * [-4435.848] (-4446.478) (-4437.691) (-4442.494) -- 0:03:08 756000 -- (-4446.474) [-4434.905] (-4443.375) (-4446.977) * (-4436.762) [-4442.698] (-4442.733) (-4442.614) -- 0:03:07 756500 -- (-4444.998) [-4439.282] (-4437.099) (-4433.556) * (-4440.194) [-4435.527] (-4437.761) (-4441.373) -- 0:03:07 757000 -- (-4438.078) (-4443.631) (-4436.223) [-4435.642] * (-4439.966) (-4447.999) [-4429.650] (-4444.413) -- 0:03:07 757500 -- [-4435.450] (-4448.975) (-4440.387) (-4437.051) * (-4441.633) (-4438.069) [-4444.525] (-4436.135) -- 0:03:06 758000 -- (-4448.789) [-4434.261] (-4446.510) (-4432.984) * (-4439.373) [-4440.977] (-4436.328) (-4445.622) -- 0:03:06 758500 -- (-4441.485) [-4438.212] (-4439.573) (-4434.531) * (-4445.242) [-4428.813] (-4440.536) (-4439.277) -- 0:03:05 759000 -- (-4439.807) [-4434.375] (-4436.782) (-4430.033) * [-4439.407] (-4437.560) (-4444.286) (-4440.824) -- 0:03:05 759500 -- (-4452.268) (-4444.398) (-4439.352) [-4433.032] * (-4437.068) (-4431.530) [-4440.134] (-4442.202) -- 0:03:05 760000 -- [-4436.987] (-4434.615) (-4435.482) (-4444.739) * (-4432.679) [-4435.143] (-4432.652) (-4434.184) -- 0:03:04 Average standard deviation of split frequencies: 0.009213 760500 -- (-4439.843) (-4440.221) [-4434.304] (-4442.771) * (-4432.060) [-4432.736] (-4443.520) (-4446.111) -- 0:03:04 761000 -- (-4444.516) (-4442.326) [-4435.849] (-4447.984) * (-4436.161) (-4436.456) [-4439.851] (-4435.396) -- 0:03:04 761500 -- [-4436.805] (-4437.967) (-4433.554) (-4449.364) * [-4433.257] (-4438.686) (-4432.996) (-4442.126) -- 0:03:03 762000 -- [-4443.661] (-4433.460) (-4436.130) (-4447.267) * (-4440.529) (-4433.056) [-4435.824] (-4446.588) -- 0:03:03 762500 -- (-4433.999) (-4441.358) (-4439.777) [-4439.486] * (-4442.025) (-4441.051) (-4435.346) [-4437.620] -- 0:03:02 763000 -- (-4444.645) (-4433.420) (-4444.440) [-4436.174] * [-4434.624] (-4438.325) (-4436.649) (-4440.467) -- 0:03:02 763500 -- (-4445.809) [-4432.184] (-4442.574) (-4439.911) * [-4439.938] (-4434.462) (-4449.138) (-4438.499) -- 0:03:02 764000 -- (-4447.194) (-4430.748) (-4448.115) [-4435.651] * (-4441.357) (-4444.026) (-4439.124) [-4436.631] -- 0:03:01 764500 -- (-4442.307) (-4444.916) [-4435.139] (-4432.163) * (-4437.402) [-4432.550] (-4439.465) (-4441.796) -- 0:03:01 765000 -- (-4436.422) (-4448.130) [-4432.250] (-4433.952) * [-4433.589] (-4431.818) (-4441.786) (-4436.128) -- 0:03:00 Average standard deviation of split frequencies: 0.009026 765500 -- (-4438.715) [-4434.191] (-4443.887) (-4453.209) * (-4439.259) (-4431.441) (-4436.497) [-4434.943] -- 0:03:00 766000 -- (-4436.924) [-4436.590] (-4444.415) (-4437.860) * (-4441.181) [-4434.426] (-4442.881) (-4432.309) -- 0:03:00 766500 -- [-4428.899] (-4437.092) (-4452.699) (-4443.409) * (-4429.468) (-4433.084) (-4431.451) [-4435.172] -- 0:02:59 767000 -- [-4430.819] (-4437.046) (-4456.111) (-4444.073) * (-4438.493) (-4433.394) [-4433.830] (-4442.923) -- 0:02:59 767500 -- (-4439.184) (-4438.685) (-4445.386) [-4433.922] * (-4438.146) (-4436.212) (-4447.026) [-4432.603] -- 0:02:59 768000 -- (-4438.338) [-4429.533] (-4443.522) (-4440.194) * [-4439.851] (-4431.643) (-4441.720) (-4437.959) -- 0:02:58 768500 -- [-4431.245] (-4428.379) (-4441.586) (-4435.848) * (-4438.725) (-4437.759) (-4434.813) [-4428.135] -- 0:02:58 769000 -- [-4431.133] (-4430.307) (-4434.970) (-4440.112) * (-4437.268) (-4439.628) (-4431.521) [-4433.916] -- 0:02:57 769500 -- (-4442.766) (-4435.961) (-4434.532) [-4439.403] * (-4439.392) (-4443.937) (-4437.442) [-4432.452] -- 0:02:57 770000 -- [-4440.044] (-4447.007) (-4438.852) (-4452.277) * (-4439.331) [-4430.113] (-4431.005) (-4435.928) -- 0:02:57 Average standard deviation of split frequencies: 0.009012 770500 -- [-4435.812] (-4436.488) (-4432.997) (-4441.438) * (-4430.418) (-4435.995) (-4440.005) [-4435.479] -- 0:02:56 771000 -- (-4436.964) [-4428.681] (-4440.242) (-4442.260) * (-4432.084) (-4460.021) [-4435.117] (-4443.528) -- 0:02:56 771500 -- (-4437.293) [-4436.031] (-4434.184) (-4443.268) * (-4431.888) (-4448.686) [-4430.451] (-4440.074) -- 0:02:55 772000 -- (-4437.324) (-4445.365) [-4430.797] (-4446.576) * [-4431.433] (-4439.377) (-4432.419) (-4450.485) -- 0:02:55 772500 -- (-4444.087) (-4435.562) [-4442.499] (-4449.016) * (-4436.878) (-4436.562) (-4434.796) [-4441.589] -- 0:02:54 773000 -- (-4436.980) [-4434.467] (-4453.208) (-4443.691) * (-4445.410) (-4437.729) [-4432.231] (-4441.462) -- 0:02:54 773500 -- (-4433.651) (-4433.642) (-4437.282) [-4439.011] * [-4432.397] (-4439.963) (-4441.983) (-4442.909) -- 0:02:54 774000 -- (-4431.406) (-4443.848) [-4438.591] (-4443.575) * [-4427.535] (-4442.535) (-4435.296) (-4434.938) -- 0:02:54 774500 -- [-4440.113] (-4441.882) (-4438.249) (-4445.419) * (-4439.657) (-4446.423) [-4434.751] (-4440.478) -- 0:02:53 775000 -- (-4443.543) (-4430.380) (-4444.151) [-4431.695] * (-4438.751) [-4434.993] (-4433.861) (-4447.655) -- 0:02:53 Average standard deviation of split frequencies: 0.009031 775500 -- (-4448.607) (-4439.734) (-4441.791) [-4435.734] * (-4449.126) [-4438.915] (-4432.820) (-4436.914) -- 0:02:52 776000 -- (-4439.948) (-4435.694) (-4445.481) [-4435.739] * [-4433.600] (-4445.820) (-4456.807) (-4444.511) -- 0:02:52 776500 -- [-4435.944] (-4436.243) (-4438.188) (-4435.727) * (-4436.974) (-4444.165) (-4437.869) [-4432.760] -- 0:02:52 777000 -- (-4443.252) (-4432.768) [-4438.035] (-4437.117) * [-4434.072] (-4436.699) (-4432.396) (-4440.359) -- 0:02:51 777500 -- (-4438.576) (-4445.655) [-4443.212] (-4451.957) * (-4434.160) (-4440.352) [-4436.281] (-4438.698) -- 0:02:51 778000 -- (-4445.201) (-4445.239) (-4445.391) [-4439.023] * (-4435.239) [-4437.506] (-4436.663) (-4433.434) -- 0:02:50 778500 -- [-4434.337] (-4437.988) (-4444.545) (-4438.048) * (-4435.140) (-4432.166) (-4438.532) [-4428.031] -- 0:02:50 779000 -- (-4435.593) [-4432.499] (-4440.670) (-4436.329) * [-4435.092] (-4442.969) (-4433.030) (-4445.285) -- 0:02:50 779500 -- (-4435.645) (-4448.815) (-4427.671) [-4433.693] * (-4436.154) (-4431.780) [-4434.845] (-4454.185) -- 0:02:49 780000 -- (-4442.949) (-4442.631) (-4442.520) [-4435.978] * (-4435.776) [-4435.839] (-4434.713) (-4435.102) -- 0:02:49 Average standard deviation of split frequencies: 0.008695 780500 -- (-4433.850) [-4431.058] (-4434.752) (-4435.690) * (-4438.279) (-4440.956) [-4431.303] (-4435.643) -- 0:02:49 781000 -- (-4448.254) [-4432.441] (-4441.566) (-4434.224) * (-4435.646) [-4439.775] (-4434.943) (-4430.917) -- 0:02:48 781500 -- [-4438.360] (-4435.811) (-4435.908) (-4434.138) * (-4447.811) (-4446.440) [-4438.075] (-4436.390) -- 0:02:48 782000 -- (-4438.072) (-4438.777) [-4440.772] (-4435.606) * (-4442.957) (-4449.637) (-4443.951) [-4436.663] -- 0:02:47 782500 -- [-4434.449] (-4436.043) (-4437.497) (-4444.203) * (-4437.081) (-4449.604) (-4432.093) [-4432.246] -- 0:02:47 783000 -- (-4432.029) [-4436.836] (-4438.531) (-4438.319) * (-4439.507) (-4441.835) (-4435.050) [-4439.246] -- 0:02:47 783500 -- (-4432.867) (-4434.030) [-4429.854] (-4438.800) * (-4437.709) (-4440.177) (-4445.105) [-4436.708] -- 0:02:46 784000 -- (-4449.084) [-4439.309] (-4428.719) (-4441.157) * (-4430.074) [-4435.289] (-4430.451) (-4442.940) -- 0:02:46 784500 -- [-4442.491] (-4447.259) (-4435.203) (-4431.814) * (-4432.219) [-4438.237] (-4434.018) (-4440.493) -- 0:02:45 785000 -- (-4434.216) [-4437.794] (-4437.253) (-4433.088) * [-4434.462] (-4438.194) (-4433.506) (-4439.267) -- 0:02:45 Average standard deviation of split frequencies: 0.008636 785500 -- (-4437.608) (-4434.341) [-4431.931] (-4439.446) * [-4433.035] (-4435.940) (-4449.989) (-4438.971) -- 0:02:45 786000 -- (-4440.964) (-4434.955) (-4436.214) [-4439.903] * (-4434.735) [-4436.078] (-4436.762) (-4438.095) -- 0:02:44 786500 -- (-4442.239) [-4434.496] (-4441.147) (-4444.467) * (-4430.948) [-4435.697] (-4444.862) (-4443.516) -- 0:02:44 787000 -- (-4435.485) [-4440.013] (-4446.596) (-4441.063) * (-4439.354) (-4443.579) (-4433.653) [-4435.482] -- 0:02:44 787500 -- [-4436.561] (-4449.831) (-4439.393) (-4445.073) * (-4439.778) (-4435.887) [-4433.326] (-4444.878) -- 0:02:43 788000 -- (-4435.378) [-4432.000] (-4434.644) (-4430.794) * [-4436.239] (-4435.588) (-4438.670) (-4450.232) -- 0:02:43 788500 -- (-4446.022) (-4437.496) (-4436.750) [-4432.840] * (-4441.243) (-4454.372) [-4433.029] (-4438.113) -- 0:02:42 789000 -- (-4441.892) (-4438.693) [-4432.275] (-4433.636) * [-4435.214] (-4434.884) (-4441.889) (-4443.776) -- 0:02:42 789500 -- [-4434.599] (-4438.070) (-4440.935) (-4433.133) * [-4435.027] (-4438.715) (-4437.073) (-4464.335) -- 0:02:42 790000 -- [-4445.374] (-4432.235) (-4442.058) (-4438.143) * (-4436.794) [-4430.130] (-4440.222) (-4440.399) -- 0:02:41 Average standard deviation of split frequencies: 0.008347 790500 -- (-4437.284) [-4433.188] (-4442.207) (-4434.742) * (-4441.071) (-4445.082) [-4441.750] (-4440.631) -- 0:02:41 791000 -- (-4434.570) (-4437.842) [-4427.866] (-4441.642) * (-4443.689) (-4437.697) (-4450.209) [-4438.444] -- 0:02:40 791500 -- (-4436.039) (-4453.470) [-4438.653] (-4435.654) * (-4439.537) [-4431.967] (-4445.061) (-4435.041) -- 0:02:40 792000 -- (-4438.840) (-4441.904) [-4438.373] (-4436.971) * (-4441.959) [-4431.920] (-4442.294) (-4431.076) -- 0:02:40 792500 -- (-4433.460) [-4441.535] (-4438.668) (-4440.736) * (-4435.662) (-4448.787) [-4433.017] (-4436.259) -- 0:02:39 793000 -- (-4437.341) (-4437.611) [-4436.988] (-4435.938) * (-4436.713) (-4436.649) (-4433.123) [-4434.690] -- 0:02:39 793500 -- [-4435.544] (-4434.156) (-4440.704) (-4433.335) * (-4437.237) (-4438.207) (-4442.705) [-4431.359] -- 0:02:39 794000 -- [-4432.183] (-4432.468) (-4435.195) (-4440.856) * (-4434.328) (-4431.984) (-4431.091) [-4436.302] -- 0:02:38 794500 -- (-4439.865) [-4435.850] (-4440.415) (-4438.661) * [-4436.711] (-4448.237) (-4433.926) (-4437.169) -- 0:02:38 795000 -- (-4439.130) (-4436.711) (-4438.296) [-4433.133] * (-4442.722) (-4433.619) (-4425.651) [-4436.367] -- 0:02:37 Average standard deviation of split frequencies: 0.008567 795500 -- (-4434.973) (-4443.227) (-4441.984) [-4430.568] * (-4441.543) (-4441.057) [-4433.731] (-4443.384) -- 0:02:37 796000 -- [-4434.577] (-4432.612) (-4445.398) (-4434.630) * (-4441.027) (-4442.341) (-4442.787) [-4439.689] -- 0:02:37 796500 -- [-4437.991] (-4436.289) (-4442.876) (-4439.282) * (-4438.735) [-4437.461] (-4434.382) (-4448.073) -- 0:02:36 797000 -- [-4438.221] (-4433.529) (-4439.911) (-4445.741) * (-4448.741) [-4435.181] (-4435.473) (-4443.460) -- 0:02:36 797500 -- (-4443.365) [-4432.078] (-4438.273) (-4463.905) * [-4434.228] (-4447.701) (-4442.710) (-4446.412) -- 0:02:35 798000 -- (-4441.961) [-4436.908] (-4436.220) (-4447.545) * [-4433.354] (-4429.354) (-4445.698) (-4442.935) -- 0:02:35 798500 -- [-4438.507] (-4440.728) (-4442.614) (-4434.361) * [-4432.522] (-4436.063) (-4442.766) (-4448.989) -- 0:02:35 799000 -- (-4444.095) (-4434.676) [-4446.447] (-4437.492) * (-4439.517) [-4430.481] (-4460.458) (-4446.484) -- 0:02:34 799500 -- (-4444.803) (-4442.504) (-4449.209) [-4436.876] * (-4435.907) [-4434.301] (-4436.429) (-4434.454) -- 0:02:34 800000 -- [-4437.720] (-4436.584) (-4442.312) (-4441.881) * [-4441.668] (-4447.710) (-4434.308) (-4439.926) -- 0:02:34 Average standard deviation of split frequencies: 0.008596 800500 -- (-4441.437) (-4446.184) [-4438.061] (-4435.666) * (-4437.818) (-4447.794) (-4435.684) [-4439.429] -- 0:02:33 801000 -- (-4437.705) (-4449.979) (-4438.395) [-4437.525] * (-4440.427) [-4430.215] (-4439.548) (-4441.394) -- 0:02:33 801500 -- (-4446.401) [-4432.363] (-4447.380) (-4437.271) * (-4434.968) (-4433.007) [-4441.428] (-4436.247) -- 0:02:32 802000 -- [-4430.260] (-4430.103) (-4451.592) (-4439.181) * (-4431.108) [-4440.639] (-4439.433) (-4446.368) -- 0:02:32 802500 -- (-4431.724) [-4435.432] (-4442.557) (-4435.890) * (-4436.753) (-4446.514) [-4440.148] (-4436.303) -- 0:02:32 803000 -- (-4438.284) (-4435.634) (-4447.910) [-4435.557] * (-4432.680) (-4451.606) [-4434.408] (-4439.722) -- 0:02:31 803500 -- (-4447.152) [-4439.970] (-4453.023) (-4429.304) * [-4434.442] (-4437.646) (-4441.924) (-4442.156) -- 0:02:31 804000 -- [-4438.152] (-4437.524) (-4441.366) (-4434.209) * [-4439.023] (-4438.889) (-4439.300) (-4439.963) -- 0:02:30 804500 -- [-4436.388] (-4440.209) (-4443.618) (-4435.514) * (-4440.309) (-4433.502) [-4435.350] (-4436.547) -- 0:02:30 805000 -- (-4440.781) (-4435.798) (-4449.245) [-4432.612] * (-4438.907) [-4431.128] (-4441.890) (-4453.644) -- 0:02:30 Average standard deviation of split frequencies: 0.008578 805500 -- (-4437.018) (-4434.451) (-4450.829) [-4433.364] * (-4444.574) (-4445.081) (-4443.128) [-4432.223] -- 0:02:29 806000 -- (-4439.717) (-4439.325) [-4432.602] (-4443.245) * [-4434.853] (-4438.714) (-4442.708) (-4445.365) -- 0:02:29 806500 -- [-4434.274] (-4441.134) (-4437.819) (-4430.757) * (-4446.296) (-4449.073) (-4443.719) [-4438.129] -- 0:02:28 807000 -- (-4434.876) [-4433.565] (-4442.967) (-4435.605) * [-4445.164] (-4445.726) (-4443.113) (-4436.961) -- 0:02:28 807500 -- (-4445.522) (-4436.489) [-4438.360] (-4437.891) * (-4449.682) (-4433.697) [-4434.645] (-4438.288) -- 0:02:28 808000 -- (-4441.634) [-4435.622] (-4442.318) (-4442.460) * (-4447.161) (-4436.688) [-4431.923] (-4446.494) -- 0:02:27 808500 -- (-4435.180) (-4438.745) (-4436.300) [-4450.234] * [-4432.462] (-4446.324) (-4443.756) (-4431.189) -- 0:02:27 809000 -- (-4438.074) (-4434.088) [-4438.411] (-4437.756) * (-4431.807) (-4444.290) (-4443.593) [-4428.861] -- 0:02:27 809500 -- (-4438.516) [-4436.958] (-4436.572) (-4449.313) * (-4431.139) (-4439.991) [-4429.691] (-4435.942) -- 0:02:26 810000 -- (-4431.237) (-4450.842) [-4429.995] (-4432.727) * [-4434.766] (-4437.025) (-4433.146) (-4444.696) -- 0:02:26 Average standard deviation of split frequencies: 0.008335 810500 -- (-4434.109) (-4440.819) (-4450.837) [-4428.886] * (-4444.018) (-4436.688) (-4430.758) [-4441.383] -- 0:02:25 811000 -- (-4440.439) (-4444.468) [-4439.106] (-4436.470) * (-4437.205) (-4436.664) [-4428.803] (-4436.879) -- 0:02:25 811500 -- (-4449.529) (-4441.792) [-4442.537] (-4437.863) * [-4439.075] (-4436.383) (-4442.367) (-4431.709) -- 0:02:25 812000 -- (-4453.951) (-4440.944) [-4439.654] (-4435.188) * (-4446.080) (-4444.374) (-4434.700) [-4431.464] -- 0:02:24 812500 -- (-4445.007) (-4436.045) (-4447.431) [-4436.222] * (-4444.358) (-4429.303) (-4435.627) [-4439.557] -- 0:02:24 813000 -- (-4441.070) (-4440.867) (-4440.547) [-4439.102] * [-4439.679] (-4435.932) (-4437.644) (-4442.483) -- 0:02:23 813500 -- (-4443.844) (-4433.311) (-4443.818) [-4433.323] * (-4447.254) (-4433.710) (-4440.682) [-4434.736] -- 0:02:23 814000 -- (-4434.610) (-4431.611) [-4438.890] (-4438.234) * (-4438.153) (-4441.544) (-4430.133) [-4441.121] -- 0:02:23 814500 -- (-4437.559) (-4447.152) (-4442.362) [-4428.491] * [-4436.811] (-4438.999) (-4439.498) (-4439.407) -- 0:02:22 815000 -- (-4454.597) (-4438.058) [-4437.091] (-4448.268) * (-4440.875) (-4442.809) [-4434.898] (-4439.568) -- 0:02:22 Average standard deviation of split frequencies: 0.008088 815500 -- (-4447.223) [-4434.468] (-4443.731) (-4437.741) * (-4440.688) (-4436.432) [-4432.806] (-4444.020) -- 0:02:22 816000 -- (-4450.850) [-4429.184] (-4435.774) (-4435.642) * (-4448.519) (-4435.511) (-4440.773) [-4427.207] -- 0:02:21 816500 -- (-4447.317) (-4430.897) (-4442.286) [-4430.076] * (-4438.127) [-4442.893] (-4442.875) (-4449.796) -- 0:02:21 817000 -- (-4434.226) (-4438.900) [-4435.556] (-4438.047) * [-4434.846] (-4439.949) (-4438.254) (-4446.167) -- 0:02:20 817500 -- (-4440.084) [-4441.850] (-4434.873) (-4450.617) * [-4438.288] (-4443.851) (-4435.099) (-4442.202) -- 0:02:20 818000 -- (-4434.883) [-4436.687] (-4435.178) (-4443.013) * (-4440.245) (-4437.740) [-4437.252] (-4442.422) -- 0:02:20 818500 -- (-4439.242) [-4435.010] (-4440.934) (-4437.448) * [-4435.521] (-4441.543) (-4441.213) (-4444.224) -- 0:02:19 819000 -- (-4431.820) (-4434.181) (-4437.662) [-4433.376] * (-4440.884) [-4436.175] (-4433.232) (-4439.162) -- 0:02:19 819500 -- (-4439.515) (-4442.495) [-4434.010] (-4439.881) * (-4439.586) [-4435.568] (-4442.779) (-4442.083) -- 0:02:18 820000 -- [-4439.729] (-4445.567) (-4433.263) (-4444.721) * [-4437.613] (-4438.806) (-4436.084) (-4443.270) -- 0:02:18 Average standard deviation of split frequencies: 0.007621 820500 -- [-4436.874] (-4438.114) (-4435.016) (-4435.070) * (-4442.198) (-4449.549) (-4440.953) [-4435.766] -- 0:02:18 821000 -- (-4445.302) (-4436.099) [-4439.171] (-4439.001) * (-4447.421) (-4448.025) [-4432.462] (-4436.577) -- 0:02:17 821500 -- (-4432.679) (-4439.724) [-4440.026] (-4434.008) * (-4437.643) (-4445.631) [-4431.888] (-4443.828) -- 0:02:17 822000 -- (-4433.346) (-4449.553) [-4439.624] (-4433.640) * (-4446.547) [-4437.087] (-4443.629) (-4437.168) -- 0:02:17 822500 -- [-4433.052] (-4444.949) (-4438.705) (-4438.028) * [-4430.954] (-4440.623) (-4436.466) (-4435.455) -- 0:02:16 823000 -- (-4441.220) (-4436.210) [-4438.611] (-4432.258) * (-4442.964) (-4435.014) [-4432.399] (-4439.554) -- 0:02:16 823500 -- [-4430.771] (-4433.898) (-4445.486) (-4448.610) * (-4441.452) (-4447.512) (-4440.684) [-4431.406] -- 0:02:15 824000 -- [-4439.982] (-4444.927) (-4440.091) (-4439.967) * (-4437.418) (-4439.371) (-4440.217) [-4429.203] -- 0:02:15 824500 -- (-4448.621) [-4438.213] (-4438.564) (-4439.499) * (-4433.426) [-4436.956] (-4437.797) (-4431.482) -- 0:02:15 825000 -- (-4440.114) (-4435.340) [-4438.904] (-4447.686) * (-4431.581) (-4437.597) [-4435.586] (-4431.377) -- 0:02:14 Average standard deviation of split frequencies: 0.007762 825500 -- (-4441.374) (-4433.863) [-4434.558] (-4446.376) * (-4433.347) [-4432.243] (-4440.063) (-4447.087) -- 0:02:14 826000 -- (-4437.890) (-4436.262) (-4439.143) [-4434.601] * (-4435.901) (-4435.687) [-4435.364] (-4432.259) -- 0:02:13 826500 -- (-4440.194) (-4436.699) (-4445.761) [-4444.582] * [-4437.087] (-4436.756) (-4440.902) (-4443.439) -- 0:02:13 827000 -- (-4432.856) (-4439.817) [-4438.536] (-4429.986) * (-4428.632) [-4433.471] (-4431.015) (-4447.296) -- 0:02:13 827500 -- (-4432.589) (-4448.308) [-4436.584] (-4433.300) * (-4438.444) (-4435.726) (-4440.164) [-4445.918] -- 0:02:12 828000 -- (-4442.028) (-4435.981) (-4441.609) [-4438.203] * [-4434.595] (-4438.917) (-4439.254) (-4441.504) -- 0:02:12 828500 -- (-4433.739) (-4443.126) [-4438.358] (-4446.675) * (-4428.412) [-4433.300] (-4447.122) (-4445.572) -- 0:02:12 829000 -- (-4446.055) (-4445.157) [-4431.864] (-4436.818) * (-4433.537) (-4433.166) (-4436.150) [-4434.337] -- 0:02:11 829500 -- (-4430.560) (-4427.948) [-4435.600] (-4430.043) * (-4432.488) (-4447.677) (-4430.815) [-4441.893] -- 0:02:11 830000 -- (-4434.009) (-4432.067) (-4432.656) [-4431.340] * [-4435.302] (-4442.731) (-4436.621) (-4448.955) -- 0:02:10 Average standard deviation of split frequencies: 0.007680 830500 -- [-4431.333] (-4428.925) (-4442.110) (-4431.249) * [-4428.288] (-4443.534) (-4442.119) (-4435.056) -- 0:02:10 831000 -- (-4446.501) (-4440.241) [-4441.049] (-4434.120) * (-4436.260) (-4442.241) [-4438.173] (-4440.102) -- 0:02:10 831500 -- [-4435.395] (-4438.101) (-4453.366) (-4443.887) * (-4446.438) (-4439.132) [-4438.631] (-4440.712) -- 0:02:09 832000 -- (-4436.228) (-4435.147) [-4440.969] (-4434.512) * (-4430.708) [-4432.731] (-4440.603) (-4437.969) -- 0:02:09 832500 -- (-4434.953) [-4430.662] (-4455.268) (-4439.736) * (-4445.224) (-4441.112) [-4432.263] (-4433.262) -- 0:02:08 833000 -- (-4442.451) (-4443.136) (-4435.427) [-4436.163] * [-4434.373] (-4436.370) (-4434.474) (-4440.342) -- 0:02:08 833500 -- [-4435.063] (-4440.271) (-4445.997) (-4452.407) * (-4435.982) [-4427.504] (-4435.353) (-4440.848) -- 0:02:08 834000 -- (-4441.811) (-4441.464) [-4429.040] (-4445.222) * (-4432.754) (-4448.966) [-4436.097] (-4437.712) -- 0:02:07 834500 -- [-4434.588] (-4434.000) (-4434.468) (-4443.554) * (-4435.926) (-4434.005) [-4440.695] (-4439.250) -- 0:02:07 835000 -- [-4433.799] (-4441.869) (-4432.007) (-4445.122) * [-4441.933] (-4439.529) (-4443.848) (-4438.338) -- 0:02:07 Average standard deviation of split frequencies: 0.008120 835500 -- [-4434.240] (-4434.947) (-4432.104) (-4448.675) * (-4432.794) (-4432.403) (-4438.098) [-4434.501] -- 0:02:06 836000 -- (-4444.644) [-4437.266] (-4431.993) (-4433.409) * [-4442.902] (-4439.392) (-4439.936) (-4425.185) -- 0:02:06 836500 -- [-4447.055] (-4443.858) (-4439.518) (-4434.035) * (-4433.824) [-4430.778] (-4438.329) (-4439.410) -- 0:02:05 837000 -- (-4435.161) (-4444.690) (-4447.710) [-4436.377] * (-4443.111) (-4440.855) [-4439.662] (-4440.803) -- 0:02:05 837500 -- (-4429.779) (-4437.890) (-4437.176) [-4434.873] * (-4441.960) (-4436.498) (-4434.111) [-4439.342] -- 0:02:05 838000 -- (-4435.038) (-4436.475) [-4431.254] (-4443.052) * (-4440.097) (-4438.836) (-4434.505) [-4438.023] -- 0:02:04 838500 -- (-4451.379) [-4432.150] (-4434.369) (-4434.823) * [-4442.298] (-4442.716) (-4437.116) (-4433.769) -- 0:02:04 839000 -- (-4435.691) [-4428.865] (-4438.750) (-4441.907) * [-4435.041] (-4436.525) (-4439.709) (-4433.637) -- 0:02:03 839500 -- [-4432.741] (-4436.874) (-4446.559) (-4444.695) * (-4443.647) (-4436.892) (-4446.123) [-4427.716] -- 0:02:03 840000 -- (-4433.497) (-4448.538) [-4436.594] (-4435.302) * (-4437.933) (-4438.922) [-4434.388] (-4436.639) -- 0:02:03 Average standard deviation of split frequencies: 0.008224 840500 -- [-4439.416] (-4434.838) (-4445.559) (-4437.050) * (-4434.184) (-4442.031) [-4441.656] (-4442.423) -- 0:02:02 841000 -- (-4442.075) (-4442.662) [-4436.346] (-4430.620) * [-4436.494] (-4437.164) (-4445.366) (-4426.740) -- 0:02:02 841500 -- (-4434.393) (-4449.603) (-4441.069) [-4442.076] * (-4453.991) [-4432.073] (-4439.323) (-4437.541) -- 0:02:02 842000 -- (-4431.857) [-4435.431] (-4443.841) (-4438.332) * (-4452.588) [-4430.629] (-4429.971) (-4437.481) -- 0:02:01 842500 -- (-4443.348) [-4436.849] (-4436.756) (-4439.935) * (-4439.961) [-4433.177] (-4433.480) (-4450.156) -- 0:02:01 843000 -- (-4441.634) (-4441.734) (-4440.498) [-4438.252] * (-4437.056) (-4446.139) [-4428.683] (-4435.095) -- 0:02:00 843500 -- (-4436.470) (-4445.445) (-4434.626) [-4439.689] * (-4438.869) [-4443.615] (-4439.140) (-4434.854) -- 0:02:00 844000 -- (-4436.477) (-4440.462) [-4433.282] (-4431.537) * (-4435.344) (-4440.465) (-4446.458) [-4428.999] -- 0:02:00 844500 -- (-4432.668) (-4444.785) (-4435.122) [-4432.339] * (-4436.434) (-4438.461) (-4437.689) [-4435.301] -- 0:01:59 845000 -- (-4436.055) (-4437.227) [-4427.358] (-4432.706) * (-4450.481) (-4436.499) (-4438.905) [-4437.353] -- 0:01:59 Average standard deviation of split frequencies: 0.007875 845500 -- (-4443.955) (-4442.135) (-4439.690) [-4429.700] * (-4450.966) (-4434.018) (-4437.447) [-4432.981] -- 0:01:58 846000 -- (-4443.311) (-4437.777) (-4438.835) [-4433.614] * (-4435.267) [-4432.729] (-4434.385) (-4436.564) -- 0:01:58 846500 -- (-4446.597) [-4440.276] (-4442.960) (-4439.616) * (-4432.459) (-4439.502) (-4442.906) [-4433.963] -- 0:01:58 847000 -- (-4440.806) [-4433.916] (-4442.202) (-4434.122) * (-4440.737) (-4443.094) [-4436.948] (-4444.424) -- 0:01:57 847500 -- [-4443.140] (-4433.399) (-4440.655) (-4433.506) * (-4436.113) (-4445.957) [-4444.549] (-4437.715) -- 0:01:57 848000 -- [-4434.886] (-4437.418) (-4437.435) (-4439.257) * [-4436.921] (-4444.895) (-4437.530) (-4446.836) -- 0:01:57 848500 -- (-4437.324) [-4442.481] (-4428.568) (-4435.525) * [-4437.134] (-4438.011) (-4438.620) (-4438.282) -- 0:01:56 849000 -- (-4447.709) [-4437.108] (-4431.260) (-4432.948) * (-4442.706) [-4440.098] (-4437.895) (-4434.356) -- 0:01:56 849500 -- (-4440.675) (-4444.058) [-4432.878] (-4431.718) * (-4436.722) (-4446.519) (-4441.856) [-4432.125] -- 0:01:55 850000 -- [-4443.411] (-4437.333) (-4439.834) (-4444.085) * (-4442.145) (-4432.351) [-4429.679] (-4440.109) -- 0:01:55 Average standard deviation of split frequencies: 0.007721 850500 -- (-4437.251) (-4432.901) (-4450.187) [-4436.887] * (-4436.113) (-4445.715) (-4438.209) [-4431.417] -- 0:01:55 851000 -- [-4429.002] (-4442.017) (-4448.696) (-4437.595) * (-4438.186) [-4438.059] (-4440.061) (-4438.731) -- 0:01:54 851500 -- [-4430.645] (-4439.821) (-4458.285) (-4440.803) * [-4439.500] (-4449.676) (-4442.166) (-4438.434) -- 0:01:54 852000 -- (-4436.885) (-4448.080) (-4442.621) [-4433.931] * [-4439.949] (-4456.923) (-4435.025) (-4433.885) -- 0:01:53 852500 -- (-4435.054) (-4439.271) (-4448.067) [-4435.535] * (-4444.941) (-4450.190) [-4436.950] (-4437.054) -- 0:01:53 853000 -- [-4436.337] (-4434.033) (-4439.850) (-4436.766) * (-4436.407) (-4451.392) (-4440.901) [-4434.059] -- 0:01:53 853500 -- (-4448.789) (-4438.622) (-4453.075) [-4433.058] * (-4436.832) (-4444.655) (-4444.346) [-4434.580] -- 0:01:52 854000 -- (-4434.323) (-4442.844) (-4444.633) [-4429.683] * (-4434.820) [-4435.825] (-4447.495) (-4445.119) -- 0:01:52 854500 -- (-4440.411) (-4442.316) (-4440.871) [-4434.180] * (-4436.692) (-4436.064) (-4440.121) [-4437.582] -- 0:01:52 855000 -- (-4446.263) (-4441.072) (-4445.744) [-4437.811] * (-4440.690) (-4437.642) (-4432.476) [-4440.350] -- 0:01:51 Average standard deviation of split frequencies: 0.007673 855500 -- [-4433.123] (-4453.525) (-4437.713) (-4443.853) * (-4432.468) (-4438.933) (-4442.468) [-4434.203] -- 0:01:51 856000 -- (-4440.472) [-4442.094] (-4435.688) (-4435.229) * (-4433.574) (-4441.360) [-4436.313] (-4433.961) -- 0:01:50 856500 -- [-4433.963] (-4446.020) (-4441.975) (-4441.520) * (-4452.226) [-4433.236] (-4438.031) (-4440.051) -- 0:01:50 857000 -- (-4441.949) (-4445.447) (-4431.956) [-4442.048] * (-4439.617) [-4432.985] (-4432.546) (-4442.940) -- 0:01:50 857500 -- (-4459.880) (-4434.294) [-4434.636] (-4445.203) * (-4445.711) (-4437.012) [-4431.640] (-4449.025) -- 0:01:49 858000 -- (-4434.143) [-4445.576] (-4448.523) (-4444.820) * (-4436.117) [-4438.799] (-4438.195) (-4449.805) -- 0:01:49 858500 -- (-4454.068) [-4433.685] (-4433.684) (-4450.469) * (-4439.620) [-4429.520] (-4443.067) (-4433.356) -- 0:01:48 859000 -- (-4433.150) (-4430.301) (-4440.867) [-4434.138] * (-4427.637) (-4443.468) (-4445.167) [-4436.107] -- 0:01:48 859500 -- (-4438.198) (-4432.511) [-4438.006] (-4443.132) * (-4439.695) (-4442.233) (-4456.005) [-4434.244] -- 0:01:48 860000 -- (-4430.670) [-4436.127] (-4432.812) (-4436.219) * (-4438.646) (-4443.733) [-4435.687] (-4439.412) -- 0:01:47 Average standard deviation of split frequencies: 0.007339 860500 -- [-4434.008] (-4432.673) (-4442.230) (-4435.143) * (-4443.647) [-4431.033] (-4437.061) (-4433.378) -- 0:01:47 861000 -- (-4442.001) (-4434.469) (-4440.241) [-4433.022] * (-4437.020) (-4433.508) (-4448.611) [-4437.303] -- 0:01:47 861500 -- (-4435.394) (-4432.974) [-4432.528] (-4438.424) * (-4443.863) (-4426.582) (-4437.175) [-4436.598] -- 0:01:46 862000 -- [-4430.931] (-4435.768) (-4437.808) (-4437.773) * (-4433.402) (-4443.570) (-4434.764) [-4429.590] -- 0:01:46 862500 -- (-4430.162) [-4434.707] (-4429.230) (-4439.790) * (-4440.817) (-4444.613) [-4438.989] (-4439.954) -- 0:01:46 863000 -- (-4447.292) [-4435.994] (-4428.371) (-4438.794) * (-4428.871) (-4444.405) [-4437.430] (-4444.248) -- 0:01:45 863500 -- (-4441.877) (-4438.276) [-4440.992] (-4438.133) * (-4437.187) (-4436.151) [-4437.599] (-4439.918) -- 0:01:45 864000 -- (-4434.195) (-4437.127) [-4438.322] (-4452.427) * [-4431.809] (-4429.288) (-4442.792) (-4439.753) -- 0:01:44 864500 -- [-4436.310] (-4435.640) (-4442.821) (-4436.555) * [-4437.710] (-4445.557) (-4440.919) (-4438.645) -- 0:01:44 865000 -- (-4436.568) (-4443.753) (-4442.901) [-4431.273] * (-4446.029) [-4436.806] (-4445.396) (-4434.130) -- 0:01:43 Average standard deviation of split frequencies: 0.007585 865500 -- (-4437.094) (-4443.558) (-4448.324) [-4443.037] * (-4434.421) (-4439.938) [-4441.060] (-4437.765) -- 0:01:43 866000 -- (-4455.459) [-4435.399] (-4432.544) (-4444.313) * (-4437.799) [-4430.781] (-4438.841) (-4431.314) -- 0:01:43 866500 -- (-4441.920) (-4432.183) (-4440.553) [-4445.975] * (-4432.085) (-4438.684) (-4443.141) [-4441.594] -- 0:01:42 867000 -- (-4434.524) [-4434.199] (-4436.030) (-4438.114) * (-4447.564) (-4438.306) (-4442.002) [-4437.282] -- 0:01:42 867500 -- (-4443.482) (-4433.896) (-4445.106) [-4438.362] * (-4433.382) (-4438.944) [-4435.078] (-4432.073) -- 0:01:42 868000 -- (-4444.504) [-4429.804] (-4442.193) (-4439.469) * [-4436.695] (-4437.429) (-4433.816) (-4434.131) -- 0:01:41 868500 -- (-4437.480) (-4438.988) (-4439.083) [-4435.590] * [-4434.962] (-4455.754) (-4443.545) (-4431.027) -- 0:01:41 869000 -- [-4439.512] (-4436.582) (-4436.337) (-4433.842) * (-4441.745) [-4449.097] (-4438.616) (-4433.754) -- 0:01:41 869500 -- (-4438.294) [-4436.098] (-4440.698) (-4444.258) * (-4436.108) (-4434.165) (-4436.289) [-4435.156] -- 0:01:40 870000 -- [-4434.812] (-4443.591) (-4444.551) (-4433.408) * [-4432.647] (-4434.137) (-4439.451) (-4438.007) -- 0:01:40 Average standard deviation of split frequencies: 0.007508 870500 -- [-4438.539] (-4438.619) (-4444.335) (-4435.992) * [-4442.012] (-4431.914) (-4442.227) (-4440.056) -- 0:01:39 871000 -- [-4439.509] (-4432.509) (-4443.234) (-4444.607) * (-4439.534) [-4430.131] (-4435.275) (-4441.538) -- 0:01:39 871500 -- [-4440.499] (-4445.565) (-4452.963) (-4432.534) * [-4435.286] (-4449.895) (-4441.163) (-4435.663) -- 0:01:39 872000 -- (-4449.570) [-4430.223] (-4436.883) (-4432.638) * (-4428.998) (-4432.464) [-4431.020] (-4437.664) -- 0:01:38 872500 -- (-4444.606) (-4432.944) (-4445.302) [-4434.959] * (-4437.724) (-4438.480) (-4433.400) [-4430.842] -- 0:01:38 873000 -- (-4440.797) (-4432.090) [-4435.671] (-4438.503) * (-4445.217) (-4441.285) [-4429.475] (-4429.853) -- 0:01:37 873500 -- [-4435.868] (-4441.442) (-4441.316) (-4448.220) * (-4449.308) [-4431.436] (-4434.928) (-4431.747) -- 0:01:37 874000 -- (-4433.857) [-4433.313] (-4434.657) (-4448.229) * (-4438.747) (-4443.285) [-4440.189] (-4431.335) -- 0:01:37 874500 -- (-4440.679) (-4438.235) (-4439.981) [-4432.665] * (-4452.525) (-4436.755) (-4452.511) [-4433.031] -- 0:01:36 875000 -- [-4434.791] (-4440.604) (-4440.529) (-4442.903) * (-4437.884) [-4437.806] (-4443.353) (-4456.485) -- 0:01:36 Average standard deviation of split frequencies: 0.007677 875500 -- (-4430.126) (-4439.339) (-4439.521) [-4437.819] * (-4436.722) [-4428.917] (-4436.452) (-4451.288) -- 0:01:35 876000 -- [-4441.829] (-4438.709) (-4435.553) (-4438.740) * [-4431.690] (-4440.499) (-4445.086) (-4436.171) -- 0:01:35 876500 -- [-4431.534] (-4435.653) (-4442.135) (-4436.959) * (-4436.244) [-4442.922] (-4453.556) (-4443.405) -- 0:01:35 877000 -- (-4432.087) [-4432.227] (-4439.927) (-4459.523) * (-4432.971) (-4443.279) (-4441.870) [-4432.125] -- 0:01:34 877500 -- [-4437.231] (-4439.466) (-4433.559) (-4444.170) * (-4440.019) (-4439.208) [-4433.864] (-4432.928) -- 0:01:34 878000 -- (-4447.457) (-4440.965) (-4445.879) [-4441.536] * (-4443.996) (-4444.676) [-4428.695] (-4442.289) -- 0:01:34 878500 -- (-4441.851) [-4434.514] (-4443.956) (-4449.571) * (-4440.144) (-4446.271) [-4437.055] (-4440.912) -- 0:01:33 879000 -- (-4438.866) [-4438.763] (-4435.801) (-4447.664) * (-4438.343) (-4442.568) (-4455.638) [-4431.027] -- 0:01:33 879500 -- (-4443.552) (-4440.159) (-4444.921) [-4437.353] * [-4432.988] (-4443.774) (-4449.564) (-4440.390) -- 0:01:32 880000 -- (-4437.260) (-4438.323) [-4438.349] (-4437.285) * (-4442.999) (-4442.992) [-4432.798] (-4437.150) -- 0:01:32 Average standard deviation of split frequencies: 0.006959 880500 -- (-4430.920) (-4436.887) [-4434.065] (-4443.262) * (-4435.252) (-4445.437) (-4441.450) [-4437.450] -- 0:01:32 881000 -- (-4435.765) [-4435.939] (-4438.952) (-4439.830) * (-4437.538) (-4440.056) [-4432.570] (-4441.976) -- 0:01:31 881500 -- (-4436.765) [-4441.626] (-4442.810) (-4439.538) * (-4446.127) (-4436.349) (-4433.421) [-4434.731] -- 0:01:31 882000 -- (-4437.555) [-4444.516] (-4446.149) (-4433.847) * (-4434.963) (-4444.732) [-4436.265] (-4438.527) -- 0:01:30 882500 -- [-4436.086] (-4442.186) (-4444.706) (-4431.950) * [-4440.935] (-4433.146) (-4438.092) (-4440.292) -- 0:01:30 883000 -- [-4434.454] (-4436.118) (-4442.111) (-4433.771) * (-4433.981) [-4427.555] (-4437.867) (-4453.247) -- 0:01:30 883500 -- (-4434.448) [-4436.557] (-4440.834) (-4433.292) * [-4435.560] (-4434.672) (-4441.669) (-4447.020) -- 0:01:29 884000 -- (-4436.695) (-4440.593) (-4432.051) [-4434.296] * (-4441.500) (-4440.080) [-4435.617] (-4445.925) -- 0:01:29 884500 -- [-4435.219] (-4438.827) (-4437.827) (-4438.593) * [-4441.319] (-4435.920) (-4437.714) (-4443.724) -- 0:01:29 885000 -- [-4440.945] (-4436.573) (-4439.546) (-4439.302) * (-4447.438) [-4430.778] (-4433.525) (-4436.143) -- 0:01:28 Average standard deviation of split frequencies: 0.007297 885500 -- (-4430.843) (-4437.981) [-4434.779] (-4441.054) * [-4434.310] (-4435.281) (-4437.073) (-4441.888) -- 0:01:28 886000 -- (-4431.296) [-4430.025] (-4442.603) (-4438.045) * [-4430.251] (-4434.800) (-4433.085) (-4444.734) -- 0:01:27 886500 -- [-4437.468] (-4437.484) (-4434.465) (-4445.899) * (-4434.780) (-4439.883) [-4438.187] (-4437.196) -- 0:01:27 887000 -- (-4436.412) (-4441.032) [-4441.223] (-4451.942) * (-4432.894) [-4433.563] (-4440.058) (-4444.587) -- 0:01:27 887500 -- [-4439.574] (-4445.896) (-4432.309) (-4442.367) * (-4438.830) (-4434.812) (-4442.812) [-4437.107] -- 0:01:26 888000 -- (-4441.926) (-4439.145) (-4432.880) [-4431.681] * [-4435.471] (-4437.537) (-4440.520) (-4444.297) -- 0:01:26 888500 -- (-4446.639) [-4435.489] (-4448.695) (-4446.615) * (-4429.715) (-4436.309) [-4431.751] (-4453.752) -- 0:01:25 889000 -- (-4443.857) [-4433.217] (-4439.076) (-4438.805) * (-4438.689) [-4436.191] (-4440.100) (-4443.333) -- 0:01:25 889500 -- [-4432.265] (-4440.038) (-4446.808) (-4434.153) * (-4439.443) (-4433.402) [-4436.306] (-4438.644) -- 0:01:25 890000 -- (-4447.959) (-4447.878) [-4433.705] (-4435.792) * (-4431.349) (-4431.579) [-4440.979] (-4444.787) -- 0:01:24 Average standard deviation of split frequencies: 0.007334 890500 -- [-4448.617] (-4454.556) (-4443.209) (-4433.953) * (-4445.375) [-4435.688] (-4443.758) (-4438.687) -- 0:01:24 891000 -- (-4436.494) (-4441.773) [-4434.923] (-4436.554) * (-4435.601) [-4441.459] (-4440.536) (-4436.350) -- 0:01:24 891500 -- (-4431.981) [-4433.584] (-4439.969) (-4435.715) * [-4430.936] (-4438.217) (-4451.472) (-4451.965) -- 0:01:23 892000 -- (-4435.912) (-4434.117) (-4439.810) [-4435.263] * [-4442.001] (-4439.986) (-4438.491) (-4441.864) -- 0:01:23 892500 -- (-4435.036) (-4436.499) (-4441.145) [-4432.919] * (-4441.155) (-4432.542) (-4434.422) [-4431.414] -- 0:01:22 893000 -- (-4441.867) (-4451.270) [-4437.791] (-4448.973) * (-4437.864) [-4431.199] (-4439.996) (-4449.711) -- 0:01:22 893500 -- [-4434.139] (-4440.495) (-4438.591) (-4447.682) * [-4435.722] (-4442.478) (-4443.278) (-4438.530) -- 0:01:22 894000 -- (-4451.629) (-4447.931) [-4440.083] (-4439.921) * (-4445.101) (-4438.821) (-4445.516) [-4440.331] -- 0:01:21 894500 -- [-4435.710] (-4437.990) (-4443.050) (-4435.397) * (-4438.775) (-4436.208) [-4439.565] (-4441.840) -- 0:01:21 895000 -- (-4425.488) (-4440.626) [-4432.523] (-4443.096) * (-4450.167) (-4443.232) (-4438.262) [-4444.679] -- 0:01:20 Average standard deviation of split frequencies: 0.007291 895500 -- [-4440.026] (-4443.535) (-4436.865) (-4444.777) * [-4444.400] (-4439.231) (-4440.343) (-4435.016) -- 0:01:20 896000 -- (-4434.691) [-4440.392] (-4444.152) (-4439.642) * [-4433.770] (-4433.783) (-4450.530) (-4430.200) -- 0:01:20 896500 -- (-4436.260) [-4435.196] (-4439.099) (-4445.784) * (-4428.791) (-4435.950) [-4435.206] (-4436.186) -- 0:01:19 897000 -- (-4439.998) [-4432.725] (-4436.833) (-4448.771) * [-4436.454] (-4432.314) (-4431.858) (-4450.703) -- 0:01:19 897500 -- (-4429.844) (-4432.880) [-4430.041] (-4437.211) * [-4429.574] (-4440.790) (-4442.204) (-4436.545) -- 0:01:19 898000 -- (-4433.277) (-4445.518) [-4438.431] (-4443.989) * [-4428.786] (-4443.109) (-4441.039) (-4443.217) -- 0:01:18 898500 -- [-4434.052] (-4439.566) (-4455.318) (-4456.861) * [-4438.578] (-4438.508) (-4449.971) (-4435.724) -- 0:01:18 899000 -- (-4441.545) [-4427.128] (-4439.054) (-4437.735) * (-4459.848) [-4432.240] (-4446.167) (-4439.096) -- 0:01:17 899500 -- (-4443.124) (-4453.283) [-4430.234] (-4440.432) * (-4444.311) [-4435.541] (-4438.665) (-4450.779) -- 0:01:17 900000 -- (-4435.133) (-4433.920) [-4432.413] (-4436.036) * (-4451.662) (-4444.553) (-4433.915) [-4436.822] -- 0:01:17 Average standard deviation of split frequencies: 0.007028 900500 -- (-4440.259) (-4438.064) (-4431.383) [-4435.295] * (-4447.499) (-4434.495) [-4436.950] (-4438.071) -- 0:01:16 901000 -- (-4448.170) (-4434.097) [-4441.932] (-4435.196) * (-4447.082) [-4437.230] (-4438.473) (-4440.828) -- 0:01:16 901500 -- (-4439.854) [-4438.194] (-4446.152) (-4440.391) * (-4430.950) (-4440.854) (-4442.811) [-4441.996] -- 0:01:15 902000 -- [-4441.846] (-4446.432) (-4443.934) (-4439.244) * (-4440.471) [-4437.745] (-4444.384) (-4438.865) -- 0:01:15 902500 -- (-4439.276) (-4428.691) (-4441.600) [-4427.346] * [-4432.627] (-4450.341) (-4449.415) (-4440.222) -- 0:01:15 903000 -- (-4438.349) (-4435.009) [-4433.077] (-4430.840) * [-4434.314] (-4437.486) (-4433.814) (-4433.803) -- 0:01:14 903500 -- [-4435.149] (-4436.828) (-4440.834) (-4434.043) * (-4435.881) (-4439.171) (-4436.480) [-4435.021] -- 0:01:14 904000 -- (-4437.722) (-4443.663) [-4431.471] (-4437.209) * (-4432.347) (-4447.819) (-4436.560) [-4438.688] -- 0:01:14 904500 -- (-4435.262) (-4436.373) [-4424.653] (-4443.081) * [-4430.294] (-4437.641) (-4431.516) (-4434.180) -- 0:01:13 905000 -- [-4439.294] (-4434.513) (-4438.591) (-4443.875) * (-4443.671) (-4439.766) [-4429.474] (-4442.142) -- 0:01:13 Average standard deviation of split frequencies: 0.006764 905500 -- (-4445.771) (-4439.456) (-4432.567) [-4429.323] * [-4433.365] (-4436.129) (-4427.730) (-4437.448) -- 0:01:12 906000 -- (-4447.464) (-4429.922) [-4444.310] (-4439.445) * (-4431.938) (-4445.378) (-4440.807) [-4436.359] -- 0:01:12 906500 -- (-4441.254) [-4433.332] (-4442.178) (-4442.932) * [-4436.261] (-4441.694) (-4442.762) (-4441.307) -- 0:01:12 907000 -- (-4448.034) (-4430.652) (-4447.955) [-4443.211] * [-4438.944] (-4441.469) (-4437.364) (-4441.512) -- 0:01:11 907500 -- (-4442.032) (-4446.567) [-4437.881] (-4432.266) * (-4439.446) (-4433.865) (-4440.343) [-4437.380] -- 0:01:11 908000 -- (-4436.764) [-4437.567] (-4436.925) (-4430.413) * (-4436.440) (-4439.794) (-4441.973) [-4440.899] -- 0:01:10 908500 -- (-4435.646) (-4436.296) (-4436.966) [-4438.369] * [-4434.140] (-4442.116) (-4443.311) (-4444.391) -- 0:01:10 909000 -- (-4441.889) [-4436.806] (-4445.771) (-4445.448) * (-4434.721) (-4433.664) (-4439.440) [-4437.954] -- 0:01:10 909500 -- (-4436.779) (-4432.249) [-4434.325] (-4442.733) * [-4434.209] (-4443.017) (-4437.259) (-4434.976) -- 0:01:09 910000 -- (-4445.927) (-4449.323) [-4446.233] (-4441.401) * [-4431.066] (-4433.012) (-4437.291) (-4438.561) -- 0:01:09 Average standard deviation of split frequencies: 0.006951 910500 -- (-4442.905) [-4433.772] (-4437.973) (-4443.977) * [-4440.233] (-4437.946) (-4436.589) (-4440.659) -- 0:01:09 911000 -- (-4435.648) (-4435.039) [-4436.506] (-4439.037) * (-4440.293) (-4434.185) [-4432.898] (-4455.976) -- 0:01:08 911500 -- (-4436.383) (-4434.759) (-4443.645) [-4433.175] * (-4443.240) [-4430.802] (-4432.182) (-4435.108) -- 0:01:08 912000 -- [-4431.226] (-4435.042) (-4442.557) (-4435.509) * (-4439.558) (-4447.883) (-4437.942) [-4439.151] -- 0:01:07 912500 -- (-4431.749) (-4440.184) (-4452.159) [-4436.045] * (-4445.060) (-4442.929) [-4435.445] (-4440.852) -- 0:01:07 913000 -- (-4444.930) (-4438.397) (-4444.884) [-4435.977] * [-4435.664] (-4445.615) (-4441.679) (-4439.118) -- 0:01:07 913500 -- (-4450.891) (-4433.045) (-4439.364) [-4443.028] * (-4438.654) (-4441.897) [-4438.246] (-4438.704) -- 0:01:06 914000 -- [-4440.279] (-4431.988) (-4438.592) (-4436.334) * (-4434.352) [-4441.744] (-4442.996) (-4442.340) -- 0:01:06 914500 -- [-4433.843] (-4443.352) (-4442.831) (-4439.118) * [-4440.414] (-4439.480) (-4441.102) (-4445.244) -- 0:01:05 915000 -- (-4443.913) [-4430.750] (-4438.250) (-4431.811) * [-4428.921] (-4455.710) (-4440.775) (-4436.317) -- 0:01:05 Average standard deviation of split frequencies: 0.007095 915500 -- (-4429.883) (-4438.812) [-4431.549] (-4442.191) * (-4432.195) [-4429.026] (-4439.302) (-4451.046) -- 0:01:05 916000 -- (-4430.612) [-4430.580] (-4435.723) (-4439.850) * (-4440.708) (-4428.501) (-4436.412) [-4438.539] -- 0:01:04 916500 -- (-4430.237) (-4449.130) [-4434.166] (-4437.091) * (-4442.322) [-4427.077] (-4438.506) (-4444.415) -- 0:01:04 917000 -- (-4438.551) (-4442.700) (-4440.368) [-4443.253] * (-4439.904) (-4446.197) (-4437.049) [-4438.000] -- 0:01:03 917500 -- (-4442.271) (-4441.632) (-4436.381) [-4442.464] * (-4434.674) [-4433.820] (-4437.105) (-4450.855) -- 0:01:03 918000 -- (-4440.018) [-4439.823] (-4436.521) (-4441.494) * (-4442.005) (-4437.296) [-4439.494] (-4446.911) -- 0:01:03 918500 -- (-4437.086) [-4434.418] (-4438.639) (-4435.693) * (-4448.012) [-4433.619] (-4435.943) (-4443.214) -- 0:01:02 919000 -- (-4433.958) (-4445.570) [-4438.506] (-4447.052) * (-4432.760) (-4440.075) (-4442.525) [-4434.616] -- 0:01:02 919500 -- (-4432.816) [-4431.064] (-4438.762) (-4450.503) * (-4442.262) [-4433.825] (-4438.336) (-4437.877) -- 0:01:02 920000 -- (-4429.511) (-4436.158) [-4434.507] (-4443.395) * (-4445.966) (-4434.862) (-4443.557) [-4429.754] -- 0:01:01 Average standard deviation of split frequencies: 0.006729 920500 -- [-4432.066] (-4433.546) (-4447.271) (-4443.431) * [-4436.572] (-4448.367) (-4434.846) (-4443.462) -- 0:01:01 921000 -- (-4430.070) (-4438.349) [-4441.253] (-4440.601) * [-4440.015] (-4441.309) (-4443.813) (-4437.556) -- 0:01:00 921500 -- (-4437.780) (-4432.482) (-4440.022) [-4436.961] * (-4442.628) [-4439.531] (-4444.768) (-4446.998) -- 0:01:00 922000 -- [-4435.954] (-4441.804) (-4440.505) (-4438.263) * (-4440.735) (-4433.941) (-4435.717) [-4432.711] -- 0:01:00 922500 -- (-4434.631) [-4433.798] (-4434.365) (-4430.706) * (-4432.860) [-4428.800] (-4438.536) (-4454.866) -- 0:00:59 923000 -- (-4433.904) (-4440.906) (-4450.760) [-4431.153] * [-4433.138] (-4432.317) (-4439.861) (-4442.343) -- 0:00:59 923500 -- (-4436.227) (-4449.486) (-4439.981) [-4436.630] * (-4450.168) (-4431.434) (-4448.580) [-4442.516] -- 0:00:58 924000 -- (-4438.059) [-4444.697] (-4434.213) (-4443.303) * (-4448.750) (-4441.607) (-4435.212) [-4440.531] -- 0:00:58 924500 -- (-4434.698) (-4447.494) (-4434.696) [-4439.359] * (-4440.028) [-4432.835] (-4438.236) (-4429.871) -- 0:00:58 925000 -- [-4433.657] (-4447.201) (-4441.779) (-4453.314) * (-4439.187) [-4431.753] (-4441.811) (-4441.100) -- 0:00:57 Average standard deviation of split frequencies: 0.006763 925500 -- (-4430.088) (-4434.537) (-4446.005) [-4441.333] * (-4443.659) (-4436.490) [-4437.236] (-4437.943) -- 0:00:57 926000 -- (-4440.196) (-4441.172) [-4435.338] (-4445.600) * (-4437.621) (-4443.491) [-4438.985] (-4426.832) -- 0:00:57 926500 -- (-4443.097) [-4437.914] (-4433.610) (-4434.522) * [-4441.780] (-4431.296) (-4445.461) (-4433.174) -- 0:00:56 927000 -- (-4436.111) (-4433.151) [-4436.222] (-4445.363) * (-4448.863) (-4441.445) [-4431.026] (-4445.772) -- 0:00:56 927500 -- (-4433.134) (-4430.706) [-4436.418] (-4443.723) * [-4426.991] (-4434.578) (-4434.967) (-4440.757) -- 0:00:55 928000 -- [-4440.341] (-4443.486) (-4445.594) (-4436.832) * (-4433.123) [-4435.212] (-4440.974) (-4435.641) -- 0:00:55 928500 -- (-4440.008) (-4438.326) (-4437.800) [-4435.280] * [-4427.734] (-4436.862) (-4434.834) (-4435.035) -- 0:00:55 929000 -- (-4444.092) [-4431.677] (-4442.194) (-4441.389) * (-4435.449) [-4440.143] (-4440.416) (-4440.395) -- 0:00:54 929500 -- (-4436.683) [-4437.422] (-4439.202) (-4433.868) * (-4437.476) (-4446.708) (-4442.789) [-4437.953] -- 0:00:54 930000 -- [-4430.734] (-4442.604) (-4439.388) (-4431.583) * (-4436.171) [-4433.628] (-4451.707) (-4430.474) -- 0:00:53 Average standard deviation of split frequencies: 0.006766 930500 -- [-4438.221] (-4447.188) (-4437.089) (-4436.814) * (-4437.162) (-4435.384) (-4438.201) [-4432.701] -- 0:00:53 931000 -- (-4452.756) (-4443.803) (-4444.950) [-4433.606] * (-4439.289) (-4446.441) (-4440.931) [-4428.708] -- 0:00:53 931500 -- [-4427.336] (-4443.581) (-4435.111) (-4432.560) * (-4436.569) (-4437.181) [-4431.843] (-4442.724) -- 0:00:52 932000 -- (-4440.943) (-4438.339) (-4434.879) [-4451.289] * (-4443.320) (-4446.495) [-4432.333] (-4438.549) -- 0:00:52 932500 -- (-4435.889) (-4437.252) [-4432.120] (-4443.943) * (-4436.715) (-4443.715) (-4431.920) [-4433.315] -- 0:00:52 933000 -- (-4437.419) [-4447.794] (-4435.809) (-4434.721) * (-4438.371) (-4449.907) (-4441.094) [-4432.152] -- 0:00:51 933500 -- [-4432.132] (-4451.857) (-4435.467) (-4439.134) * (-4443.208) (-4453.286) [-4437.873] (-4431.252) -- 0:00:51 934000 -- (-4433.551) (-4435.006) [-4435.104] (-4440.592) * (-4441.773) (-4449.529) [-4428.409] (-4435.243) -- 0:00:50 934500 -- (-4437.620) (-4434.995) [-4434.018] (-4436.592) * [-4437.461] (-4443.760) (-4439.236) (-4442.552) -- 0:00:50 935000 -- [-4434.980] (-4434.170) (-4435.970) (-4441.041) * (-4435.900) (-4446.082) [-4435.118] (-4451.451) -- 0:00:50 Average standard deviation of split frequencies: 0.006763 935500 -- (-4428.356) (-4446.050) [-4431.156] (-4436.994) * [-4438.676] (-4442.171) (-4438.523) (-4430.210) -- 0:00:49 936000 -- (-4450.345) (-4448.408) [-4437.411] (-4436.365) * [-4438.856] (-4445.676) (-4436.438) (-4435.533) -- 0:00:49 936500 -- (-4447.543) (-4454.548) (-4439.127) [-4446.004] * (-4443.239) (-4440.607) (-4437.284) [-4436.156] -- 0:00:48 937000 -- [-4432.385] (-4443.653) (-4436.893) (-4437.367) * (-4438.004) (-4440.247) (-4439.076) [-4429.279] -- 0:00:48 937500 -- [-4436.660] (-4442.680) (-4437.380) (-4434.957) * (-4437.729) (-4437.356) (-4448.395) [-4435.788] -- 0:00:48 938000 -- [-4438.762] (-4442.975) (-4433.220) (-4431.513) * (-4431.825) (-4447.801) [-4439.418] (-4440.414) -- 0:00:47 938500 -- (-4439.271) [-4435.736] (-4441.469) (-4441.342) * (-4440.336) [-4435.134] (-4453.550) (-4442.281) -- 0:00:47 939000 -- (-4441.447) (-4436.901) [-4435.353] (-4438.019) * (-4439.471) (-4447.661) (-4439.830) [-4438.052] -- 0:00:47 939500 -- (-4438.084) (-4439.986) (-4448.467) [-4434.317] * (-4434.123) [-4438.758] (-4446.709) (-4435.882) -- 0:00:46 940000 -- (-4442.398) (-4430.870) (-4440.969) [-4432.963] * (-4433.681) (-4436.695) (-4437.066) [-4431.693] -- 0:00:46 Average standard deviation of split frequencies: 0.006944 940500 -- (-4443.263) [-4449.179] (-4438.337) (-4441.140) * (-4439.642) (-4438.753) [-4432.114] (-4439.089) -- 0:00:45 941000 -- (-4433.615) (-4441.585) (-4441.079) [-4433.421] * [-4434.098] (-4449.979) (-4438.199) (-4443.517) -- 0:00:45 941500 -- (-4436.210) (-4441.742) [-4433.788] (-4440.270) * (-4433.930) (-4446.620) (-4433.058) [-4441.273] -- 0:00:45 942000 -- (-4429.696) [-4437.113] (-4435.936) (-4439.334) * (-4436.932) (-4449.055) (-4435.027) [-4425.017] -- 0:00:44 942500 -- (-4430.958) [-4439.292] (-4438.272) (-4439.023) * (-4432.859) (-4447.001) (-4436.732) [-4438.481] -- 0:00:44 943000 -- (-4436.258) (-4436.654) (-4435.268) [-4436.986] * (-4442.187) (-4441.680) (-4442.308) [-4434.403] -- 0:00:43 943500 -- (-4445.602) [-4428.514] (-4435.310) (-4441.377) * (-4432.961) (-4452.450) [-4437.923] (-4435.252) -- 0:00:43 944000 -- (-4442.272) (-4434.219) [-4433.172] (-4436.837) * (-4430.856) (-4432.203) [-4437.013] (-4444.501) -- 0:00:43 944500 -- (-4432.908) (-4442.082) [-4430.914] (-4437.686) * (-4441.119) (-4444.870) [-4440.317] (-4434.824) -- 0:00:42 945000 -- (-4432.734) (-4436.363) [-4439.014] (-4437.126) * (-4447.274) (-4442.783) [-4442.447] (-4434.646) -- 0:00:42 Average standard deviation of split frequencies: 0.006798 945500 -- [-4435.142] (-4441.819) (-4435.625) (-4441.558) * (-4446.829) (-4448.294) (-4443.672) [-4438.627] -- 0:00:42 946000 -- (-4443.617) (-4446.305) [-4437.324] (-4435.910) * (-4444.779) [-4436.720] (-4448.028) (-4433.324) -- 0:00:41 946500 -- (-4439.237) (-4443.893) [-4439.118] (-4450.201) * (-4441.971) [-4436.635] (-4428.662) (-4429.161) -- 0:00:41 947000 -- [-4441.232] (-4440.468) (-4447.315) (-4440.237) * (-4441.575) (-4442.932) [-4432.494] (-4440.401) -- 0:00:40 947500 -- (-4440.149) [-4437.558] (-4440.263) (-4436.232) * (-4446.306) (-4448.942) [-4436.543] (-4437.951) -- 0:00:40 948000 -- [-4429.114] (-4439.459) (-4436.456) (-4448.568) * [-4437.099] (-4442.245) (-4435.609) (-4452.975) -- 0:00:40 948500 -- (-4441.845) (-4455.464) (-4433.371) [-4436.775] * (-4435.526) (-4431.729) [-4429.027] (-4437.251) -- 0:00:39 949000 -- [-4437.477] (-4438.750) (-4434.809) (-4439.632) * (-4436.055) (-4439.972) (-4442.847) [-4430.416] -- 0:00:39 949500 -- [-4432.110] (-4446.964) (-4440.661) (-4445.586) * [-4438.077] (-4440.450) (-4436.047) (-4455.433) -- 0:00:38 950000 -- (-4438.817) (-4453.793) [-4435.344] (-4443.357) * (-4432.742) [-4431.274] (-4445.773) (-4443.772) -- 0:00:38 Average standard deviation of split frequencies: 0.006765 950500 -- [-4437.943] (-4440.017) (-4439.989) (-4440.412) * (-4436.570) [-4435.204] (-4445.971) (-4443.995) -- 0:00:38 951000 -- (-4435.291) (-4435.610) (-4437.172) [-4436.612] * (-4432.420) [-4435.283] (-4443.430) (-4444.728) -- 0:00:37 951500 -- (-4439.753) (-4434.767) (-4439.774) [-4442.293] * (-4435.163) (-4434.798) [-4439.243] (-4438.275) -- 0:00:37 952000 -- (-4437.434) [-4434.728] (-4432.722) (-4438.138) * (-4434.500) [-4437.392] (-4443.371) (-4428.405) -- 0:00:37 952500 -- (-4440.559) [-4437.740] (-4445.219) (-4444.736) * (-4444.104) (-4433.686) (-4439.086) [-4439.201] -- 0:00:36 953000 -- (-4442.528) (-4436.312) (-4433.549) [-4435.438] * (-4452.650) [-4431.710] (-4432.734) (-4442.840) -- 0:00:36 953500 -- (-4444.443) (-4445.823) [-4431.388] (-4436.866) * [-4438.817] (-4442.291) (-4426.981) (-4435.002) -- 0:00:35 954000 -- (-4447.828) (-4434.710) [-4444.290] (-4442.972) * (-4433.776) (-4451.330) (-4436.802) [-4430.774] -- 0:00:35 954500 -- (-4447.755) [-4427.358] (-4442.815) (-4446.636) * (-4437.265) (-4435.768) (-4446.138) [-4436.924] -- 0:00:35 955000 -- (-4437.946) [-4432.179] (-4435.460) (-4444.970) * (-4431.772) [-4438.229] (-4436.149) (-4443.050) -- 0:00:34 Average standard deviation of split frequencies: 0.006763 955500 -- [-4438.085] (-4444.319) (-4431.675) (-4439.846) * [-4432.848] (-4443.419) (-4443.261) (-4434.078) -- 0:00:34 956000 -- (-4432.577) (-4440.678) [-4434.556] (-4432.454) * [-4428.793] (-4439.596) (-4435.968) (-4436.034) -- 0:00:33 956500 -- (-4441.142) (-4437.517) (-4441.292) [-4433.064] * [-4440.653] (-4438.867) (-4438.727) (-4437.972) -- 0:00:33 957000 -- (-4443.246) (-4450.457) [-4432.623] (-4439.993) * (-4432.799) (-4436.349) [-4439.385] (-4437.177) -- 0:00:33 957500 -- (-4438.970) (-4440.467) [-4435.523] (-4436.170) * (-4444.860) (-4441.451) (-4456.333) [-4441.505] -- 0:00:32 958000 -- (-4441.505) (-4442.694) [-4436.513] (-4440.691) * (-4448.162) (-4441.318) (-4440.405) [-4430.288] -- 0:00:32 958500 -- (-4441.510) [-4439.428] (-4438.262) (-4431.650) * (-4434.431) (-4444.087) [-4432.418] (-4431.968) -- 0:00:31 959000 -- (-4446.197) (-4449.260) (-4437.033) [-4442.158] * (-4432.473) (-4440.099) (-4443.813) [-4435.726] -- 0:00:31 959500 -- (-4446.371) [-4434.719] (-4435.238) (-4449.294) * (-4437.288) [-4430.419] (-4443.985) (-4441.010) -- 0:00:31 960000 -- (-4442.452) (-4441.235) [-4435.174] (-4437.643) * (-4440.615) (-4436.876) (-4433.212) [-4439.987] -- 0:00:30 Average standard deviation of split frequencies: 0.006660 960500 -- (-4438.700) (-4433.564) [-4434.940] (-4438.212) * (-4437.577) (-4446.268) (-4445.347) [-4437.570] -- 0:00:30 961000 -- [-4432.142] (-4442.200) (-4442.378) (-4439.619) * (-4435.231) [-4439.633] (-4436.347) (-4437.164) -- 0:00:30 961500 -- (-4433.780) (-4442.140) [-4434.332] (-4439.794) * [-4438.495] (-4433.987) (-4447.980) (-4443.260) -- 0:00:29 962000 -- [-4437.605] (-4435.771) (-4444.098) (-4441.593) * [-4438.101] (-4432.129) (-4444.779) (-4445.968) -- 0:00:29 962500 -- (-4436.959) [-4440.309] (-4428.658) (-4433.659) * [-4440.666] (-4430.639) (-4440.557) (-4438.983) -- 0:00:28 963000 -- (-4442.347) (-4436.851) [-4435.976] (-4435.294) * [-4436.468] (-4437.475) (-4433.139) (-4441.963) -- 0:00:28 963500 -- (-4441.411) [-4436.606] (-4429.583) (-4433.572) * (-4434.242) [-4437.488] (-4436.147) (-4446.170) -- 0:00:28 964000 -- [-4443.065] (-4435.445) (-4436.471) (-4438.382) * [-4436.571] (-4440.705) (-4437.203) (-4441.757) -- 0:00:27 964500 -- [-4430.065] (-4435.647) (-4431.675) (-4441.544) * [-4431.854] (-4443.265) (-4452.912) (-4435.976) -- 0:00:27 965000 -- [-4432.733] (-4435.368) (-4437.779) (-4443.296) * (-4444.695) (-4444.392) (-4436.868) [-4435.626] -- 0:00:26 Average standard deviation of split frequencies: 0.006414 965500 -- (-4432.755) (-4445.679) [-4433.683] (-4435.313) * [-4432.119] (-4436.397) (-4451.388) (-4436.354) -- 0:00:26 966000 -- (-4437.011) (-4436.771) [-4436.437] (-4443.902) * (-4435.389) [-4431.139] (-4446.665) (-4443.795) -- 0:00:26 966500 -- (-4441.274) [-4431.788] (-4437.081) (-4441.357) * (-4438.524) (-4432.700) [-4430.356] (-4449.183) -- 0:00:25 967000 -- (-4444.571) [-4436.401] (-4434.494) (-4439.636) * [-4434.934] (-4434.424) (-4446.036) (-4449.505) -- 0:00:25 967500 -- (-4440.092) (-4437.748) [-4430.421] (-4444.243) * [-4441.630] (-4436.749) (-4448.934) (-4447.940) -- 0:00:25 968000 -- (-4444.619) [-4433.644] (-4437.409) (-4441.447) * (-4442.829) (-4447.218) (-4450.084) [-4432.949] -- 0:00:24 968500 -- (-4442.558) (-4441.754) (-4441.596) [-4446.463] * [-4435.004] (-4444.877) (-4433.001) (-4447.216) -- 0:00:24 969000 -- (-4445.786) [-4432.723] (-4445.926) (-4436.425) * [-4439.840] (-4437.079) (-4439.312) (-4434.614) -- 0:00:23 969500 -- (-4443.475) (-4433.497) (-4444.286) [-4431.999] * (-4450.751) [-4439.604] (-4437.603) (-4443.616) -- 0:00:23 970000 -- (-4442.688) [-4443.438] (-4440.576) (-4440.910) * (-4437.835) (-4451.197) [-4433.216] (-4446.945) -- 0:00:23 Average standard deviation of split frequencies: 0.006383 970500 -- (-4447.571) [-4433.569] (-4438.054) (-4432.355) * (-4435.577) [-4442.651] (-4432.913) (-4444.994) -- 0:00:22 971000 -- (-4433.476) [-4429.688] (-4431.862) (-4445.852) * (-4452.045) (-4434.173) [-4439.786] (-4443.011) -- 0:00:22 971500 -- (-4440.179) (-4441.651) (-4431.354) [-4438.900] * [-4439.709] (-4437.408) (-4441.652) (-4437.252) -- 0:00:21 972000 -- (-4451.159) (-4436.860) [-4430.652] (-4447.798) * [-4436.880] (-4440.623) (-4442.701) (-4452.239) -- 0:00:21 972500 -- (-4438.543) (-4436.397) [-4431.979] (-4446.824) * (-4438.271) (-4442.901) (-4437.244) [-4438.219] -- 0:00:21 973000 -- (-4437.402) (-4437.148) [-4438.427] (-4444.744) * [-4436.662] (-4443.347) (-4439.022) (-4431.035) -- 0:00:20 973500 -- [-4436.740] (-4436.873) (-4434.904) (-4441.718) * (-4442.260) (-4431.452) [-4432.329] (-4434.295) -- 0:00:20 974000 -- (-4434.600) [-4438.465] (-4439.532) (-4442.425) * (-4437.397) (-4434.355) (-4450.950) [-4434.835] -- 0:00:20 974500 -- [-4430.147] (-4433.822) (-4439.240) (-4437.833) * (-4438.700) [-4430.854] (-4438.172) (-4426.244) -- 0:00:19 975000 -- (-4431.357) (-4439.372) (-4441.039) [-4435.504] * [-4432.675] (-4438.254) (-4437.439) (-4446.335) -- 0:00:19 Average standard deviation of split frequencies: 0.005934 975500 -- (-4443.754) [-4433.873] (-4445.048) (-4438.805) * (-4437.459) [-4432.494] (-4448.201) (-4432.788) -- 0:00:18 976000 -- (-4437.741) (-4445.593) (-4449.652) [-4434.610] * (-4440.223) [-4431.915] (-4434.884) (-4433.573) -- 0:00:18 976500 -- [-4437.229] (-4442.785) (-4438.845) (-4440.298) * (-4436.828) [-4430.308] (-4434.353) (-4432.476) -- 0:00:18 977000 -- (-4436.176) (-4448.282) (-4435.692) [-4434.262] * (-4444.366) (-4434.796) (-4432.650) [-4430.927] -- 0:00:17 977500 -- [-4438.753] (-4447.853) (-4436.363) (-4443.118) * (-4437.111) (-4433.360) [-4433.021] (-4441.917) -- 0:00:17 978000 -- (-4444.844) (-4439.370) [-4430.735] (-4437.179) * (-4435.673) (-4440.009) (-4436.377) [-4441.559] -- 0:00:16 978500 -- (-4435.533) (-4447.421) (-4436.628) [-4438.765] * (-4437.296) (-4429.636) [-4438.966] (-4441.718) -- 0:00:16 979000 -- [-4436.723] (-4435.072) (-4433.366) (-4437.139) * [-4433.651] (-4431.643) (-4439.289) (-4434.460) -- 0:00:16 979500 -- (-4434.022) (-4437.784) [-4438.372] (-4447.189) * (-4439.326) [-4435.324] (-4433.313) (-4435.976) -- 0:00:15 980000 -- (-4437.540) [-4437.698] (-4437.773) (-4443.699) * (-4451.729) (-4438.034) [-4435.149] (-4436.996) -- 0:00:15 Average standard deviation of split frequencies: 0.005974 980500 -- (-4445.651) (-4438.286) (-4445.574) [-4436.105] * (-4440.857) [-4440.936] (-4439.782) (-4435.198) -- 0:00:15 981000 -- [-4438.681] (-4443.580) (-4440.743) (-4445.901) * (-4451.101) [-4441.051] (-4453.312) (-4437.057) -- 0:00:14 981500 -- (-4433.617) (-4450.857) [-4438.153] (-4444.814) * [-4440.178] (-4440.688) (-4446.386) (-4436.553) -- 0:00:14 982000 -- (-4440.289) (-4432.185) [-4439.486] (-4442.125) * (-4438.836) (-4435.002) (-4444.447) [-4431.892] -- 0:00:13 982500 -- (-4449.123) (-4447.822) (-4451.875) [-4437.865] * [-4434.221] (-4445.688) (-4433.677) (-4438.036) -- 0:00:13 983000 -- (-4440.549) [-4437.461] (-4441.209) (-4443.854) * (-4440.101) (-4438.100) [-4438.141] (-4448.247) -- 0:00:13 983500 -- (-4438.820) [-4433.071] (-4437.601) (-4444.550) * (-4432.851) [-4429.826] (-4440.192) (-4434.739) -- 0:00:12 984000 -- (-4437.549) [-4435.556] (-4452.544) (-4434.576) * [-4434.176] (-4436.838) (-4435.581) (-4436.812) -- 0:00:12 984500 -- [-4438.329] (-4448.837) (-4448.912) (-4445.883) * (-4441.523) [-4432.419] (-4433.676) (-4438.032) -- 0:00:11 985000 -- (-4439.456) (-4438.145) (-4437.643) [-4430.722] * (-4445.975) (-4440.896) (-4437.366) [-4432.856] -- 0:00:11 Average standard deviation of split frequencies: 0.005703 985500 -- (-4435.967) [-4439.148] (-4443.519) (-4444.013) * (-4444.057) [-4447.132] (-4436.329) (-4436.063) -- 0:00:11 986000 -- (-4440.552) (-4439.439) (-4436.031) [-4434.782] * (-4440.908) (-4442.588) [-4437.522] (-4430.337) -- 0:00:10 986500 -- (-4435.670) [-4436.428] (-4434.588) (-4443.441) * (-4449.947) (-4438.054) (-4437.848) [-4429.973] -- 0:00:10 987000 -- (-4442.131) (-4430.955) (-4442.847) [-4433.737] * (-4444.852) (-4445.624) (-4434.428) [-4435.927] -- 0:00:10 987500 -- (-4441.876) [-4430.269] (-4440.332) (-4443.594) * (-4449.759) (-4447.580) [-4437.608] (-4443.130) -- 0:00:09 988000 -- (-4450.262) (-4442.488) (-4439.986) [-4436.172] * (-4437.210) [-4434.576] (-4439.090) (-4431.480) -- 0:00:09 988500 -- (-4442.475) (-4447.005) (-4441.013) [-4437.030] * (-4440.261) (-4448.703) [-4445.031] (-4443.757) -- 0:00:08 989000 -- (-4445.127) (-4437.376) [-4435.214] (-4432.593) * (-4440.531) (-4445.773) [-4436.329] (-4445.256) -- 0:00:08 989500 -- (-4440.805) (-4435.204) (-4435.470) [-4431.737] * [-4438.439] (-4437.917) (-4436.304) (-4440.419) -- 0:00:08 990000 -- [-4442.253] (-4438.416) (-4438.537) (-4443.766) * (-4437.236) [-4434.859] (-4443.424) (-4437.398) -- 0:00:07 Average standard deviation of split frequencies: 0.005846 990500 -- [-4437.833] (-4433.205) (-4440.329) (-4443.553) * (-4441.917) (-4441.076) (-4442.959) [-4446.808] -- 0:00:07 991000 -- (-4433.293) (-4434.842) (-4437.193) [-4434.923] * (-4440.163) (-4436.620) [-4434.168] (-4437.901) -- 0:00:06 991500 -- (-4440.371) [-4434.396] (-4442.563) (-4443.994) * (-4435.424) [-4437.618] (-4435.294) (-4454.562) -- 0:00:06 992000 -- [-4435.666] (-4438.756) (-4435.973) (-4442.806) * (-4436.680) [-4443.716] (-4433.551) (-4445.770) -- 0:00:06 992500 -- (-4442.980) (-4436.253) (-4439.168) [-4436.633] * (-4440.114) (-4446.416) [-4437.917] (-4429.994) -- 0:00:05 993000 -- [-4431.765] (-4455.749) (-4445.502) (-4434.336) * [-4430.850] (-4441.015) (-4436.087) (-4438.902) -- 0:00:05 993500 -- [-4430.484] (-4438.542) (-4441.610) (-4442.661) * (-4441.141) (-4441.717) (-4438.226) [-4435.353] -- 0:00:05 994000 -- (-4431.868) (-4439.086) [-4433.804] (-4446.256) * (-4443.732) (-4439.032) (-4438.811) [-4445.038] -- 0:00:04 994500 -- [-4442.119] (-4433.693) (-4440.618) (-4443.821) * (-4439.061) (-4441.965) (-4444.939) [-4433.350] -- 0:00:04 995000 -- (-4441.604) (-4444.198) [-4436.573] (-4444.186) * (-4442.301) (-4449.566) (-4440.119) [-4434.914] -- 0:00:03 Average standard deviation of split frequencies: 0.005950 995500 -- [-4439.868] (-4430.248) (-4438.416) (-4446.029) * (-4443.789) (-4437.620) [-4441.050] (-4433.746) -- 0:00:03 996000 -- (-4454.280) (-4431.163) (-4442.405) [-4437.375] * (-4436.935) (-4438.016) (-4438.539) [-4437.591] -- 0:00:03 996500 -- (-4439.552) [-4427.501] (-4441.972) (-4434.917) * (-4445.884) [-4437.444] (-4450.896) (-4437.313) -- 0:00:02 997000 -- (-4440.919) [-4435.278] (-4465.031) (-4439.067) * (-4438.629) (-4435.773) (-4435.220) [-4432.979] -- 0:00:02 997500 -- (-4438.193) [-4435.259] (-4439.539) (-4450.079) * [-4433.097] (-4441.041) (-4441.890) (-4438.101) -- 0:00:01 998000 -- (-4434.782) [-4431.930] (-4438.679) (-4440.189) * (-4434.059) [-4442.712] (-4435.407) (-4441.421) -- 0:00:01 998500 -- (-4433.662) (-4444.942) [-4439.963] (-4436.167) * (-4437.014) (-4441.378) [-4427.945] (-4432.464) -- 0:00:01 999000 -- (-4435.531) (-4439.281) (-4434.023) [-4442.193] * (-4435.701) [-4434.925] (-4453.528) (-4430.203) -- 0:00:00 999500 -- (-4440.181) [-4431.811] (-4434.602) (-4443.488) * (-4442.040) (-4446.394) (-4439.349) [-4427.753] -- 0:00:00 1000000 -- (-4442.221) (-4435.666) [-4436.303] (-4438.838) * (-4432.655) [-4443.633] (-4434.570) (-4434.721) -- 0:00:00 Average standard deviation of split frequencies: 0.005726 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -4442.220707 -- 9.527182 Chain 1 -- -4442.220675 -- 9.527182 Chain 2 -- -4435.665651 -- 10.666725 Chain 2 -- -4435.665651 -- 10.666725 Chain 3 -- -4436.302524 -- 11.086548 Chain 3 -- -4436.302559 -- 11.086548 Chain 4 -- -4438.838455 -- 6.556997 Chain 4 -- -4438.838398 -- 6.556997 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -4432.655411 -- 8.215000 Chain 1 -- -4432.655407 -- 8.215000 Chain 2 -- -4443.632621 -- 15.043975 Chain 2 -- -4443.632660 -- 15.043975 Chain 3 -- -4434.569811 -- 10.798367 Chain 3 -- -4434.569845 -- 10.798367 Chain 4 -- -4434.720531 -- 10.376082 Chain 4 -- -4434.720572 -- 10.376082 Analysis completed in 12 mins 51 seconds Analysis used 770.66 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -4423.10 Likelihood of best state for "cold" chain of run 2 was -4423.10 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 31.1 % ( 27 %) Dirichlet(Revmat{all}) 46.5 % ( 21 %) Slider(Revmat{all}) 22.5 % ( 29 %) Dirichlet(Pi{all}) 26.1 % ( 34 %) Slider(Pi{all}) 25.9 % ( 25 %) Multiplier(Alpha{1,2}) 37.9 % ( 27 %) Multiplier(Alpha{3}) 41.0 % ( 24 %) Slider(Pinvar{all}) 10.2 % ( 14 %) ExtSPR(Tau{all},V{all}) 2.2 % ( 4 %) ExtTBR(Tau{all},V{all}) 13.5 % ( 17 %) NNI(Tau{all},V{all}) 9.7 % ( 12 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 20 %) Multiplier(V{all}) 31.3 % ( 32 %) Nodeslider(V{all}) 24.8 % ( 27 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 31.3 % ( 26 %) Dirichlet(Revmat{all}) 47.4 % ( 35 %) Slider(Revmat{all}) 22.4 % ( 31 %) Dirichlet(Pi{all}) 25.8 % ( 26 %) Slider(Pi{all}) 26.2 % ( 19 %) Multiplier(Alpha{1,2}) 37.8 % ( 27 %) Multiplier(Alpha{3}) 40.8 % ( 27 %) Slider(Pinvar{all}) 10.1 % ( 11 %) ExtSPR(Tau{all},V{all}) 2.4 % ( 1 %) ExtTBR(Tau{all},V{all}) 13.6 % ( 7 %) NNI(Tau{all},V{all}) 9.7 % ( 7 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 21 %) Multiplier(V{all}) 31.6 % ( 34 %) Nodeslider(V{all}) 24.6 % ( 30 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.76 0.56 0.41 2 | 166316 0.78 0.60 3 | 166486 167151 0.80 4 | 166563 167154 166330 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.76 0.56 0.41 2 | 166692 0.78 0.59 3 | 167216 167307 0.80 4 | 166594 166147 166044 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -4433.85 | 2 1 2 | | 2 2 | | 1 2 * 1 2 2 | | 1 2 2 1 1 | |1 12 1 * 1 21 2 1 2 | | * 1 2 1 2 2 11 2 1 1| |2 1 2 2 1 2 1 * 21 2 2 2 1 | | 2 1 2 1 2 2 1 12 2 1 *22 | | 2 111 12 * 1 1 1 1* 1 1 1 2 1 1 | | 1 2 1 12 2 1 1 | | 2 1 2 1 2 2 1 | | 2 1 2| | * 2 2 2 2 | | 1 2 1 | | 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -4438.18 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -4430.02 -4447.74 2 -4430.19 -4445.02 -------------------------------------- TOTAL -4430.10 -4447.11 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.620457 0.014000 1.396620 1.859078 1.615321 1323.57 1326.57 1.000 r(A<->C){all} 0.121403 0.000312 0.087439 0.156438 0.120534 1127.55 1142.89 1.001 r(A<->G){all} 0.279533 0.000942 0.220369 0.339272 0.278326 882.86 884.36 1.000 r(A<->T){all} 0.086000 0.000493 0.045637 0.129382 0.084810 860.08 927.98 1.000 r(C<->G){all} 0.042756 0.000072 0.027911 0.060683 0.042070 1119.96 1178.12 1.000 r(C<->T){all} 0.401755 0.001052 0.337355 0.463942 0.401372 823.13 832.60 1.002 r(G<->T){all} 0.068553 0.000167 0.044216 0.094335 0.067917 1143.45 1176.90 1.000 pi(A){all} 0.170142 0.000109 0.149423 0.189882 0.170042 1108.74 1169.05 1.000 pi(C){all} 0.329307 0.000157 0.304992 0.354699 0.329219 993.97 1021.39 1.000 pi(G){all} 0.280788 0.000161 0.256565 0.306325 0.280661 1000.62 1176.46 1.000 pi(T){all} 0.219763 0.000126 0.198288 0.242065 0.219560 890.75 993.60 1.003 alpha{1,2} 0.127970 0.000127 0.106339 0.149635 0.126989 1364.49 1432.74 1.000 alpha{3} 3.170872 0.619212 1.876519 4.761786 3.064193 1280.18 1347.57 1.000 pinvar{all} 0.291495 0.001539 0.219276 0.370737 0.292728 962.63 1134.57 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 11 -- C11 12 -- C12 Key to taxon bipartitions (saved to file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------------ 1 -- .*********** 2 -- .*.......... 3 -- ..*......... 4 -- ...*........ 5 -- ....*....... 6 -- .....*...... 7 -- ......*..... 8 -- .......*.... 9 -- ........*... 10 -- .........*.. 11 -- ..........*. 12 -- ...........* 13 -- .....******* 14 -- ...********* 15 -- .........**. 16 -- .....**..... 17 -- .**......... 18 -- ...*.******* 19 -- .....**....* 20 -- ........***. 21 -- .....***...* 22 -- .....**.**** 23 -- .....***.*** 24 -- .......****. 25 -- .....**..*** ------------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 13 3002 1.000000 0.000000 1.000000 1.000000 2 14 3002 1.000000 0.000000 1.000000 1.000000 2 15 2948 0.982012 0.005653 0.978015 0.986009 2 16 2928 0.975350 0.000942 0.974684 0.976016 2 17 2912 0.970020 0.000000 0.970020 0.970020 2 18 2709 0.902398 0.010835 0.894737 0.910060 2 19 2660 0.886076 0.002827 0.884077 0.888075 2 20 1760 0.586276 0.001884 0.584943 0.587608 2 21 1083 0.360759 0.017430 0.348434 0.373085 2 22 782 0.260493 0.011306 0.252498 0.268488 2 23 690 0.229847 0.011306 0.221852 0.237841 2 24 570 0.189873 0.000000 0.189873 0.189873 2 25 558 0.185876 0.012248 0.177215 0.194537 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.026408 0.000059 0.012383 0.041271 0.025636 1.000 2 length{all}[2] 0.019661 0.000037 0.008345 0.031176 0.019131 1.000 2 length{all}[3] 0.008578 0.000017 0.001570 0.016744 0.007980 1.000 2 length{all}[4] 0.045901 0.000133 0.024278 0.068138 0.045088 1.000 2 length{all}[5] 0.070869 0.000203 0.044054 0.098850 0.069663 1.000 2 length{all}[6] 0.125382 0.000484 0.087066 0.170954 0.123670 1.000 2 length{all}[7] 0.067361 0.000246 0.037772 0.098509 0.066482 1.000 2 length{all}[8] 0.266470 0.001451 0.196797 0.341804 0.264388 1.000 2 length{all}[9] 0.377956 0.002565 0.282757 0.479144 0.375350 1.000 2 length{all}[10] 0.134815 0.000553 0.091900 0.180936 0.133408 1.000 2 length{all}[11] 0.108589 0.000426 0.070669 0.148125 0.106838 1.000 2 length{all}[12] 0.069000 0.000231 0.042507 0.100275 0.067694 1.000 2 length{all}[13] 0.103456 0.000525 0.058034 0.146880 0.102499 1.000 2 length{all}[14] 0.055864 0.000173 0.031704 0.082478 0.054646 1.000 2 length{all}[15] 0.034396 0.000236 0.006642 0.063918 0.032925 1.000 2 length{all}[16] 0.029123 0.000127 0.008916 0.050799 0.027508 1.000 2 length{all}[17] 0.009354 0.000026 0.000724 0.019252 0.008567 1.000 2 length{all}[18] 0.014892 0.000055 0.001814 0.028960 0.013924 1.000 2 length{all}[19] 0.020183 0.000098 0.002997 0.038921 0.019032 1.000 2 length{all}[20] 0.020172 0.000148 0.000573 0.042570 0.018065 0.999 2 length{all}[21] 0.014234 0.000090 0.000001 0.031699 0.012996 0.999 2 length{all}[22] 0.016160 0.000137 0.000051 0.038018 0.014438 1.000 2 length{all}[23] 0.023775 0.000251 0.000028 0.052424 0.021469 0.999 2 length{all}[24] 0.009783 0.000052 0.000225 0.023200 0.008122 1.000 2 length{all}[25] 0.015603 0.000110 0.000036 0.034953 0.013550 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005726 Maximum standard deviation of split frequencies = 0.017430 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.000 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | | /----------------------------------------------- C4 (4) | | | | /------------ C6 (6) | | /----98----+ | | | \------------ C7 (7) | /----90----+ /-----89----+ | | | | \----------------------- C12 (12) | | | | | | | |----------------------------------- C8 (8) + | \----100----+ | | | /----------------------- C9 (9) |----100----+ | | | | \-----59----+ /------------ C10 (10) | | \----98----+ | | \------------ C11 (11) | | | \---------------------------------------------------------- C5 (5) | | /------------ C2 (2) \----------------------------97---------------------------+ \------------ C3 (3) Phylogram (based on average branch lengths): /--- C1 (1) | | /----- C4 (4) | | | | /---------------- C6 (6) | | /---+ | | | \-------- C7 (7) | /-+ /-+ | | | | \--------- C12 (12) | | | | | | | |---------------------------------- C8 (8) + | \------------+ | | | /------------------------------------------------ C9 (9) |------+ | | | | \-+ /----------------- C10 (10) | | \---+ | | \-------------- C11 (11) | | | \--------- C5 (5) | |/--- C2 (2) \+ \- C3 (3) |-----------| 0.100 expected changes per site Calculating tree probabilities... Credible sets of trees (136 trees sampled): 50 % credible set contains 4 trees 90 % credible set contains 28 trees 95 % credible set contains 50 trees 99 % credible set contains 106 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 12 ls = 1149 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Reading seq #11: C11 Reading seq #12: C12 Sites with gaps or missing data are removed. 45 ambiguity characters in seq. 1 45 ambiguity characters in seq. 2 45 ambiguity characters in seq. 3 42 ambiguity characters in seq. 4 45 ambiguity characters in seq. 5 39 ambiguity characters in seq. 6 45 ambiguity characters in seq. 7 51 ambiguity characters in seq. 8 33 ambiguity characters in seq. 9 51 ambiguity characters in seq. 10 33 ambiguity characters in seq. 11 51 ambiguity characters in seq. 12 19 sites are removed. 13 14 15 16 17 18 189 193 194 195 196 197 198 378 379 380 381 382 383 Sequences read.. Counting site patterns.. 0:00 276 patterns at 364 / 364 sites (100.0%), 0:00 Counting codons.. NG distances for seqs.: 1 2 3 4 5 6 7 8 9 10 11 12 528 bytes for distance 269376 bytes for conP 37536 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 1212192 bytes for conP, adjusted 0.031954 0.052478 0.004792 0.087449 0.112440 0.002514 0.008839 0.130896 0.122580 0.106764 0.398954 0.019120 0.409760 0.041820 0.185890 0.128680 0.122292 0.014101 0.027593 0.011459 0.300000 1.300000 ntime & nrate & np: 20 2 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 22 lnL0 = -5402.909777 Iterating by ming2 Initial: fx= 5402.909777 x= 0.03195 0.05248 0.00479 0.08745 0.11244 0.00251 0.00884 0.13090 0.12258 0.10676 0.39895 0.01912 0.40976 0.04182 0.18589 0.12868 0.12229 0.01410 0.02759 0.01146 0.30000 1.30000 1 h-m-p 0.0000 0.0002 2225.8508 ++YCCCCC 5328.445113 5 0.0001 38 | 0/22 2 h-m-p 0.0001 0.0005 947.6615 ++ 5101.077696 m 0.0005 63 | 0/22 3 h-m-p 0.0000 0.0000 16842.1181 +YYYYC 5058.387939 4 0.0000 93 | 0/22 4 h-m-p 0.0000 0.0000 16672.7850 +CYCCCC 4898.393836 5 0.0000 128 | 0/22 5 h-m-p 0.0000 0.0002 5420.6440 ++ 4547.023310 m 0.0002 153 | 0/22 6 h-m-p 0.0000 0.0000 4683.7540 h-m-p: 5.87897384e-21 2.93948692e-20 4.68375395e+03 4547.023310 .. | 0/22 7 h-m-p 0.0000 0.0001 2428.3797 ++ 4418.339023 m 0.0001 200 | 0/22 8 h-m-p 0.0000 0.0001 2665.0520 +YYYYYYCC 4300.842232 7 0.0001 234 | 0/22 9 h-m-p 0.0000 0.0001 586.6791 CYCCCC 4296.453929 5 0.0000 268 | 0/22 10 h-m-p 0.0000 0.0003 580.6383 +YCYYCCC 4265.747406 6 0.0002 304 | 0/22 11 h-m-p 0.0000 0.0000 1141.8218 +YYYCC 4260.526050 4 0.0000 335 | 0/22 12 h-m-p 0.0001 0.0005 155.8747 YCCC 4259.202383 3 0.0001 365 | 0/22 13 h-m-p 0.0001 0.0009 199.9657 CYC 4257.996326 2 0.0001 393 | 0/22 14 h-m-p 0.0002 0.0013 164.5220 CCC 4256.503267 2 0.0003 422 | 0/22 15 h-m-p 0.0001 0.0004 158.6051 YCCC 4255.656574 3 0.0002 452 | 0/22 16 h-m-p 0.0002 0.0013 148.6559 CCC 4254.697325 2 0.0003 481 | 0/22 17 h-m-p 0.0004 0.0038 99.0882 YCCC 4253.390291 3 0.0007 511 | 0/22 18 h-m-p 0.0003 0.0021 241.2723 CCC 4251.841098 2 0.0004 540 | 0/22 19 h-m-p 0.0007 0.0048 128.6404 CCC 4250.097695 2 0.0009 569 | 0/22 20 h-m-p 0.0006 0.0063 180.1401 YCCC 4246.464048 3 0.0015 599 | 0/22 21 h-m-p 0.0009 0.0051 280.3099 CCCC 4242.231706 3 0.0011 630 | 0/22 22 h-m-p 0.0008 0.0038 170.1628 YCCCC 4238.743773 4 0.0016 662 | 0/22 23 h-m-p 0.0010 0.0050 155.2267 YCCC 4237.748107 3 0.0006 692 | 0/22 24 h-m-p 0.0026 0.0128 31.1855 CCC 4237.518041 2 0.0009 721 | 0/22 25 h-m-p 0.0034 0.0296 7.7141 YC 4237.461549 1 0.0014 747 | 0/22 26 h-m-p 0.0036 0.1521 3.0116 YCC 4237.286462 2 0.0064 775 | 0/22 27 h-m-p 0.0036 0.0605 5.3649 +YCCCC 4234.641754 4 0.0150 808 | 0/22 28 h-m-p 0.0021 0.0106 38.6784 +CYCCC 4195.676945 4 0.0099 842 | 0/22 29 h-m-p 0.0007 0.0034 25.4966 CYC 4195.463462 2 0.0007 870 | 0/22 30 h-m-p 0.1704 6.3495 0.1000 +YCCC 4189.921970 3 1.2128 901 | 0/22 31 h-m-p 0.1198 0.5988 0.2882 +YYCCCC 4182.802372 5 0.3746 957 | 0/22 32 h-m-p 0.2638 1.3191 0.2242 +YYYYC 4169.455170 4 1.0309 1009 | 0/22 33 h-m-p 0.1980 0.9898 0.1365 +YCCCC 4165.277967 4 0.6113 1064 | 0/22 34 h-m-p 0.3829 1.9143 0.1735 YCCC 4162.920929 3 0.2637 1116 | 0/22 35 h-m-p 0.5956 2.9778 0.0359 CCCC 4161.842147 3 0.9518 1169 | 0/22 36 h-m-p 1.6000 8.0000 0.0204 YC 4161.756889 1 0.9528 1217 | 0/22 37 h-m-p 1.6000 8.0000 0.0070 YC 4161.751240 1 0.7597 1265 | 0/22 38 h-m-p 1.4964 8.0000 0.0036 YC 4161.750193 1 1.1863 1313 | 0/22 39 h-m-p 1.6000 8.0000 0.0005 YC 4161.750046 1 1.0425 1361 | 0/22 40 h-m-p 1.6000 8.0000 0.0002 Y 4161.750027 0 0.9848 1408 | 0/22 41 h-m-p 0.8552 8.0000 0.0002 C 4161.750024 0 1.1654 1455 | 0/22 42 h-m-p 1.6000 8.0000 0.0001 Y 4161.750023 0 1.2555 1502 | 0/22 43 h-m-p 1.6000 8.0000 0.0000 C 4161.750023 0 1.3559 1549 | 0/22 44 h-m-p 1.6000 8.0000 0.0000 C 4161.750023 0 1.6000 1596 | 0/22 45 h-m-p 1.6000 8.0000 0.0000 --------Y 4161.750023 0 0.0000 1651 Out.. lnL = -4161.750023 1652 lfun, 1652 eigenQcodon, 33040 P(t) Time used: 0:17 Model 1: NearlyNeutral TREE # 1 (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 0.031954 0.052478 0.004792 0.087449 0.112440 0.002514 0.008839 0.130896 0.122580 0.106764 0.398954 0.019120 0.409760 0.041820 0.185890 0.128680 0.122292 0.014101 0.027593 0.011459 3.380222 0.500545 0.139499 ntime & nrate & np: 20 2 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 4.678645 np = 23 lnL0 = -4506.964065 Iterating by ming2 Initial: fx= 4506.964065 x= 0.03195 0.05248 0.00479 0.08745 0.11244 0.00251 0.00884 0.13090 0.12258 0.10676 0.39895 0.01912 0.40976 0.04182 0.18589 0.12868 0.12229 0.01410 0.02759 0.01146 3.38022 0.50054 0.13950 1 h-m-p 0.0000 0.0002 2348.8509 +++ 4283.092918 m 0.0002 29 | 0/23 2 h-m-p 0.0001 0.0003 3561.3586 -YYYCC 4276.984658 4 0.0000 61 | 0/23 3 h-m-p 0.0000 0.0004 701.5788 ++CCCC 4185.525664 3 0.0004 95 | 0/23 4 h-m-p 0.0001 0.0003 527.9405 CYCCC 4183.276851 4 0.0000 128 | 0/23 5 h-m-p 0.0000 0.0002 196.9428 +YYYY 4179.969768 3 0.0002 158 | 0/23 6 h-m-p 0.0001 0.0004 428.3382 YCCCC 4174.061039 4 0.0002 191 | 0/23 7 h-m-p 0.0001 0.0006 289.2237 CCCC 4171.571561 3 0.0002 223 | 0/23 8 h-m-p 0.0002 0.0011 141.3482 CCCC 4169.957723 3 0.0003 255 | 0/23 9 h-m-p 0.0005 0.0027 63.2157 CC 4169.223133 1 0.0005 283 | 0/23 10 h-m-p 0.0006 0.0035 56.3607 CCC 4168.679241 2 0.0006 313 | 0/23 11 h-m-p 0.0014 0.0157 25.2814 YC 4168.466111 1 0.0010 340 | 0/23 12 h-m-p 0.0015 0.0251 16.5348 C 4168.327604 0 0.0015 366 | 0/23 13 h-m-p 0.0027 0.0255 9.4501 YC 4168.277396 1 0.0014 393 | 0/23 14 h-m-p 0.0014 0.0292 9.7642 CC 4168.216038 1 0.0019 421 | 0/23 15 h-m-p 0.0012 0.0534 16.1567 +YCC 4168.041410 2 0.0034 451 | 0/23 16 h-m-p 0.0017 0.0267 33.4113 CC 4167.865178 1 0.0017 479 | 0/23 17 h-m-p 0.0011 0.0251 50.5124 +CCC 4167.081958 2 0.0048 510 | 0/23 18 h-m-p 0.0026 0.0129 88.6877 YCC 4166.562905 2 0.0018 539 | 0/23 19 h-m-p 0.0015 0.0220 108.1076 CC 4165.949151 1 0.0018 567 | 0/23 20 h-m-p 0.0099 0.0496 17.0856 CC 4165.829870 1 0.0021 595 | 0/23 21 h-m-p 0.0191 0.1414 1.8507 YYC 4165.576001 2 0.0147 623 | 0/23 22 h-m-p 0.0103 0.1500 2.6439 ++ 4135.045814 m 0.1500 649 | 0/23 23 h-m-p 0.0001 0.0003 284.8145 +YCYCCC 4131.442276 5 0.0002 684 | 0/23 24 h-m-p 0.0010 0.0048 16.2950 CCC 4131.254416 2 0.0011 714 | 0/23 25 h-m-p 0.0231 0.7261 0.8019 ++YYYC 4115.454224 3 0.3453 745 | 0/23 26 h-m-p 0.0903 0.4517 0.8164 YCCCC 4110.424199 4 0.2019 801 | 0/23 27 h-m-p 0.2051 1.0253 0.5642 YCCC 4106.539990 3 0.4404 855 | 0/23 28 h-m-p 1.1188 6.8873 0.2221 YCCC 4105.198657 3 0.7766 909 | 0/23 29 h-m-p 1.1666 5.8332 0.0492 YYC 4104.257666 2 1.0670 960 | 0/23 30 h-m-p 0.7813 7.3803 0.0671 CYC 4103.765421 2 0.8781 1012 | 0/23 31 h-m-p 1.2380 8.0000 0.0476 YC 4103.621686 1 0.7016 1062 | 0/23 32 h-m-p 1.4823 8.0000 0.0225 CC 4103.602697 1 0.4897 1113 | 0/23 33 h-m-p 0.4615 8.0000 0.0239 YC 4103.595896 1 0.7818 1163 | 0/23 34 h-m-p 1.6000 8.0000 0.0021 C 4103.592640 0 1.4900 1212 | 0/23 35 h-m-p 0.9069 8.0000 0.0035 YC 4103.588965 1 1.9100 1262 | 0/23 36 h-m-p 1.6000 8.0000 0.0037 YC 4103.587927 1 0.9090 1312 | 0/23 37 h-m-p 1.6000 8.0000 0.0017 C 4103.587882 0 0.6090 1361 | 0/23 38 h-m-p 1.6000 8.0000 0.0001 Y 4103.587880 0 0.7710 1410 | 0/23 39 h-m-p 1.6000 8.0000 0.0000 Y 4103.587880 0 0.7813 1459 | 0/23 40 h-m-p 1.6000 8.0000 0.0000 Y 4103.587880 0 0.7174 1508 | 0/23 41 h-m-p 1.6000 8.0000 0.0000 Y 4103.587880 0 0.9073 1557 | 0/23 42 h-m-p 1.6000 8.0000 0.0000 Y 4103.587880 0 0.9604 1606 | 0/23 43 h-m-p 1.6000 8.0000 0.0000 Y 4103.587880 0 1.6000 1655 | 0/23 44 h-m-p 1.6000 8.0000 0.0000 C 4103.587880 0 0.4000 1704 Out.. lnL = -4103.587880 1705 lfun, 5115 eigenQcodon, 68200 P(t) Time used: 0:53 Model 2: PositiveSelection TREE # 1 (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 initial w for M2:NSpselection reset. 0.031954 0.052478 0.004792 0.087449 0.112440 0.002514 0.008839 0.130896 0.122580 0.106764 0.398954 0.019120 0.409760 0.041820 0.185890 0.128680 0.122292 0.014101 0.027593 0.011459 3.445434 1.302842 0.509198 0.419451 2.107983 ntime & nrate & np: 20 3 25 Bounds (np=25): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 3.509592 np = 25 lnL0 = -4678.536977 Iterating by ming2 Initial: fx= 4678.536977 x= 0.03195 0.05248 0.00479 0.08745 0.11244 0.00251 0.00884 0.13090 0.12258 0.10676 0.39895 0.01912 0.40976 0.04182 0.18589 0.12868 0.12229 0.01410 0.02759 0.01146 3.44543 1.30284 0.50920 0.41945 2.10798 1 h-m-p 0.0000 0.0005 2282.3893 +++ 4570.502181 m 0.0005 31 | 0/25 2 h-m-p 0.0000 0.0001 2098.6797 +YCCC 4401.706437 3 0.0001 66 | 0/25 3 h-m-p 0.0000 0.0002 331.6412 +YYCCCC 4395.471641 5 0.0001 103 | 0/25 4 h-m-p 0.0000 0.0001 2607.0484 ++ 4358.688358 m 0.0001 131 | 0/25 5 h-m-p 0.0000 0.0003 4527.4119 YCCC 4322.210267 3 0.0001 164 | 0/25 6 h-m-p 0.0011 0.0056 155.9199 YCCC 4309.949682 3 0.0019 197 | 0/25 7 h-m-p 0.0005 0.0027 181.3890 +YYCCC 4290.310494 4 0.0019 232 | 0/25 8 h-m-p 0.0003 0.0014 204.7270 +YCCC 4284.647859 3 0.0008 266 | 0/25 9 h-m-p 0.0009 0.0043 140.1563 YCCCC 4276.894245 4 0.0020 301 | 0/25 10 h-m-p 0.0006 0.0030 147.1621 +YCCCC 4271.204627 4 0.0016 337 | 0/25 11 h-m-p 0.0018 0.0090 62.4514 YCCCC 4267.417014 4 0.0036 372 | 0/25 12 h-m-p 0.0015 0.0101 148.3390 CYC 4264.390912 2 0.0015 403 | 0/25 13 h-m-p 0.0018 0.0100 126.2216 YCCCC 4258.493938 4 0.0035 438 | 0/25 14 h-m-p 0.0031 0.0153 139.7091 CCCC 4250.985031 3 0.0047 472 | 0/25 15 h-m-p 0.0039 0.0195 125.3261 YCC 4241.970902 2 0.0071 503 | 0/25 16 h-m-p 0.0072 0.0358 84.3529 CCC 4235.958244 2 0.0074 535 | 0/25 17 h-m-p 0.0099 0.0496 59.7495 YCCC 4232.919720 3 0.0066 568 | 0/25 18 h-m-p 0.0081 0.1045 48.5522 YCCC 4228.827007 3 0.0126 601 | 0/25 19 h-m-p 0.0107 0.0550 57.3313 CYCC 4224.001320 3 0.0150 634 | 0/25 20 h-m-p 0.0064 0.0320 119.7613 YCCC 4213.813902 3 0.0137 667 | 0/25 21 h-m-p 0.0238 0.1191 13.3337 CCC 4212.661953 2 0.0201 699 | 0/25 22 h-m-p 0.0337 0.1808 7.9523 YCCC 4210.673597 3 0.0606 732 | 0/25 23 h-m-p 0.0184 0.1582 26.2295 CCCC 4207.559099 3 0.0277 766 | 0/25 24 h-m-p 0.0365 0.1823 7.7810 CCC 4205.539778 2 0.0526 798 | 0/25 25 h-m-p 0.0253 0.2541 16.1606 +YCCC 4192.506596 3 0.1474 832 | 0/25 26 h-m-p 0.0057 0.0283 24.0453 +CC 4189.983047 1 0.0223 863 | 0/25 27 h-m-p 0.0990 7.6718 5.4192 +YCCC 4180.636846 3 0.6391 897 | 0/25 28 h-m-p 1.0587 8.0000 3.2716 +YCCC 4161.447474 3 2.6678 931 | 0/25 29 h-m-p 1.3307 6.6535 2.6440 CYC 4153.982587 2 1.4592 962 | 0/25 30 h-m-p 0.9324 5.7693 4.1376 YCCC 4146.439388 3 1.9167 995 | 0/25 31 h-m-p 1.3467 6.7335 2.6977 YCCC 4142.856548 3 2.5018 1028 | 0/25 32 h-m-p 1.6000 8.0000 0.8584 YCC 4141.050065 2 2.7452 1059 | 0/25 33 h-m-p 1.4090 8.0000 1.6724 YCCC 4139.316587 3 3.3215 1117 | 0/25 34 h-m-p 1.6000 8.0000 1.1585 YCCC 4138.619081 3 3.1929 1150 | 0/25 35 h-m-p 1.6000 8.0000 0.9065 +C 4136.822863 0 6.4000 1179 | 0/25 36 h-m-p 1.6000 8.0000 0.2213 CCC 4136.217821 2 1.4131 1236 | 0/25 37 h-m-p 1.0036 8.0000 0.3116 +YCC 4135.865164 2 2.8337 1293 | 0/25 38 h-m-p 1.4697 8.0000 0.6009 YCCC 4135.524134 3 3.4315 1351 | 0/25 39 h-m-p 1.6000 8.0000 0.9765 +YCCC 4134.909306 3 4.8342 1410 | 0/25 40 h-m-p 1.6000 8.0000 1.7548 YC 4134.234076 1 3.5239 1464 | 0/25 41 h-m-p 1.6000 8.0000 0.7362 CC 4133.812531 1 2.0546 1494 | 0/25 42 h-m-p 1.6000 8.0000 0.4538 +YCC 4133.334117 2 4.7643 1551 | 0/25 43 h-m-p 1.6000 8.0000 0.7159 CCCC 4132.383762 3 2.6433 1610 | 0/25 44 h-m-p 0.5009 7.6300 3.7782 YCCC 4132.029440 3 1.0955 1668 | 0/25 45 h-m-p 1.6000 8.0000 1.1444 YCCC 4131.538703 3 3.1968 1701 | 0/25 46 h-m-p 1.6000 8.0000 0.3197 +YCCC 4129.996170 3 4.7748 1735 | 0/25 47 h-m-p 0.2077 3.9787 7.3482 +CCC 4129.269978 2 0.9315 1793 | 0/25 48 h-m-p 1.6000 8.0000 0.5122 CY 4128.872727 1 1.5864 1823 | 0/25 49 h-m-p 1.1730 8.0000 0.6927 +YCC 4128.066656 2 5.4540 1880 | 0/25 50 h-m-p 1.6000 8.0000 1.0479 YCCCC 4125.637625 4 3.3964 1940 | 0/25 51 h-m-p 1.1795 5.8976 2.5165 YYC 4124.866820 2 0.9751 1970 | 0/25 52 h-m-p 1.6000 8.0000 0.3792 YCCC 4124.465742 3 0.8535 2003 | 0/25 53 h-m-p 0.1894 8.0000 1.7086 ++YYC 4123.380588 2 2.6042 2060 | 0/25 54 h-m-p 1.2671 6.3353 1.3242 YCCCCC 4121.416409 5 1.5997 2097 | 0/25 55 h-m-p 0.2338 3.7607 9.0609 +YYC 4120.031864 2 0.8228 2128 | 0/25 56 h-m-p 1.3435 6.7174 2.8567 YYCC 4119.326545 3 0.9478 2160 | 0/25 57 h-m-p 1.3690 6.8451 1.5482 CYC 4118.592836 2 1.2376 2191 | 0/25 58 h-m-p 1.4442 7.2209 0.4517 CCC 4117.698742 2 1.6244 2223 | 0/25 59 h-m-p 0.8538 4.2691 0.8116 CCCC 4117.117141 3 0.8788 2282 | 0/25 60 h-m-p 0.2518 3.6817 2.8326 +YCC 4116.584007 2 0.7030 2339 | 0/25 61 h-m-p 1.1293 5.6465 1.0728 YYCC 4116.170388 3 1.0026 2371 | 0/25 62 h-m-p 0.8755 4.3777 0.5244 YYC 4115.864627 2 0.6605 2401 | 0/25 63 h-m-p 0.7419 6.1730 0.4669 YC 4115.691602 1 0.5099 2455 | 0/25 64 h-m-p 0.2308 8.0000 1.0314 +CYC 4115.550138 2 0.8579 2512 | 0/25 65 h-m-p 1.0347 8.0000 0.8552 CCC 4115.385585 2 1.5365 2544 | 0/25 66 h-m-p 0.7946 8.0000 1.6536 CCC 4115.293596 2 0.9599 2601 | 0/25 67 h-m-p 1.6000 8.0000 0.9141 YCC 4115.238299 2 0.9546 2632 | 0/25 68 h-m-p 1.6000 8.0000 0.3520 YCC 4115.184906 2 1.2136 2688 | 0/25 69 h-m-p 1.6000 8.0000 0.1631 YC 4115.030784 1 3.1185 2742 | 0/25 70 h-m-p 1.3121 6.5604 0.2270 CCCC 4114.840913 3 1.4986 2801 | 0/25 71 h-m-p 1.6000 8.0000 0.0754 CC 4114.721845 1 1.7417 2856 | 0/25 72 h-m-p 0.7646 8.0000 0.1717 +YCCC 4114.148090 3 5.4374 2915 | 0/25 73 h-m-p 0.6585 7.1126 1.4181 YCCC 4113.468728 3 1.4712 2973 | 0/25 74 h-m-p 1.3261 6.7653 1.5733 CYC 4112.787626 2 1.2659 3004 | 0/25 75 h-m-p 0.7173 3.5866 2.4190 CCCC 4111.904509 3 1.2546 3038 | 0/25 76 h-m-p 0.4933 2.4665 1.9474 CYCCCC 4110.995434 5 0.7418 3075 | 0/25 77 h-m-p 0.3580 2.9352 4.0348 YCCCC 4109.621745 4 0.7229 3110 | 0/25 78 h-m-p 0.6883 3.4413 2.6109 CCCC 4108.324712 3 0.9756 3144 | 0/25 79 h-m-p 0.3341 1.6705 6.6105 CCCCC 4107.499617 4 0.4494 3180 | 0/25 80 h-m-p 0.2268 1.1340 0.3546 CCCC 4107.172757 3 0.2615 3214 | 0/25 81 h-m-p 0.0351 4.5767 2.6383 ++YC 4106.968405 1 0.3669 3270 | 0/25 82 h-m-p 0.3203 1.6015 1.8337 YYY 4106.808187 2 0.3134 3300 | 0/25 83 h-m-p 0.2609 3.2484 2.2028 CCC 4106.564147 2 0.3473 3332 | 0/25 84 h-m-p 0.5246 4.6837 1.4582 CCCC 4106.323552 3 0.9049 3366 | 0/25 85 h-m-p 0.4059 2.3873 3.2512 CCCC 4106.004790 3 0.6067 3400 | 0/25 86 h-m-p 1.0841 6.0560 1.8194 YYC 4105.763407 2 0.8948 3430 | 0/25 87 h-m-p 0.4666 4.4178 3.4892 CCC 4105.562879 2 0.3852 3462 | 0/25 88 h-m-p 0.3449 4.3098 3.8965 CCCC 4105.311682 3 0.6088 3496 | 0/25 89 h-m-p 0.3316 1.9958 7.1529 YYC 4105.146091 2 0.2654 3526 | 0/25 90 h-m-p 0.4419 3.2953 4.2968 YCC 4104.996374 2 0.2892 3557 | 0/25 91 h-m-p 0.1299 2.0396 9.5659 CCCC 4104.853265 3 0.2340 3591 | 0/25 92 h-m-p 0.4845 3.7283 4.6210 YC 4104.741550 1 0.2441 3620 | 0/25 93 h-m-p 0.1789 2.5890 6.3076 CCCC 4104.616602 3 0.2645 3654 | 0/25 94 h-m-p 0.5300 3.1862 3.1477 YCC 4104.551390 2 0.3414 3685 | 0/25 95 h-m-p 0.1979 2.0389 5.4304 CCC 4104.476024 2 0.2378 3717 | 0/25 96 h-m-p 0.3137 3.9465 4.1162 CCC 4104.397691 2 0.3787 3749 | 0/25 97 h-m-p 0.1924 2.3654 8.1024 CCC 4104.313609 2 0.2371 3781 | 0/25 98 h-m-p 0.2806 3.1769 6.8457 YYC 4104.251339 2 0.2359 3811 | 0/25 99 h-m-p 0.2847 2.1247 5.6717 YCC 4104.195146 2 0.2158 3842 | 0/25 100 h-m-p 0.3989 8.0000 3.0684 YC 4104.153985 1 0.2138 3871 | 0/25 101 h-m-p 0.0817 3.1652 8.0337 +CCCC 4104.088113 3 0.3595 3906 | 0/25 102 h-m-p 0.4375 3.1318 6.6018 YYC 4104.041481 2 0.3017 3936 | 0/25 103 h-m-p 0.2333 2.7262 8.5378 YC 4104.013888 1 0.1113 3965 | 0/25 104 h-m-p 0.3205 4.3667 2.9658 YC 4103.957100 1 0.7027 3994 | 0/25 105 h-m-p 0.8327 8.0000 2.5028 C 4103.911352 0 0.8264 4022 | 0/25 106 h-m-p 0.3445 7.5597 6.0035 CCCC 4103.868923 3 0.5067 4056 | 0/25 107 h-m-p 0.7020 8.0000 4.3330 CY 4103.821786 1 0.6826 4086 | 0/25 108 h-m-p 0.8559 8.0000 3.4559 YCC 4103.800776 2 0.5171 4117 | 0/25 109 h-m-p 0.5582 8.0000 3.2014 CCC 4103.777395 2 0.4810 4149 | 0/25 110 h-m-p 0.1063 3.2316 14.4834 YCCC 4103.753982 3 0.1973 4182 | 0/25 111 h-m-p 0.4987 8.0000 5.7312 CCC 4103.730400 2 0.5314 4214 | 0/25 112 h-m-p 1.1634 8.0000 2.6179 YC 4103.717772 1 0.5230 4243 | 0/25 113 h-m-p 0.4262 8.0000 3.2121 CY 4103.704590 1 0.4558 4273 | 0/25 114 h-m-p 0.3050 8.0000 4.8011 YC 4103.687776 1 0.6722 4302 | 0/25 115 h-m-p 0.7640 8.0000 4.2242 CCC 4103.667776 2 1.0363 4334 | 0/25 116 h-m-p 1.4493 8.0000 3.0205 CY 4103.658746 1 0.4019 4364 | 0/25 117 h-m-p 0.1146 8.0000 10.5940 +YC 4103.649158 1 0.3061 4394 | 0/25 118 h-m-p 0.5774 8.0000 5.6161 C 4103.639771 0 0.5774 4422 | 0/25 119 h-m-p 0.7309 8.0000 4.4362 CY 4103.632443 1 0.6392 4452 | 0/25 120 h-m-p 1.0921 8.0000 2.5964 CCC 4103.625169 2 0.9699 4484 | 0/25 121 h-m-p 0.4106 8.0000 6.1329 YCC 4103.617841 2 0.8333 4515 | 0/25 122 h-m-p 1.1807 8.0000 4.3284 YC 4103.612065 1 0.6921 4544 | 0/25 123 h-m-p 0.4942 8.0000 6.0618 CCC 4103.607945 2 0.7327 4576 | 0/25 124 h-m-p 1.2299 8.0000 3.6113 YC 4103.604373 1 0.7706 4605 | 0/25 125 h-m-p 0.4948 8.0000 5.6245 YC 4103.600980 1 0.8213 4634 | 0/25 126 h-m-p 0.9620 8.0000 4.8020 C 4103.597861 0 1.0448 4662 | 0/25 127 h-m-p 1.4704 8.0000 3.4120 CY 4103.595461 1 1.2286 4692 | 0/25 128 h-m-p 0.3886 8.0000 10.7881 CC 4103.593718 1 0.5401 4722 | 0/25 129 h-m-p 1.0299 8.0000 5.6574 YC 4103.592480 1 0.6710 4751 | 0/25 130 h-m-p 0.5211 8.0000 7.2841 CC 4103.591401 1 0.8051 4781 | 0/25 131 h-m-p 1.3483 8.0000 4.3492 C 4103.590509 0 1.1898 4809 | 0/25 132 h-m-p 1.0813 8.0000 4.7853 C 4103.589786 0 1.0107 4837 | 0/25 133 h-m-p 0.5166 8.0000 9.3625 CC 4103.589235 1 0.7830 4867 | 0/25 134 h-m-p 1.2167 8.0000 6.0251 YC 4103.588898 1 0.7794 4896 | 0/25 135 h-m-p 0.8976 8.0000 5.2317 C 4103.588587 0 1.2587 4924 | 0/25 136 h-m-p 1.0639 8.0000 6.1899 C 4103.588352 0 1.2505 4952 | 0/25 137 h-m-p 1.3845 8.0000 5.5908 Y 4103.588217 0 0.9426 4980 | 0/25 138 h-m-p 1.2848 8.0000 4.1016 C 4103.588134 0 1.0538 5008 | 0/25 139 h-m-p 0.8296 8.0000 5.2101 C 4103.588060 0 1.2487 5036 | 0/25 140 h-m-p 1.6000 8.0000 2.2645 Y 4103.588029 0 1.0093 5064 | 0/25 141 h-m-p 1.3575 8.0000 1.6837 C 4103.588008 0 1.5038 5092 | 0/25 142 h-m-p 1.6000 8.0000 0.3446 Y 4103.588003 0 0.9441 5120 | 0/25 143 h-m-p 0.0252 8.0000 12.8996 +C 4103.587998 0 0.1284 5174 | 0/25 144 h-m-p 1.6000 8.0000 0.4936 Y 4103.587995 0 0.6861 5202 | 0/25 145 h-m-p 0.5439 8.0000 0.6227 +Y 4103.587989 0 1.4461 5256 | 0/25 146 h-m-p 0.8646 8.0000 1.0415 +Y 4103.587980 0 2.7785 5310 | 0/25 147 h-m-p 1.6000 8.0000 0.4532 Y 4103.587974 0 0.8596 5338 | 0/25 148 h-m-p 0.2028 8.0000 1.9208 +C 4103.587969 0 0.8718 5392 | 0/25 149 h-m-p 1.6000 8.0000 0.5417 C 4103.587968 0 0.6397 5420 | 0/25 150 h-m-p 0.6827 8.0000 0.5076 C 4103.587965 0 0.9782 5473 | 0/25 151 h-m-p 0.9949 8.0000 0.4991 ++ 4103.587951 m 8.0000 5526 | 0/25 152 h-m-p 0.3536 8.0000 11.2927 +Y 4103.587910 0 2.6053 5580 | 0/25 153 h-m-p 1.5945 8.0000 18.4517 C 4103.587906 0 0.3549 5608 | 0/25 154 h-m-p 0.0909 4.1309 72.0226 --------------.. | 0/25 155 h-m-p 0.0002 0.0967 0.2312 Y 4103.587905 0 0.0000 5676 | 0/25 156 h-m-p 0.0001 0.0446 0.5700 C 4103.587904 0 0.0000 5729 | 0/25 157 h-m-p 0.0007 0.3296 0.2407 C 4103.587901 0 0.0002 5782 | 0/25 158 h-m-p 0.0016 0.7783 0.1159 -C 4103.587901 0 0.0001 5836 | 0/25 159 h-m-p 0.0006 0.3152 0.1531 Y 4103.587900 0 0.0001 5889 | 0/25 160 h-m-p 0.0037 1.8647 0.0688 -C 4103.587900 0 0.0003 5943 | 0/25 161 h-m-p 0.0062 3.0965 0.0393 -Y 4103.587900 0 0.0003 5997 | 0/25 162 h-m-p 0.0064 3.1983 0.0267 -Y 4103.587900 0 0.0003 6051 | 0/25 163 h-m-p 0.0122 6.1027 0.0249 -Y 4103.587900 0 0.0005 6105 | 0/25 164 h-m-p 0.0160 8.0000 0.0397 --Y 4103.587899 0 0.0004 6160 | 0/25 165 h-m-p 0.0160 8.0000 0.0180 --C 4103.587899 0 0.0004 6215 | 0/25 166 h-m-p 0.0160 8.0000 0.0080 -Y 4103.587899 0 0.0005 6269 | 0/25 167 h-m-p 0.0160 8.0000 0.0074 --C 4103.587899 0 0.0003 6324 | 0/25 168 h-m-p 0.0160 8.0000 0.0031 -C 4103.587899 0 0.0011 6378 | 0/25 169 h-m-p 0.0160 8.0000 0.0060 Y 4103.587899 0 0.0022 6431 | 0/25 170 h-m-p 0.0160 8.0000 0.0178 C 4103.587899 0 0.0034 6484 | 0/25 171 h-m-p 0.0160 8.0000 0.0739 -C 4103.587899 0 0.0008 6538 | 0/25 172 h-m-p 0.0160 8.0000 0.0151 -C 4103.587899 0 0.0011 6592 | 0/25 173 h-m-p 0.0160 8.0000 0.0049 -C 4103.587899 0 0.0013 6646 | 0/25 174 h-m-p 0.0160 8.0000 0.0007 -C 4103.587899 0 0.0010 6700 Out.. lnL = -4103.587899 6701 lfun, 26804 eigenQcodon, 402060 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -4150.281244 S = -4049.667162 -91.634058 Calculating f(w|X), posterior probabilities of site classes. did 10 / 276 patterns 4:25 did 20 / 276 patterns 4:25 did 30 / 276 patterns 4:25 did 40 / 276 patterns 4:25 did 50 / 276 patterns 4:25 did 60 / 276 patterns 4:25 did 70 / 276 patterns 4:25 did 80 / 276 patterns 4:25 did 90 / 276 patterns 4:25 did 100 / 276 patterns 4:25 did 110 / 276 patterns 4:25 did 120 / 276 patterns 4:25 did 130 / 276 patterns 4:25 did 140 / 276 patterns 4:25 did 150 / 276 patterns 4:25 did 160 / 276 patterns 4:26 did 170 / 276 patterns 4:26 did 180 / 276 patterns 4:26 did 190 / 276 patterns 4:26 did 200 / 276 patterns 4:26 did 210 / 276 patterns 4:26 did 220 / 276 patterns 4:26 did 230 / 276 patterns 4:26 did 240 / 276 patterns 4:26 did 250 / 276 patterns 4:26 did 260 / 276 patterns 4:26 did 270 / 276 patterns 4:26 did 276 / 276 patterns 4:26 Time used: 4:26 Model 3: discrete TREE # 1 (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 0.031954 0.052478 0.004792 0.087449 0.112440 0.002514 0.008839 0.130896 0.122580 0.106764 0.398954 0.019120 0.409760 0.041820 0.185890 0.128680 0.122292 0.014101 0.027593 0.011459 3.445436 0.446685 0.067456 0.016684 0.042946 0.059180 ntime & nrate & np: 20 4 26 Bounds (np=26): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 12.476617 np = 26 lnL0 = -4181.765656 Iterating by ming2 Initial: fx= 4181.765656 x= 0.03195 0.05248 0.00479 0.08745 0.11244 0.00251 0.00884 0.13090 0.12258 0.10676 0.39895 0.01912 0.40976 0.04182 0.18589 0.12868 0.12229 0.01410 0.02759 0.01146 3.44544 0.44668 0.06746 0.01668 0.04295 0.05918 1 h-m-p 0.0000 0.0000 1511.1128 ++ 4152.499201 m 0.0000 31 | 1/26 2 h-m-p 0.0001 0.0004 446.1449 ++ 4118.077113 m 0.0004 60 | 2/26 3 h-m-p 0.0000 0.0001 1534.0644 YCYCCC 4116.863556 5 0.0000 98 | 2/26 4 h-m-p 0.0001 0.0005 192.4985 +YYCC 4113.349577 3 0.0002 132 | 2/26 5 h-m-p 0.0001 0.0005 145.2469 CCCC 4112.227141 3 0.0002 167 | 2/26 6 h-m-p 0.0002 0.0018 144.8949 YCCC 4111.921379 3 0.0001 201 | 2/26 7 h-m-p 0.0001 0.0020 108.9103 +YCC 4111.098407 2 0.0003 234 | 2/26 8 h-m-p 0.0006 0.0039 57.5956 CCC 4110.514557 2 0.0006 267 | 2/26 9 h-m-p 0.0004 0.0047 91.1851 CYC 4110.013899 2 0.0004 299 | 2/26 10 h-m-p 0.0004 0.0021 103.6279 YYC 4109.612608 2 0.0003 330 | 2/26 11 h-m-p 0.0004 0.0044 84.5350 YCCC 4108.865493 3 0.0008 364 | 2/26 12 h-m-p 0.0008 0.0089 90.4387 CCC 4107.886552 2 0.0012 397 | 2/26 13 h-m-p 0.0009 0.0130 110.9840 YCCC 4106.341449 3 0.0017 431 | 2/26 14 h-m-p 0.0008 0.0038 227.0285 CCCC 4104.545839 3 0.0009 466 | 1/26 15 h-m-p 0.0001 0.0004 1911.8850 -YCC 4104.478476 2 0.0000 499 | 1/26 16 h-m-p 0.0001 0.0080 194.3968 ++CCC 4102.745053 2 0.0012 534 | 1/26 17 h-m-p 0.0011 0.0054 179.2778 CCC 4101.607821 2 0.0009 567 | 1/26 18 h-m-p 0.0009 0.0060 176.6669 CC 4100.479783 1 0.0009 598 | 1/26 19 h-m-p 0.0014 0.0069 37.1788 YC 4100.339924 1 0.0007 628 | 1/26 20 h-m-p 0.0041 0.0278 5.9674 -YC 4100.332846 1 0.0005 659 | 1/26 21 h-m-p 0.0031 0.3255 0.9246 C 4100.328950 0 0.0032 688 | 1/26 22 h-m-p 0.0011 0.3954 2.5898 ++CCC 4100.230469 2 0.0217 748 | 1/26 23 h-m-p 0.0008 0.0907 70.4129 ++YCCC 4098.899132 3 0.0096 784 | 0/26 24 h-m-p 0.0003 0.0029 1973.7291 -CCC 4098.850368 2 0.0000 818 | 0/26 25 h-m-p 0.0037 0.0697 9.6775 CC 4098.831722 1 0.0012 849 | 0/26 26 h-m-p 0.0036 1.7938 5.1481 ++CC 4098.344887 1 0.0702 882 | 0/26 27 h-m-p 0.2272 1.1361 0.3197 ++ 4098.072842 m 1.1361 911 | 1/26 28 h-m-p 1.2154 8.0000 0.2989 YCCC 4097.863461 3 0.8077 971 | 0/26 29 h-m-p 0.0000 0.0001 24120.9083 YC 4097.860449 1 0.0000 1026 | 0/26 30 h-m-p 0.1595 1.8510 0.1997 +CC 4097.618461 1 0.8380 1058 | 0/26 31 h-m-p 0.0471 0.2353 0.0426 ++ 4097.560060 m 0.2353 1113 | 1/26 32 h-m-p 0.0612 8.0000 0.1638 ++CC 4097.411962 1 0.9899 1172 | 1/26 33 h-m-p 1.6000 8.0000 0.0273 YC 4097.382854 1 1.1618 1227 | 1/26 34 h-m-p 0.4751 8.0000 0.0667 +YCYC 4097.233837 3 4.7999 1286 | 1/26 35 h-m-p 1.6000 8.0000 0.1732 CYCCC 4096.947428 4 2.4533 1347 | 1/26 36 h-m-p 0.6260 3.1298 0.4986 YCCC 4096.246204 3 1.1494 1406 | 1/26 37 h-m-p 1.6000 8.0000 0.2128 YCCC 4095.643805 3 1.0008 1465 | 1/26 38 h-m-p 0.1258 6.1567 1.6928 +CYC 4094.440885 2 0.4931 1523 | 1/26 39 h-m-p 1.2039 6.0197 0.1170 CCCC 4093.645246 3 1.8090 1558 | 1/26 40 h-m-p 1.6000 8.0000 0.1072 CCC 4093.281210 2 1.8783 1616 | 1/26 41 h-m-p 1.5552 8.0000 0.1295 CCC 4093.115335 2 1.7209 1674 | 1/26 42 h-m-p 1.6000 8.0000 0.1114 CCC 4092.830224 2 1.8268 1732 | 1/26 43 h-m-p 1.6000 8.0000 0.0852 YC 4092.793945 1 1.2610 1787 | 1/26 44 h-m-p 1.6000 8.0000 0.0090 YC 4092.772305 1 3.6544 1842 | 1/26 45 h-m-p 0.7330 8.0000 0.0449 +YC 4092.701697 1 4.3217 1898 | 1/26 46 h-m-p 1.6000 8.0000 0.0283 YC 4092.640882 1 3.1241 1953 | 1/26 47 h-m-p 1.6000 8.0000 0.0222 +CC 4092.465966 1 6.2834 2010 | 1/26 48 h-m-p 1.6000 8.0000 0.0350 CCC 4092.314987 2 2.2594 2068 | 1/26 49 h-m-p 1.2426 8.0000 0.0636 CC 4092.294970 1 1.2272 2124 | 1/26 50 h-m-p 1.6000 8.0000 0.0161 YC 4092.292555 1 0.9357 2179 | 1/26 51 h-m-p 1.6000 8.0000 0.0078 YC 4092.292417 1 0.8971 2234 | 1/26 52 h-m-p 1.6000 8.0000 0.0005 Y 4092.292415 0 0.9620 2288 | 1/26 53 h-m-p 1.6000 8.0000 0.0000 Y 4092.292415 0 0.9501 2342 | 1/26 54 h-m-p 1.6000 8.0000 0.0000 Y 4092.292415 0 1.0246 2396 | 1/26 55 h-m-p 1.6000 8.0000 0.0000 --------------Y 4092.292415 0 0.0000 2464 Out.. lnL = -4092.292415 2465 lfun, 9860 eigenQcodon, 147900 P(t) Time used: 5:44 Model 7: beta TREE # 1 (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 0.031954 0.052478 0.004792 0.087449 0.112440 0.002514 0.008839 0.130896 0.122580 0.106764 0.398954 0.019120 0.409760 0.041820 0.185890 0.128680 0.122292 0.014101 0.027593 0.011459 3.415953 1.051152 1.246982 ntime & nrate & np: 20 1 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 5.358192 np = 23 lnL0 = -4488.244455 Iterating by ming2 Initial: fx= 4488.244455 x= 0.03195 0.05248 0.00479 0.08745 0.11244 0.00251 0.00884 0.13090 0.12258 0.10676 0.39895 0.01912 0.40976 0.04182 0.18589 0.12868 0.12229 0.01410 0.02759 0.01146 3.41595 1.05115 1.24698 1 h-m-p 0.0000 0.0004 2017.0734 +YYCCCC 4452.771977 5 0.0001 37 | 0/23 2 h-m-p 0.0002 0.0011 400.9157 ++ 4371.940215 m 0.0011 63 | 0/23 3 h-m-p 0.0000 0.0001 3734.8778 ++ 4320.402533 m 0.0001 89 | 0/23 4 h-m-p 0.0000 0.0002 1263.1474 ++ 4258.208712 m 0.0002 115 | 0/23 5 h-m-p 0.0000 0.0000 29038.0978 ++ 4225.820233 m 0.0000 141 | 1/23 6 h-m-p 0.0001 0.0004 249.2439 ++ 4216.971972 m 0.0004 167 | 1/23 7 h-m-p 0.0003 0.0014 142.6581 +YCYCCC 4205.872863 5 0.0009 202 | 0/23 8 h-m-p 0.0001 0.0003 519.6172 CCC 4203.854191 2 0.0001 232 | 0/23 9 h-m-p 0.0001 0.0006 428.1138 +YCYCCC 4194.783726 5 0.0003 267 | 0/23 10 h-m-p 0.0001 0.0003 848.5560 +YCCCC 4183.966729 4 0.0002 301 | 0/23 11 h-m-p 0.0001 0.0004 344.9704 ++ 4173.082193 m 0.0004 327 | 0/23 12 h-m-p 0.0001 0.0005 870.6707 +YYCCC 4154.885415 4 0.0003 360 | 0/23 13 h-m-p 0.0002 0.0009 285.9254 YCCCC 4149.555093 4 0.0004 393 | 0/23 14 h-m-p 0.0001 0.0003 196.1161 +CYC 4147.802314 2 0.0003 423 | 0/23 15 h-m-p 0.0001 0.0007 445.5167 YCCC 4143.891881 3 0.0003 454 | 0/23 16 h-m-p 0.0002 0.0011 229.5478 YCCC 4141.104570 3 0.0005 485 | 0/23 17 h-m-p 0.0005 0.0031 207.7050 CCCC 4137.697299 3 0.0007 517 | 0/23 18 h-m-p 0.0012 0.0059 71.8381 YCCC 4136.800795 3 0.0007 548 | 0/23 19 h-m-p 0.0017 0.0137 29.0002 YCC 4136.498508 2 0.0009 577 | 0/23 20 h-m-p 0.0011 0.0105 24.8725 CCC 4136.231660 2 0.0013 607 | 0/23 21 h-m-p 0.0008 0.0169 38.2108 YCCC 4135.733434 3 0.0017 638 | 0/23 22 h-m-p 0.0087 0.0435 5.6349 CCC 4135.563678 2 0.0033 668 | 0/23 23 h-m-p 0.0020 0.0779 9.1840 +YCCC 4133.380942 3 0.0154 700 | 0/23 24 h-m-p 0.0014 0.0182 101.8667 +YCCC 4127.166449 3 0.0043 732 | 0/23 25 h-m-p 0.1141 1.0666 3.8539 YCCCC 4121.562167 4 0.2169 765 | 0/23 26 h-m-p 0.3472 1.7362 0.7926 YCCC 4116.063945 3 0.7774 796 | 0/23 27 h-m-p 0.1276 0.6378 0.6873 +YCYCCC 4112.544248 5 0.3512 854 | 0/23 28 h-m-p 0.3117 1.5584 0.4664 +YCCCC 4106.193038 4 0.8788 911 | 0/23 29 h-m-p 0.4006 2.0028 0.1290 YCCC 4104.468601 3 0.7876 965 | 0/23 30 h-m-p 0.8079 8.0000 0.1257 CYC 4103.719006 2 0.8825 1017 | 0/23 31 h-m-p 0.8642 4.3208 0.1082 CCCC 4102.805265 3 1.5699 1072 | 0/23 32 h-m-p 1.3871 8.0000 0.1225 YCCC 4101.777918 3 2.4306 1126 | 0/23 33 h-m-p 1.2299 8.0000 0.2421 YCCCC 4100.268629 4 2.2998 1182 | 0/23 34 h-m-p 0.7186 3.5928 0.4399 CYCCCC 4098.838705 5 1.1804 1240 | 0/23 35 h-m-p 1.2700 6.3498 0.1033 CC 4098.141586 1 1.1802 1291 | 0/23 36 h-m-p 0.7328 3.9307 0.1664 YYC 4097.833486 2 0.5345 1342 | 0/23 37 h-m-p 0.8302 4.1508 0.1017 CCCC 4097.598896 3 0.8629 1397 | 0/23 38 h-m-p 1.0912 8.0000 0.0804 YC 4097.576614 1 0.5356 1447 | 0/23 39 h-m-p 1.6000 8.0000 0.0235 YC 4097.568074 1 0.6685 1497 | 0/23 40 h-m-p 1.6000 8.0000 0.0031 +YC 4097.558208 1 4.3174 1548 | 0/23 41 h-m-p 1.6000 8.0000 0.0042 +YC 4097.523715 1 5.4156 1599 | 0/23 42 h-m-p 1.6000 8.0000 0.0035 YC 4097.484848 1 2.6105 1649 | 0/23 43 h-m-p 1.4925 8.0000 0.0061 YC 4097.476411 1 1.1088 1699 | 0/23 44 h-m-p 1.6000 8.0000 0.0011 CC 4097.474256 1 2.0559 1750 | 0/23 45 h-m-p 1.6000 8.0000 0.0011 C 4097.473249 0 1.9454 1799 | 0/23 46 h-m-p 1.6000 8.0000 0.0008 C 4097.473108 0 1.4261 1848 | 0/23 47 h-m-p 1.6000 8.0000 0.0001 Y 4097.473100 0 1.1119 1897 | 0/23 48 h-m-p 1.6000 8.0000 0.0000 Y 4097.473100 0 1.1527 1946 | 0/23 49 h-m-p 1.6000 8.0000 0.0000 Y 4097.473100 0 1.1928 1995 | 0/23 50 h-m-p 1.6000 8.0000 0.0000 C 4097.473100 0 1.2975 2044 | 0/23 51 h-m-p 1.6000 8.0000 0.0000 Y 4097.473100 0 0.9579 2093 | 0/23 52 h-m-p 1.6000 8.0000 0.0000 -Y 4097.473100 0 0.1000 2143 Out.. lnL = -4097.473100 2144 lfun, 23584 eigenQcodon, 428800 P(t) Time used: 9:29 Model 8: beta&w>1 TREE # 1 (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 initial w for M8:NSbetaw>1 reset. 0.031954 0.052478 0.004792 0.087449 0.112440 0.002514 0.008839 0.130896 0.122580 0.106764 0.398954 0.019120 0.409760 0.041820 0.185890 0.128680 0.122292 0.014101 0.027593 0.011459 3.403323 0.900000 0.607855 1.105757 2.513519 ntime & nrate & np: 20 2 25 Bounds (np=25): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 4.655924 np = 25 lnL0 = -4460.784667 Iterating by ming2 Initial: fx= 4460.784667 x= 0.03195 0.05248 0.00479 0.08745 0.11244 0.00251 0.00884 0.13090 0.12258 0.10676 0.39895 0.01912 0.40976 0.04182 0.18589 0.12868 0.12229 0.01410 0.02759 0.01146 3.40332 0.90000 0.60785 1.10576 2.51352 1 h-m-p 0.0000 0.0001 2375.0670 ++ 4343.064645 m 0.0001 30 | 1/25 2 h-m-p 0.0001 0.0003 483.7336 ++ 4282.776094 m 0.0003 58 | 1/25 3 h-m-p 0.0000 0.0000 19493.2019 ++ 4196.494287 m 0.0000 86 | 1/25 4 h-m-p 0.0000 0.0000 19593.2433 YCYCCC 4161.420276 5 0.0000 122 | 1/25 5 h-m-p 0.0001 0.0006 240.1504 YCCCCC 4155.560373 5 0.0002 159 | 0/25 6 h-m-p 0.0000 0.0000 2368.0090 +YCCCC 4135.869651 4 0.0000 195 | 0/25 7 h-m-p 0.0002 0.0010 98.1809 CYCC 4134.703551 3 0.0003 228 | 0/25 8 h-m-p 0.0004 0.0038 75.2506 +YCC 4132.884801 2 0.0010 260 | 0/25 9 h-m-p 0.0008 0.0041 48.0459 CCC 4132.242597 2 0.0008 292 | 0/25 10 h-m-p 0.0008 0.0089 46.7665 CCC 4131.573801 2 0.0012 324 | 0/25 11 h-m-p 0.0003 0.0017 45.0703 CYC 4131.402835 2 0.0004 355 | 0/25 12 h-m-p 0.0010 0.0117 17.3535 CCC 4131.234167 2 0.0013 387 | 0/25 13 h-m-p 0.0019 0.0321 12.1306 CCC 4131.070957 2 0.0020 419 | 0/25 14 h-m-p 0.0018 0.0259 13.2801 CCC 4130.771642 2 0.0028 451 | 0/25 15 h-m-p 0.0012 0.0223 31.6813 YC 4130.218822 1 0.0021 480 | 0/25 16 h-m-p 0.0019 0.0196 33.8916 YCC 4129.795797 2 0.0015 511 | 0/25 17 h-m-p 0.0026 0.0130 16.2457 YC 4129.637968 1 0.0013 540 | 0/25 18 h-m-p 0.0020 0.0259 10.5777 YC 4129.384950 1 0.0038 569 | 0/25 19 h-m-p 0.0008 0.0321 50.2486 +CCC 4128.589467 2 0.0027 602 | 0/25 20 h-m-p 0.0034 0.0348 39.3917 YCCC 4128.215354 3 0.0017 635 | 0/25 21 h-m-p 0.0093 0.0833 7.3327 CC 4128.143041 1 0.0029 665 | 0/25 22 h-m-p 0.0047 0.1592 4.4758 YC 4128.109284 1 0.0026 694 | 0/25 23 h-m-p 0.0066 0.7683 1.7769 ++YCCC 4125.477044 3 0.2506 729 | 0/25 24 h-m-p 0.0026 0.0130 106.8402 YC 4124.277341 1 0.0020 758 | 0/25 25 h-m-p 0.0226 0.1132 2.7451 CCC 4123.723729 2 0.0291 790 | 0/25 26 h-m-p 0.0028 0.0744 28.6017 +YCC 4120.037998 2 0.0179 822 | 0/25 27 h-m-p 0.5395 2.6974 0.5107 +YYYYC 4106.260525 4 2.1146 855 | 0/25 28 h-m-p 0.0307 0.1533 5.6938 +YCCC 4103.568993 3 0.1371 914 | 0/25 29 h-m-p 0.0352 0.1760 0.6151 ++ 4101.384752 m 0.1760 942 | 0/25 30 h-m-p 0.0939 0.4696 0.7820 +YCYCCC 4098.102851 5 0.2731 1004 | 0/25 31 h-m-p 0.5915 3.0247 0.3611 YYCCCC 4096.403427 5 0.6203 1065 | 0/25 32 h-m-p 0.2487 1.2436 0.2586 +YCCC 4095.596503 3 0.6677 1124 | 0/25 33 h-m-p 0.4810 2.4049 0.0848 YCCC 4094.816308 3 0.9594 1182 | 0/25 34 h-m-p 0.4289 2.6763 0.1896 YCCC 4094.185738 3 0.9300 1240 | 0/25 35 h-m-p 1.2228 6.1142 0.1224 YCC 4094.007667 2 0.8017 1296 | 0/25 36 h-m-p 1.0012 8.0000 0.0980 YC 4093.933845 1 0.7395 1350 | 0/25 37 h-m-p 1.6000 8.0000 0.0374 CC 4093.895530 1 1.2911 1405 | 0/25 38 h-m-p 1.5612 8.0000 0.0310 YC 4093.764869 1 3.1363 1459 | 0/25 39 h-m-p 1.6000 8.0000 0.0506 CYC 4093.509231 2 2.1991 1515 | 0/25 40 h-m-p 1.3060 8.0000 0.0851 CCC 4093.214735 2 1.3953 1572 | 0/25 41 h-m-p 1.6000 8.0000 0.0607 CCC 4092.976772 2 1.3176 1629 | 0/25 42 h-m-p 0.8114 5.7566 0.0986 YCC 4092.759739 2 1.5556 1685 | 0/25 43 h-m-p 1.6000 8.0000 0.0449 YCC 4092.702134 2 1.0678 1741 | 0/25 44 h-m-p 1.6000 8.0000 0.0191 YC 4092.692343 1 0.9736 1795 | 0/25 45 h-m-p 1.0893 8.0000 0.0171 YC 4092.686248 1 1.8899 1849 | 0/25 46 h-m-p 1.6000 8.0000 0.0190 YC 4092.672383 1 3.5700 1903 | 0/25 47 h-m-p 1.5847 8.0000 0.0428 YC 4092.644530 1 2.7487 1957 | 0/25 48 h-m-p 1.6000 8.0000 0.0623 CC 4092.620320 1 1.7200 2012 | 0/25 49 h-m-p 1.6000 8.0000 0.0397 YC 4092.615385 1 1.0681 2066 | 0/25 50 h-m-p 1.6000 8.0000 0.0103 YC 4092.614740 1 0.9646 2120 | 0/25 51 h-m-p 1.6000 8.0000 0.0015 Y 4092.614714 0 0.7845 2173 | 0/25 52 h-m-p 1.6000 8.0000 0.0003 Y 4092.614713 0 0.7791 2226 | 0/25 53 h-m-p 1.6000 8.0000 0.0001 Y 4092.614712 0 0.7042 2279 | 0/25 54 h-m-p 1.6000 8.0000 0.0000 Y 4092.614712 0 0.8662 2332 | 0/25 55 h-m-p 1.6000 8.0000 0.0000 C 4092.614712 0 0.6158 2385 | 0/25 56 h-m-p 0.5718 8.0000 0.0000 ------------Y 4092.614712 0 0.0000 2450 Out.. lnL = -4092.614712 2451 lfun, 29412 eigenQcodon, 539220 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -4168.930963 S = -4052.232817 -107.724068 Calculating f(w|X), posterior probabilities of site classes. did 10 / 276 patterns 14:12 did 20 / 276 patterns 14:12 did 30 / 276 patterns 14:12 did 40 / 276 patterns 14:12 did 50 / 276 patterns 14:13 did 60 / 276 patterns 14:13 did 70 / 276 patterns 14:13 did 80 / 276 patterns 14:13 did 90 / 276 patterns 14:13 did 100 / 276 patterns 14:14 did 110 / 276 patterns 14:14 did 120 / 276 patterns 14:14 did 130 / 276 patterns 14:14 did 140 / 276 patterns 14:14 did 150 / 276 patterns 14:14 did 160 / 276 patterns 14:15 did 170 / 276 patterns 14:15 did 180 / 276 patterns 14:15 did 190 / 276 patterns 14:15 did 200 / 276 patterns 14:16 did 210 / 276 patterns 14:16 did 220 / 276 patterns 14:16 did 230 / 276 patterns 14:16 did 240 / 276 patterns 14:16 did 250 / 276 patterns 14:17 did 260 / 276 patterns 14:17 did 270 / 276 patterns 14:17 did 276 / 276 patterns 14:17 Time used: 14:17 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=383 D_melanogaster_Csat-PB MALLPAPVTYSYS----HRTVNANTLKYISLLTLTLQNAILGLSMRYART D_sechellia_Csat-PB MALLPAPVTYPYS----HRAVNANTLKYISLLTLTLQNDILGLSMRYART D_simulans_Csat-PB MALLPAPVTYSYS----HRAVNANTLKYISLLTLTLQNAILGLSMRYART D_yakuba_Csat-PB MALLPAPIPYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART D_erecta_Csat-PB MALLPAPVTYSYS----RRPVNANTLKYVSLLTLTLQNAILGLSMRYART D_biarmipes_Csat-PB MALLPAPVSYAYAH--AHRPVNANTLKYISLLTLTLQNAILGLSMRYART D_suzukii_Csat-PB MALLPAPVSYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART D_eugracilis_Csat-PB MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART D_ficusphila_Csat-PB MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART D_rhopaloa_Csat-PB MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART D_elegans_Csat-PB MALLPAPVTYSYS----HRQVNANTLKYISLLTLTLQNAILGLSMRYART D_takahashii_Csat-PB MALLPAPVTYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART ******* .*.* * ********:********* *********** D_melanogaster_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_sechellia_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_simulans_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_yakuba_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_erecta_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_biarmipes_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_suzukii_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_eugracilis_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_ficusphila_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP D_rhopaloa_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_elegans_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP D_takahashii_Csat-PB RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP **********************************************:*** D_melanogaster_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_sechellia_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_simulans_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_yakuba_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_erecta_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_biarmipes_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_suzukii_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_eugracilis_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_ficusphila_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_rhopaloa_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_elegans_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI D_takahashii_Csat-PB MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI ************************************************** D_melanogaster_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA D_sechellia_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA D_simulans_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATA D_yakuba_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAA----AATA D_erecta_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATT D_biarmipes_Csat-PB LRRKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGG-AAA----AATA D_suzukii_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGG-AAA----AATA D_eugracilis_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTVGSSTGSAGG-AAA----AATA D_ficusphila_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGG-AAA----AATA D_rhopaloa_Csat-PB LRRKLLNTQWGALLLLVMGIVMVQLAQTVGPSSGSAGG-TGA----AATA D_elegans_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADG-AGAGAAATAAA D_takahashii_Csat-PB LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAG-ASA------TA *********************:****** ..::*.* * :.* :: D_melanogaster_Csat-PB ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_sechellia_Csat-PB ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_simulans_Csat-PB ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_yakuba_Csat-PB ASAGGAPVQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_erecta_Csat-PB DLSGGAPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_biarmipes_Csat-PB ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_suzukii_Csat-PB ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_eugracilis_Csat-PB ASSGGIPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_ficusphila_Csat-PB SSRGAAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_rhopaloa_Csat-PB SSVGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_elegans_Csat-PB SSAGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL D_takahashii_Csat-PB ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL *. * **:*************************************** D_melanogaster_Csat-PB SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV D_sechellia_Csat-PB SLLSIPFGLLTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV D_simulans_Csat-PB SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV D_yakuba_Csat-PB SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV D_erecta_Csat-PB SLLSIPFGLLTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVV D_biarmipes_Csat-PB SLLSIPFGLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVV D_suzukii_Csat-PB SLLSIPFGLITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVV D_eugracilis_Csat-PB SLLSIPFGLLTCFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVV D_ficusphila_Csat-PB SLLSIPFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVV D_rhopaloa_Csat-PB SLLSIPFGLLTCLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVV D_elegans_Csat-PB SLLSIPFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVV D_takahashii_Csat-PB SLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVV *********:**.:*******::***:*** ** **.************* D_melanogaster_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_sechellia_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_simulans_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_yakuba_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_erecta_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_biarmipes_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_suzukii_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_eugracilis_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_ficusphila_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLY D_rhopaloa_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_elegans_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY D_takahashii_Csat-PB VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY ****************************:*******:************* D_melanogaster_Csat-PB GYDPARSAPKPTMHGPGGDEEKLLPRVoooo-- D_sechellia_Csat-PB GYDPARSAPKPTMQGPGDDEEKLLPRVoooo-- D_simulans_Csat-PB GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- D_yakuba_Csat-PB GYDPARSAPKPTMQGPGGDEEKLLPRVooo--- D_erecta_Csat-PB GYDPARSAPKPTMQGPGGDEEKLLPRVoooo-- D_biarmipes_Csat-PB GYDPAKSAPKSSMQGPGGDEEKLLPRVoo---- D_suzukii_Csat-PB GYDPGRSAPKSTMQGPGGDEEKLLPRVoooo-- D_eugracilis_Csat-PB GYDPARSVPKLAMQGPGSDEEKLLPRVoooooo D_ficusphila_Csat-PB GYDPARSAPKSSMQAPGGDEEKLLPRV------ D_rhopaloa_Csat-PB GYDPARSAPKSSMQGPAGDEEKLLPRVoooooo D_elegans_Csat-PB GYDPARSAPKSSMQGPGGDEEKLLPRV------ D_takahashii_Csat-PB GYDPARSTPKSNMQGPGGDEEKLLPRVoooooo ****.:*.** *:.*..*********
>D_melanogaster_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCACGTATTCCTATTCC----------- -CATCGCACAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT CGCCAAACTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAAAA CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT CTGCGCCGCAAGCTGCTGAACACGCAGTGGGGTGCGCTGCTGCTCCTGGT GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGACGAGTG GCTCAGCCGGTGGT---GCCGCAGCT------------GCAGCCACGGCC GCCTCCTCTGGCGGTGCTCCCGAGCAGAACAGGATGCTCGGACTGTGGGC CGCACTGGGCGCCTGCTTCCTCTCCGGATTCGCGGGCATCTACTTTGAGA AGATCCTCAAGGGTGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGTTG AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGTTTCGTTAACGACGG CAGTAGGATCTTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATATTTCTCTAC GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCATGGTCCTGG CGGCGATGAGGAGAAGCTGCTGCCGCGCGTC------------------ >D_sechellia_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCACGTATCCCTATTCC----------- -CATCGCGCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGACATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT CGCCAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT CTGCGACGCAAGCTGCTGAACACGCAGTGGGGAGCGCTGCTGCTCCTTGT GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGACGAGTG GTTCGGCCGGTGGA---GCCGCAGCT------------GCCGCCACGGCC GCCTCCTCTGGCGGGGCGCCTGAGCAGAACAGGATGCTCGGACTGTGGGC CGCACTGGGCGCCTGCTTCCTCTCTGGATTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGTTG AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCATCGTTAACGACGG CAGCAGGATATTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATCTTCCTCTAC GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG CGACGATGAGGAGAAGCTGCTGCCACGCGTC------------------ >D_simulans_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCACGTATTCCTATTCC----------- -CATCGCGCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT CGCCAAACTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTACGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA CAATCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATT CTGCGCCGCAAGCTGCTGAACACGCAGTGGGGAGCGCTGCTGCTCCTGGT GATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGGCGAGTG GCTCGGCCGGTGGA---GCCGCAGCT------------GCCGCCACGGCC GCCTCCTCTGGCGGGGCGCCTGAGCAGAACAGGATGCTCGGACTGTGGGC CGCACTGGGCGCCTGCTTCCTCTCCGGATTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGAAATGTGCAGTTG AGTCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCTTCGTTAACGACGG CAGCAGGATCTTCGACCAGGGATTCTTCAAGGGCTACGATCTGTTTGTCT GGTACCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATCGTTGCCGTGGTG GTCAAGTACGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCCTCCATCTTCCTCTAC GGCTACGATCCGGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG CGGCGATGAGGAGAAGCTCCTGCCACGCGTC------------------ >D_yakuba_Csat-PB ATGGCGCTCCTGCCCGCCCCCATCCCGTATTCCTATTCC----------- -CATCGCCCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCCATCCTGGGCCTCAGCATGCGCTATGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCCGAGTT TGCCAAACTGATCACGTGCCTGTTCCTGGTCTTTAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTCCGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTACATCGTGCAGAA TAACCTGCTGTACGTCTCTGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACGGCCATGTTCGCGGTTGTCATC CTGCGTCGCAAGCTGCTGAACACCCAGTGGGGAGCGCTGCTGCTCCTGGT CATGGGCATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGACCGTCGAGTG GTTCAGCCGGTGGAGCTGCAGCAGCA------------GCAGCCACGGCC GCCTCCGCTGGAGGAGCACCTGTGCAGAACAGGATGCTTGGACTGTGGGC CGCATTGGGCGCCTGCTTCCTGTCCGGATTTGCGGGCATCTACTTCGAGA AGATCCTCAAGGGTGCCGAGATCTCCGTGTGGATGAGGAATGTGCAGTTG AGTCTGCTTAGCATTCCCTTCGGCCTGCTCACCTGCTTTGTGAACGACGG CAGCAGGATCTTCGATCAGGGATTCTTTAAGGGCTACGATCTGTTTGTCT GGTATCTGGTGCTGCTGCAGGCCGGCGGTGGATTGATTGTGGCCGTGGTG GTCAAGTATGCGGATAACATACTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTCGATTTCAATCTCACGT TGCAGTTCAGCTTTGGAGCTGGGCTGGTCATAGCCTCGATCTTTCTCTAC GGCTACGATCCTGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGACCTGG TGGCGATGAGGAGAAGCTGTTGCCACGCGTC------------------ >D_erecta_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCACATATTCTTATTCC----------- -CGTCGTCCAGTGAACGCCAATACGCTGAAGTACGTCAGCCTGCTGACGC TGACCCTACAGAATGCCATCCTGGGACTCAGCATGCGCTATGCCCGCACC CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTACTCATGGCAGAGTT TGCCAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTCCGCTCGCTGCACAAGACCATCATTGCGAATCCC ATGGACACGCTGAAGGTGTGCGTCCCCTCGCTGGTCTATATCGTTCAGAA CAACCTGCTGTACGTCTCGGCCTCCCATTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATTCTCACCACAGCCATGTTCGCGGTTGTCATC CTGCGTCGCAAGCTGCTAAACACCCAGTGGGGAGCACTGCTGCTCCTCGT GATGGGTATCGTCCTGGTGCAGTTGGCCCAAACGGAGGGTCCGGCGAGTG GTTCAGCCGGTGGA---GCTGCAGCA------------GCAGCCACGACT GATTTGTCTGGAGGAGCACCTGAGCAGAACAAGATGCTTGGACTGTGGGC CGCATTGGGAGCCTGCTTCCTATCCGGATTTGCGGGCATATACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGAGGAATGTGCAGTTG AGCCTGCTCAGCATTCCCTTCGGCCTGCTCACCTGCTTCATCAACGACGG CAGTAGGATCTTCGATCAGGGATTCTTCAAGGGCTACGATCTGTTTGTGT GCTATCTGGTCCTGCTGCAGGCCGGCGGTGGATTGATTGTGGCCGTGGTG GTCAAGTATGCGGATAACATTCTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATATACATCTTCGATTTCAATCTCACGC TGCAGTTTAGCTTTGGCGCTGGCCTGGTCATCGCCTCGATCTTTCTCTAC GGCTACGATCCTGCCAGGTCGGCGCCGAAGCCAACTATGCAGGGTCCTGG TGGCGATGAGGAGAAGCTGCTGCCACGCGTC------------------ >D_biarmipes_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCTCCTATGCCTATGCCCAT------GC CCATCGGCCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTATGCCCGCACC CGACCTGGCGACATCTTCCTCAGCTCCACGGCCGTGCTGATGGCCGAGTT CGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTGCGCTCGCTGCACAAGACCATCATCGCCAATCCC ATGGACACGTTGAAGGTGTGCGTGCCCTCGCTGGTGTACATCGTGCAGAA CAACCTGCTGTACGTGTCCGCCTCCCACTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATCCTCACCACGGCCATGTTCGCGGTGGTCATC CTGCGCCGCAAGCTGCTTAACACCCAGTGGGGTGCGCTGCTGCTCCTGGT GATGGGCATTGTCATGGTGCAGTTGGCCCAAACTGAGGGACCATCGAGTG GCTCAGCCGGTGGA---GCTGCGGCG------------GCAGCCACGGCC GCCTCCTCGGGCGGAGCACCGGAGCAGAACAGGATGCTGGGCCTGTGGGC CGCACTGGGCGCCTGTTTCCTCTCCGGCTTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGAGGAACGTTCAGCTG AGTCTGCTCAGCATTCCCTTCGGCCTGATCACCTGCTTCGTGAACGACGG CAGCCGGATCTTCGATCGGGGCTTCTTCCACGGCTACGATCTGTTCGTCT GGTACCTCGCTCTGCTGCAGGCCGGCGGCGGTTTGATTGTGGCCGTGGTG GTCAAGTACGCGGACAACATTCTGAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTCGACTTCAATCTCACGC TGCAGTTCAGCTTCGGCGCTGGCCTGGTCATCGCCTCCATCTTCCTGTAC GGCTACGATCCGGCCAAATCGGCGCCAAAGTCCAGCATGCAGGGCCCCGG CGGCGACGAGGAGAAGCTGCTGCCACGCGTC------------------ >D_suzukii_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCTCCTATTCCTATTCC----------- -CATCGACCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTATGCCCGCACC CGACCAGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCCGAGTT TGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGTTCGCTGCACAAGACCATCATTGCCAATCCC ATGGACACGCTGAAGGTGTGTGTGCCCTCGCTGGTCTACATCGTCCAAAA CAACCTGCTGTATGTATCCGCCTCCCACTTGGATGCAGCCACCTACCAGG TGACGTACCAGCTGAAGATCCTCACCACGGCCATGTTTGCTGTTGTGATC CTGCGCCGCAAGCTGCTCAACACACAGTGGGGTGCGTTGCTGCTCCTGGT GATGGGCATTGTCCTGGTGCAGTTGGCCCAAACAGTGGGACCATCGAGTG GCTCAGCCGGTGGA---GCTGCAGCA------------GCGGCCACGGCA GCCTCCTCTGGAGGAGCGCCCGAACAGAACAGAATGCTGGGTCTGTGGGC CGCACTGGGCGCCTGTTTCCTTTCTGGATTTGCGGGCATCTACTTTGAGA AGATCCTCAAGGGCGCCGAGATCTCTGTGTGGATGAGGAACGTTCAGTTG AGTCTGCTCAGCATTCCCTTCGGACTGATCACCTGCTTTGTAAACGACGG CAGCAGGATCTTCGACCGGGGATTCTTCAATGGCTACGATATGTTCGTCT GGTATCTAGTTCTGCTGCAGGCCGGCGGTGGCTTGATAGTGGCCGTGGTG GTCAAGTATGCGGACAACATTCTGAAGGGCTTCGCCACCTCGCTGGCCAT CATTATCTCATGTGTGGCCTCCATCTACATCTTTGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCTGGTCTGGTCATCGCTTCGATCTTCCTATAT GGCTATGATCCGGGCAGATCGGCGCCAAAGTCGACTATGCAGGGTCCTGG CGGCGATGAGGAGAAGCTGCTGCCACGCGTC------------------ >D_eugracilis_Csat-PB ATGGCGCTCCTTCCCGCACCCGTCACCTATTCCTAT-------------- ----CGTCCAGTGAATGCCAATACTCTAAAGTACATCAGTCTGCTGACGC TGACCCTCCAGAATGCTATCCTGGGCCTCAGTATGCGATATGCCCGTACT CGACCAGGCGACATCTTCCTCAGTTCAACGGCCGTGCTAATGGCCGAGTT CGCTAAACTGATCACGTGCCTGTTTCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTTGTCAGATCGCTGCACAAGACTATCATTGCCAATCCT ATGGATACGCTGAAGGTGTGTGTGCCCTCGCTGGTTTACATCGTCCAAAA CAACCTGTTGTATGTATCCGCCTCCCATTTGGATGCAGCTACTTACCAGG TTACGTACCAGCTGAAGATACTCACCACGGCCATGTTTGCGGTTGTTATT CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCATTGTTGCTCTTGGT GATGGGCATTGTTCTGGTGCAATTGGCCCAGACGGTGGGATCATCGACTG GGTCAGCCGGTGGA---GCTGCAGCA------------GCAGCCACGGCC GCCTCTTCCGGCGGAATACCCGAACAAAACAAGATGCTTGGGCTATGGGC TGCCCTGGGTGCCTGTTTCCTTTCCGGATTTGCGGGCATCTACTTCGAAA AGATACTAAAGGGTGCAGAGATCTCGGTGTGGATGAGGAATGTCCAGTTG AGTCTGCTCAGCATTCCTTTCGGCCTGCTCACCTGCTTTGTAAACGACGG CAGTAGGATCTTCGACCAAGGATTCTTCAATGGCTACGATCTGTTCGTTT GGTATCTAGTTCTGCTGCAGGCCGGCGGTGGTTTGATCGTGGCCGTGGTG GTGAAGTATGCAGACAACATACTTAAAGGTTTCGCCACCTCGTTGGCCAT CATCATATCGTGTGTGGCCTCCATCTACATCTTTGACTTCAATCTCACAC TCCAGTTTAGCTTTGGAGCTGGTCTGGTAATCGCCTCGATCTTTTTATAT GGCTATGATCCTGCCAGGTCCGTACCAAAATTGGCAATGCAGGGCCCTGG CAGCGATGAGGAGAAATTACTGCCACGCGTC------------------ >D_ficusphila_Csat-PB ATGGCGCTTCTGCCCGCACCTGCCACATACTCATACTCCTACTCGTATCC CCGCCGCCTAGTGAACGCCAACACGTTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAAAATGCCATCCTGGGGCTCAGCATGCGGTACGCCCGCACC CGGCCCGGCGACATCTTCCTCAGCTCCACGGCCGTCCTAATGGCCGAGTT CGCCAAGCTCATCACGTGCCTGTTCCTGGTCTTCAACGAAGAGGGCAAAG ATGCCCAAAAGTTTGTCCGTTCGCTGCACAAGACCATTGTTGCCAACCCC ATGGACACGCTGAAGGTATGTGTGCCGTCGCTGGTATACATTGTTCAAAA CAACCTGCTGTACGTGTCCGCCTCCCACTTGGACGCAGCCACCTACCAAG TTACGTATCAGCTGAAGATCCTTACCACGGCCATGTTTGCGGTGGTTATC CTGCGGCGCAAGCTGCTAAACACTCAGTGGGGCGCGCTGTTGCTGCTGGT GATGGGCATTGTGCTAGTGCAGCTGGCTCAAACAGAGGCTCCGGCGACTG GTTCGGCCGGTGGA---GCGGCAGCT------------GCGGCCACGGCG TCTTCTAGAGGAGCAGCCCCCGAACAGAACCGTATGCTCGGACTGTGGGC CGCCCTAGGCGCCTGTTTCCTCTCCGGATTTGCGGGCATCTACTTCGAAA AGATCCTCAAGGGAGCCGAGATCTCCGTGTGGATGAGGAACGTGCAACTA AGTCTGCTCAGTATTCCCTTTGGCCTGCTCACCTGCGTCGTTAACGATGG CAGCAGGATCTTCGACCAAGGCTTCTTCCACGGCTACGATTTGTTTGTCT GGTACCTGGTACTCCTGCAGGCCGGCGGCGGTTTGATCGTGGCCGTAGTG GTCAAGTATGCGGACAACATACTCAAAGGCTTTGCCACTTCGCTAGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTTGAGTTCAACCTTACGC TGCAGTTCACCTTTGGAGCTGGTCTGGTCATCGCTTCAATTTTCCTGTAT GGTTACGACCCGGCGAGATCGGCGCCGAAATCCAGTATGCAGGCTCCCGG CGGCGACGAGGAAAAGCTGCTGCCCCGTGTC------------------ >D_rhopaloa_Csat-PB ATGGCGCTTCTGCCTGCACCCGTCACCTATTCCTAT-------------- ----CGCCCAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACCTTGCAGAATGCTATCCTGGGCCTCAGCATGCGCTACGCCCGCACC CGGCCTGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCAGAGTT CGCCAAGCTCATTACGTGCCTGTTCCTGGTCTTCAATGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGTTCGCTGCATAAGACTATCATTGCGAATCCA ATGGACACGCTAAAGGTGTGTGTGCCCTCGCTGGTTTACATCGTCCAAAA CAACCTGCTGTATGTGTCCGCCTCCCACTTGGATGCGGCCACCTACCAGG TGACTTACCAGCTGAAGATCCTCACCACGGCCATGTTCGCGGTGGTGATT CTGCGTCGCAAGTTGCTCAACACCCAATGGGGTGCGCTGTTGCTCCTGGT TATGGGTATTGTCATGGTCCAGTTGGCTCAAACGGTGGGACCGTCGAGCG GTTCAGCCGGTGGA---ACTGGAGCT------------GCAGCGACCGCC TCTTCCGTTGGAGGAGCACCCGAACAGAACAGGATGCTCGGACTGTGGGC AGCACTGGGTGCCTGCTTCCTTTCCGGATTCGCGGGCATATACTTTGAGA AGATCCTCAAAGGAGCCGAGATCTCCGTGTGGATGAGGAATGTCCAGCTG AGTCTGCTGAGTATTCCCTTCGGCCTGCTCACTTGCCTCGTAAACGACGG CAGTCGGATCTTCGACCAGGGGTTCTTCAATGGCTACGATGCGTTCGTTT GGTACCTGGTTCTTCTGCAGGCCGGCGGTGGCCTGATCGTAGCCGTAGTG GTCAAGTATGCGGACAACATACTCAAGGGCTTCGCCACCTCCCTGGCCAT CATCATTTCGTGCGTGGCCTCCATCTACATCTTTGACTTCAATCTCACAC TGCAGTTTAGCTTCGGAGCTGGCCTGGTCATCGCCTCGATCTTTCTTTAT GGCTACGATCCTGCCAGATCGGCGCCAAAGTCGAGTATGCAGGGTCCTGC TGGCGACGAGGAAAAGTTGCTGCCGCGCGTC------------------ >D_elegans_Csat-PB ATGGCGCTCCTGCCCGCACCCGTCACCTATTCCTATTCC----------- -CATCGCCAAGTGAACGCCAATACGCTGAAGTACATCAGCCTGCTGACGC TGACTTTGCAGAATGCGATCCTGGGTCTCAGCATGCGCTATGCCCGCACC CGGCCGGGCGACATCTTCCTCAGTTCCACGGCCGTGCTAATGGCCGAGTT CGCCAAACTCATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGTTCGCTGCACAAGACCATCATTGCCAATCCC ATGGACACGCTGAAGGTGTGCGTGCCCTCGCTGGTGTACATCGTCCAGAA CAACCTGCTGTATGTGTCCGCCTCGCACTTGGATGCGGCCACCTACCAGG TGACGTACCAGCTAAAGATCCTCACCACGGCCATGTTTGCTGTGGTGATA CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCGCTGTTGCTCCTGGT GATGGGCATCGTTCTGGTGCAGTTGGCCCAAACTGTGGGCCCGTCGAGCG GTCCAGCCGATGGA---GCCGGAGCCGGAGCTGCGGCCACGGCCGCCGCC TCCTCCGCTGGCGGAGCACCCGAGCAGAACAGGATGCTCGGACTGTGGGC AGCACTGGGCGCCTGCTTTCTGTCCGGATTCGCTGGCATCTACTTCGAGA AGATCCTCAAGGGTGCCGAGATTTCCGTGTGGATGAGGAACGTCCAGCTG AGCCTGCTGAGCATTCCCTTCGGCCTGCTCACCTGCCTCGTGAACGACGG CAGCCGGATCTTCGAGCAGGGATTTTTCCATGGCTACGACGTATTCGTCT GGTATCTGGTCCTGCTGCAGGCCGGCGGCGGCCTGATCGTGGCCGTGGTG GTCAAGTATGCGGACAACATACTCAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTAGCCTCCATCTACATCTTCGACTTCAATCTCACGC TTCAGTTCAGCTTCGGAGCTGGCCTGGTCATCGCTTCGATCTTTCTATAT GGCTACGATCCGGCCAGATCGGCTCCAAAGTCGAGCATGCAGGGTCCTGG CGGCGACGAGGAGAAGCTGCTGCCGCGCGTC------------------ >D_takahashii_Csat-PB ATGGCGCTCCTGCCCGCCCCCGTCACCTATTCCTACTCC----------- -CATCGCCCAGTGAACGCCAATACCCTGAAGTACATCAGCCTGCTGACGC TGACCCTGCAGAATGCGATCCTGGGCCTCAGCATGCGGTACGCCCGCACC CGGCCAGGCGACATCTTCCTCAGCTCCACGGCCGTGCTAATGGCCGAGTT TGCCAAGCTGATCACGTGCCTGTTCCTGGTCTTCAACGAGGAGGGCAAGG ATGCCCAGAAGTTCGTCCGCTCGCTGCACAAGACCATCATTGCCAATCCC ATGGACACGCTGAAGGTGTGCGTGCCCTCGCTGGTTTACATCGTCCAGAA CAACCTGCTGTATGTGTCCGCCTCGCATCTGGATGCGGCCACCTACCAGG TGACGTACCAGCTGAAGATCCTCACCACCGCCATGTTTGCGGTGGTGATC CTGCGTCGCAAGCTGCTCAACACCCAGTGGGGTGCTCTGCTGCTCCTGGT GATGGGCATTGTCCTGGTGCAGTTGGCCCAAACGGTGGGTCCATCGAGTG GTTCGGCCGCTGGA---GCTTCGGCC------------------ACGGCC GCCTCCTCGGGAGGAGCGCCCGAACAGAACAGGATGCTGGGTCTGTGGGC CGCCCTGGGCGCCTGTTTCCTCTCCGGATTCGCGGGCATCTACTTCGAGA AGATCCTCAAGGGCGCCGAGATCTCCGTGTGGATGCGGAATGTGCAGCTG AGTCTGCTGAGCATTCCCTTCGGCCTGCTCACCTGCTTCGTGAACGACGG CAGCCGGATCTTCGACCAGGGATTCTTCCATGGCTACGATGTGTTCGTCT GGTATCTGGTGCTGCTGCAGGCCGGCGGTGGCCTGATCGTGGCCGTGGTG GTCAAGTATGCGGACAACATACTGAAGGGCTTCGCCACCTCGCTGGCCAT CATCATCTCGTGCGTGGCCTCCATCTACATCTTTGACTTCAATCTCACGC TGCAGTTCAGCTTCGGAGCCGGCCTGGTCATCGCCTCGATCTTTTTGTAT GGCTATGATCCTGCCAGATCCACGCCCAAGTCGAATATGCAGGGTCCTGG CGGCGACGAGGAGAAACTGCTGCCACGCGTC------------------
>D_melanogaster_Csat-PB MALLPAPVTYSYS----HRTVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMHGPGGDEEKLLPRV >D_sechellia_Csat-PB MALLPAPVTYPYS----HRAVNANTLKYISLLTLTLQNDILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCIVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGDDEEKLLPRV >D_simulans_Csat-PB MALLPAPVTYSYS----HRAVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRV >D_yakuba_Csat-PB MALLPAPIPYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPSSGSAGGAAAA----AATA ASAGGAPVQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRV >D_erecta_Csat-PB MALLPAPVTYSYS----RRPVNANTLKYVSLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPASGSAGG-AAA----AATT DLSGGAPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFINDGSRIFDQGFFKGYDLFVCYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKPTMQGPGGDEEKLLPRV >D_biarmipes_Csat-PB MALLPAPVSYAYAH--AHRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTEGPSSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFHGYDLFVWYLALLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPAKSAPKSSMQGPGGDEEKLLPRV >D_suzukii_Csat-PB MALLPAPVSYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAGG-AAA----AATA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLITCFVNDGSRIFDRGFFNGYDMFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPGRSAPKSTMQGPGGDEEKLLPRV >D_eugracilis_Csat-PB MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGSSTGSAGG-AAA----AATA ASSGGIPEQNKMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFNGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSVPKLAMQGPGSDEEKLLPRV >D_ficusphila_Csat-PB MALLPAPATYSYSYSYPRRLVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIVANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTEAPATGSAGG-AAA----AATA SSRGAAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCVVNDGSRIFDQGFFHGYDLFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFEFNLTLQFTFGAGLVIASIFLY GYDPARSAPKSSMQAPGGDEEKLLPRV >D_rhopaloa_Csat-PB MALLPAPVTYSY------RPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVMVQLAQTVGPSSGSAGG-TGA----AATA SSVGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFDQGFFNGYDAFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPAGDEEKLLPRV >D_elegans_Csat-PB MALLPAPVTYSYS----HRQVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGPADG-AGAGAAATAAA SSAGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCLVNDGSRIFEQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSAPKSSMQGPGGDEEKLLPRV >D_takahashii_Csat-PB MALLPAPVTYSYS----HRPVNANTLKYISLLTLTLQNAILGLSMRYART RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANP MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI LRRKLLNTQWGALLLLVMGIVLVQLAQTVGPSSGSAAG-ASA------TA ASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQL SLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAVV VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY GYDPARSTPKSNMQGPGGDEEKLLPRV
#NEXUS [ID: 3714470184] begin taxa; dimensions ntax=12; taxlabels D_melanogaster_Csat-PB D_sechellia_Csat-PB D_simulans_Csat-PB D_yakuba_Csat-PB D_erecta_Csat-PB D_biarmipes_Csat-PB D_suzukii_Csat-PB D_eugracilis_Csat-PB D_ficusphila_Csat-PB D_rhopaloa_Csat-PB D_elegans_Csat-PB D_takahashii_Csat-PB ; end; begin trees; translate 1 D_melanogaster_Csat-PB, 2 D_sechellia_Csat-PB, 3 D_simulans_Csat-PB, 4 D_yakuba_Csat-PB, 5 D_erecta_Csat-PB, 6 D_biarmipes_Csat-PB, 7 D_suzukii_Csat-PB, 8 D_eugracilis_Csat-PB, 9 D_ficusphila_Csat-PB, 10 D_rhopaloa_Csat-PB, 11 D_elegans_Csat-PB, 12 D_takahashii_Csat-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.02563567,((4:0.04508796,(((6:0.1236699,7:0.06648181)0.975:0.02750798,12:0.06769447)0.886:0.01903175,8:0.2643882,(9:0.37535,(10:0.1334081,11:0.1068383)0.982:0.03292487)0.586:0.01806518)1.000:0.1024992)0.902:0.01392421,5:0.06966311)1.000:0.0546459,(2:0.01913126,3:0.007979547)0.970:0.008567408); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.02563567,((4:0.04508796,(((6:0.1236699,7:0.06648181):0.02750798,12:0.06769447):0.01903175,8:0.2643882,(9:0.37535,(10:0.1334081,11:0.1068383):0.03292487):0.01806518):0.1024992):0.01392421,5:0.06966311):0.0546459,(2:0.01913126,3:0.007979547):0.008567408); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -4430.02 -4447.74 2 -4430.19 -4445.02 -------------------------------------- TOTAL -4430.10 -4447.11 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/216/Csat-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.620457 0.014000 1.396620 1.859078 1.615321 1323.57 1326.57 1.000 r(A<->C){all} 0.121403 0.000312 0.087439 0.156438 0.120534 1127.55 1142.89 1.001 r(A<->G){all} 0.279533 0.000942 0.220369 0.339272 0.278326 882.86 884.36 1.000 r(A<->T){all} 0.086000 0.000493 0.045637 0.129382 0.084810 860.08 927.98 1.000 r(C<->G){all} 0.042756 0.000072 0.027911 0.060683 0.042070 1119.96 1178.12 1.000 r(C<->T){all} 0.401755 0.001052 0.337355 0.463942 0.401372 823.13 832.60 1.002 r(G<->T){all} 0.068553 0.000167 0.044216 0.094335 0.067917 1143.45 1176.90 1.000 pi(A){all} 0.170142 0.000109 0.149423 0.189882 0.170042 1108.74 1169.05 1.000 pi(C){all} 0.329307 0.000157 0.304992 0.354699 0.329219 993.97 1021.39 1.000 pi(G){all} 0.280788 0.000161 0.256565 0.306325 0.280661 1000.62 1176.46 1.000 pi(T){all} 0.219763 0.000126 0.198288 0.242065 0.219560 890.75 993.60 1.003 alpha{1,2} 0.127970 0.000127 0.106339 0.149635 0.126989 1364.49 1432.74 1.000 alpha{3} 3.170872 0.619212 1.876519 4.761786 3.064193 1280.18 1347.57 1.000 pinvar{all} 0.291495 0.001539 0.219276 0.370737 0.292728 962.63 1134.57 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/216/Csat-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 12 ls = 364 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 3 2 9 8 0 | Ser TCT 2 3 2 1 2 0 | Tyr TAT 3 3 3 5 6 3 | Cys TGT 1 0 0 0 0 1 TTC 17 17 19 12 13 21 | TCC 8 6 8 7 5 10 | TAC 12 12 12 10 9 12 | TGC 4 5 5 5 6 4 Leu TTA 0 0 0 0 0 0 | TCA 1 0 0 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 7 6 4 | TCG 5 6 6 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 3 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 1 0 2 1 1 | Pro CCT 1 2 2 3 3 1 | His CAT 2 1 1 1 1 0 | Arg CGT 0 0 0 1 2 0 CTC 14 14 15 11 13 10 | CCC 6 6 5 5 5 6 | CAC 1 1 1 1 1 3 | CGC 7 6 7 6 5 5 CTA 0 0 0 0 3 0 | CCA 2 3 3 4 4 4 | Gln CAA 2 1 1 1 1 1 | CGA 0 1 2 0 1 1 CTG 36 35 35 34 32 37 | CCG 4 3 3 3 2 2 | CAG 11 13 13 13 13 12 | CGG 2 2 0 1 0 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 4 5 4 | Thr ACT 1 1 1 1 2 1 | Asn AAT 6 6 6 6 5 4 | Ser AGT 3 2 2 2 2 2 ATC 17 18 18 19 17 21 | ACC 7 7 7 8 8 9 | AAC 7 7 7 7 8 9 | AGC 5 6 6 6 6 7 ATA 2 2 1 2 2 0 | ACA 1 0 0 0 2 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0 Met ATG 9 9 9 9 9 10 | ACG 13 13 12 10 9 8 | AAG 14 14 14 14 15 14 | AGG 3 3 3 4 3 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 4 4 4 1 2 1 | Ala GCT 3 2 2 2 2 3 | Asp GAT 6 6 6 8 9 5 | Gly GGT 8 5 4 5 7 3 GTC 12 12 12 12 13 8 | GCC 25 24 25 25 22 26 | GAC 5 7 5 3 3 6 | GGC 17 16 18 13 13 24 GTA 2 2 2 1 1 0 | GCA 3 4 4 5 6 2 | Glu GAA 0 0 0 0 0 0 | GGA 5 7 7 11 10 3 GTG 10 10 10 14 12 18 | GCG 8 9 10 8 8 10 | GAG 9 9 9 8 9 9 | GGG 0 1 1 1 0 0 -------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 6 9 8 4 4 4 | Ser TCT 3 1 2 1 0 0 | Tyr TAT 8 8 3 5 7 6 | Cys TGT 3 3 2 1 0 1 TTC 15 12 12 16 16 17 | TCC 7 7 7 9 8 8 | TAC 7 7 12 10 8 9 | TGC 2 2 3 4 5 4 Leu TTA 0 2 0 0 0 0 | TCA 2 3 2 1 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 10 5 6 4 2 | TCG 7 7 6 7 9 11 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 4 3 4 1 0 | Pro CCT 1 4 1 4 1 2 | His CAT 0 1 0 1 1 2 | Arg CGT 1 3 3 2 2 1 CTC 9 11 10 12 13 10 | CCC 6 4 7 4 6 7 | CAC 2 1 3 1 2 1 | CGC 4 2 3 5 5 5 CTA 3 5 7 2 3 1 | CCA 5 4 0 3 2 4 | Gln CAA 2 4 7 3 2 1 | CGA 2 2 0 0 0 0 CTG 34 23 30 29 33 40 | CCG 1 0 4 2 4 0 | CAG 11 10 7 11 13 13 | CGG 2 0 3 2 2 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 4 5 6 3 3 | Thr ACT 1 5 3 4 2 0 | Asn AAT 5 7 1 7 4 6 | Ser AGT 2 5 3 4 1 2 ATC 19 16 17 16 19 20 | ACC 8 6 7 8 8 11 | AAC 9 7 12 7 9 8 | AGC 6 3 4 5 8 6 ATA 1 5 1 2 2 1 | ACA 2 1 2 1 0 0 | Lys AAA 0 4 3 1 1 1 | Arg AGA 2 1 2 1 1 1 Met ATG 10 9 9 10 9 9 | ACG 8 8 9 7 8 9 | AAG 14 11 11 13 13 13 | AGG 2 3 2 2 2 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 7 5 5 1 1 | Ala GCT 4 6 6 5 6 3 | Asp GAT 5 6 3 4 4 4 | Gly GGT 6 8 5 7 5 6 GTC 10 6 8 10 10 9 | GCC 22 21 23 19 24 28 | GAC 6 5 7 7 7 7 | GGC 17 13 15 13 18 17 GTA 2 4 4 3 2 0 | GCA 5 8 4 5 4 0 | Glu GAA 1 2 4 2 0 1 | GGA 8 6 6 9 7 6 GTG 14 13 12 12 17 20 | GCG 7 3 10 9 5 7 | GAG 7 6 6 6 9 7 | GGG 0 2 1 1 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Csat-PB position 1: T:0.17857 C:0.24176 A:0.25824 G:0.32143 position 2: T:0.37363 C:0.24725 A:0.21703 G:0.16209 position 3: T:0.13462 C:0.45055 A:0.05220 G:0.36264 Average T:0.22894 C:0.31319 A:0.17582 G:0.28205 #2: D_sechellia_Csat-PB position 1: T:0.17308 C:0.24451 A:0.25824 G:0.32418 position 2: T:0.37363 C:0.24451 A:0.22253 G:0.15934 position 3: T:0.12088 C:0.45055 A:0.05769 G:0.37088 Average T:0.22253 C:0.31319 A:0.17949 G:0.28480 #3: D_simulans_Csat-PB position 1: T:0.17857 C:0.24176 A:0.25275 G:0.32692 position 2: T:0.37363 C:0.24725 A:0.21703 G:0.16209 position 3: T:0.10989 C:0.46703 A:0.05769 G:0.36538 Average T:0.22070 C:0.31868 A:0.17582 G:0.28480 #4: D_yakuba_Csat-PB position 1: T:0.18681 C:0.23626 A:0.25549 G:0.32143 position 2: T:0.37637 C:0.24725 A:0.21429 G:0.16209 position 3: T:0.14011 C:0.41209 A:0.07143 G:0.37637 Average T:0.23443 C:0.29853 A:0.18040 G:0.28663 #5: D_erecta_Csat-PB position 1: T:0.18132 C:0.23901 A:0.25824 G:0.32143 position 2: T:0.37637 C:0.24176 A:0.22253 G:0.15934 position 3: T:0.15659 C:0.40385 A:0.08791 G:0.35165 Average T:0.23810 C:0.29487 A:0.18956 G:0.27747 #6: D_biarmipes_Csat-PB position 1: T:0.18407 C:0.23901 A:0.25275 G:0.32418 position 2: T:0.37088 C:0.24725 A:0.21703 G:0.16484 position 3: T:0.07967 C:0.49725 A:0.03571 G:0.38736 Average T:0.21154 C:0.32784 A:0.16850 G:0.29212 #7: D_suzukii_Csat-PB position 1: T:0.18956 C:0.23077 A:0.25824 G:0.32143 position 2: T:0.37637 C:0.24451 A:0.21154 G:0.16758 position 3: T:0.14835 C:0.40934 A:0.09615 G:0.34615 Average T:0.23810 C:0.29487 A:0.18864 G:0.27839 #8: D_eugracilis_Csat-PB position 1: T:0.20604 C:0.21429 A:0.26099 G:0.31868 position 2: T:0.38462 C:0.24176 A:0.21703 G:0.15659 position 3: T:0.22253 C:0.33791 A:0.14011 G:0.29945 Average T:0.27106 C:0.26465 A:0.20604 G:0.25824 #9: D_ficusphila_Csat-PB position 1: T:0.18132 C:0.24176 A:0.25000 G:0.32692 position 2: T:0.37363 C:0.25549 A:0.21703 G:0.15385 position 3: T:0.14560 C:0.41209 A:0.11538 G:0.32692 Average T:0.23352 C:0.30311 A:0.19414 G:0.26923 #10: D_rhopaloa_Csat-PB position 1: T:0.18681 C:0.23352 A:0.25824 G:0.32143 position 2: T:0.37637 C:0.24451 A:0.21429 G:0.16484 position 3: T:0.17582 C:0.40110 A:0.09066 G:0.33242 Average T:0.24634 C:0.29304 A:0.18773 G:0.27289 #11: D_elegans_Csat-PB position 1: T:0.17857 C:0.24725 A:0.24725 G:0.32692 position 2: T:0.37637 C:0.23901 A:0.21978 G:0.16484 position 3: T:0.11538 C:0.45604 A:0.06593 G:0.36264 Average T:0.22344 C:0.31410 A:0.17766 G:0.28480 #12: D_takahashii_Csat-PB position 1: T:0.18132 C:0.25000 A:0.25000 G:0.31868 position 2: T:0.37637 C:0.24725 A:0.21703 G:0.15934 position 3: T:0.11264 C:0.45879 A:0.04396 G:0.38462 Average T:0.22344 C:0.31868 A:0.17033 G:0.28755 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 61 | Ser S TCT 17 | Tyr Y TAT 60 | Cys C TGT 12 TTC 187 | TCC 90 | TAC 120 | TGC 49 Leu L TTA 2 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 61 | TCG 85 | TAG 0 | Trp W TGG 47 ------------------------------------------------------------------------------ Leu L CTT 18 | Pro P CCT 25 | His H CAT 11 | Arg R CGT 15 CTC 142 | CCC 67 | CAC 18 | CGC 60 CTA 24 | CCA 38 | Gln Q CAA 26 | CGA 9 CTG 398 | CCG 28 | CAG 140 | CGG 22 ------------------------------------------------------------------------------ Ile I ATT 54 | Thr T ACT 22 | Asn N AAT 63 | Ser S AGT 30 ATC 217 | ACC 94 | AAC 97 | AGC 68 ATA 21 | ACA 9 | Lys K AAA 16 | Arg R AGA 8 Met M ATG 111 | ACG 114 | AAG 160 | AGG 30 ------------------------------------------------------------------------------ Val V GTT 38 | Ala A GCT 44 | Asp D GAT 66 | Gly G GGT 69 GTC 122 | GCC 284 | GAC 68 | GGC 194 GTA 23 | GCA 50 | Glu E GAA 10 | GGA 85 GTG 162 | GCG 94 | GAG 94 | GGG 7 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.18384 C:0.23832 A:0.25504 G:0.32280 position 2: T:0.37569 C:0.24565 A:0.21726 G:0.16140 position 3: T:0.13851 C:0.42972 A:0.07624 G:0.35554 Average T:0.23268 C:0.30456 A:0.18284 G:0.27991 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Csat-PB D_sechellia_Csat-PB 0.1019 (0.0075 0.0734) D_simulans_Csat-PB 0.0604 (0.0037 0.0618) 0.1938 (0.0062 0.0321) D_yakuba_Csat-PB 0.0385 (0.0087 0.2270) 0.0586 (0.0125 0.2133) 0.0351 (0.0075 0.2130) D_erecta_Csat-PB 0.0538 (0.0131 0.2440) 0.0784 (0.0169 0.2158) 0.0482 (0.0106 0.2201) 0.0943 (0.0163 0.1728) D_biarmipes_Csat-PB 0.0495 (0.0176 0.3552) 0.0597 (0.0208 0.3475) 0.0506 (0.0163 0.3223) 0.0471 (0.0176 0.3732) 0.0608 (0.0252 0.4149) D_suzukii_Csat-PB 0.0340 (0.0138 0.4061) 0.0445 (0.0182 0.4098) 0.0318 (0.0125 0.3942) 0.0349 (0.0138 0.3952) 0.0464 (0.0208 0.4476) 0.0388 (0.0113 0.2900) D_eugracilis_Csat-PB 0.0277 (0.0207 0.7478) 0.0338 (0.0262 0.7755) 0.0280 (0.0211 0.7541) 0.0348 (0.0232 0.6686) 0.0387 (0.0264 0.6822) 0.0371 (0.0262 0.7081) 0.0397 (0.0192 0.4846) D_ficusphila_Csat-PB 0.0401 (0.0272 0.6792) 0.0443 (0.0298 0.6721) 0.0367 (0.0246 0.6706) 0.0379 (0.0283 0.7459) 0.0435 (0.0337 0.7739) 0.0447 (0.0285 0.6378) 0.0476 (0.0298 0.6272) 0.0332 (0.0353 1.0628) D_rhopaloa_Csat-PB 0.0446 (0.0214 0.4788) 0.0447 (0.0239 0.5349) 0.0406 (0.0214 0.5268) 0.0375 (0.0201 0.5354) 0.0526 (0.0284 0.5394) 0.0427 (0.0216 0.5050) 0.0406 (0.0188 0.4643) 0.0444 (0.0294 0.6632) 0.0414 (0.0289 0.6977) D_elegans_Csat-PB 0.0549 (0.0227 0.4134) 0.0602 (0.0259 0.4295) 0.0496 (0.0214 0.4318) 0.0555 (0.0227 0.4084) 0.0618 (0.0304 0.4917) 0.0648 (0.0227 0.3498) 0.0556 (0.0208 0.3740) 0.0435 (0.0295 0.6768) 0.0392 (0.0270 0.6896) 0.0380 (0.0138 0.3624) D_takahashii_Csat-PB 0.0436 (0.0164 0.3746) 0.0595 (0.0208 0.3499) 0.0428 (0.0151 0.3521) 0.0499 (0.0176 0.3530) 0.0584 (0.0240 0.4111) 0.0598 (0.0163 0.2733) 0.0487 (0.0126 0.2577) 0.0392 (0.0214 0.5464) 0.0441 (0.0266 0.6035) 0.0501 (0.0191 0.3812) 0.0496 (0.0151 0.3039) Model 0: one-ratio TREE # 1: (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 lnL(ntime: 20 np: 22): -4161.750023 +0.000000 13..1 13..14 14..15 15..4 15..16 16..17 17..18 18..6 18..7 17..12 16..8 16..19 19..9 19..20 20..10 20..11 14..5 13..21 21..2 21..3 0.041517 0.088736 0.021292 0.061879 0.157927 0.024856 0.039630 0.196844 0.074248 0.128592 0.328350 0.055961 0.470291 0.046978 0.166937 0.160081 0.096475 0.008288 0.030154 0.009847 3.380222 0.033369 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 2.20888 (1: 0.041517, ((4: 0.061879, (((6: 0.196844, 7: 0.074248): 0.039630, 12: 0.128592): 0.024856, 8: 0.328350, (9: 0.470291, (10: 0.166937, 11: 0.160081): 0.046978): 0.055961): 0.157927): 0.021292, 5: 0.096475): 0.088736, (2: 0.030154, 3: 0.009847): 0.008288); (D_melanogaster_Csat-PB: 0.041517, ((D_yakuba_Csat-PB: 0.061879, (((D_biarmipes_Csat-PB: 0.196844, D_suzukii_Csat-PB: 0.074248): 0.039630, D_takahashii_Csat-PB: 0.128592): 0.024856, D_eugracilis_Csat-PB: 0.328350, (D_ficusphila_Csat-PB: 0.470291, (D_rhopaloa_Csat-PB: 0.166937, D_elegans_Csat-PB: 0.160081): 0.046978): 0.055961): 0.157927): 0.021292, D_erecta_Csat-PB: 0.096475): 0.088736, (D_sechellia_Csat-PB: 0.030154, D_simulans_Csat-PB: 0.009847): 0.008288); Detailed output identifying parameters kappa (ts/tv) = 3.38022 omega (dN/dS) = 0.03337 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.042 854.9 237.1 0.0334 0.0019 0.0569 1.6 13.5 13..14 0.089 854.9 237.1 0.0334 0.0041 0.1216 3.5 28.8 14..15 0.021 854.9 237.1 0.0334 0.0010 0.0292 0.8 6.9 15..4 0.062 854.9 237.1 0.0334 0.0028 0.0848 2.4 20.1 15..16 0.158 854.9 237.1 0.0334 0.0072 0.2164 6.2 51.3 16..17 0.025 854.9 237.1 0.0334 0.0011 0.0341 1.0 8.1 17..18 0.040 854.9 237.1 0.0334 0.0018 0.0543 1.5 12.9 18..6 0.197 854.9 237.1 0.0334 0.0090 0.2697 7.7 64.0 18..7 0.074 854.9 237.1 0.0334 0.0034 0.1017 2.9 24.1 17..12 0.129 854.9 237.1 0.0334 0.0059 0.1762 5.0 41.8 16..8 0.328 854.9 237.1 0.0334 0.0150 0.4499 12.8 106.7 16..19 0.056 854.9 237.1 0.0334 0.0026 0.0767 2.2 18.2 19..9 0.470 854.9 237.1 0.0334 0.0215 0.6444 18.4 152.8 19..20 0.047 854.9 237.1 0.0334 0.0021 0.0644 1.8 15.3 20..10 0.167 854.9 237.1 0.0334 0.0076 0.2288 6.5 54.2 20..11 0.160 854.9 237.1 0.0334 0.0073 0.2194 6.3 52.0 14..5 0.096 854.9 237.1 0.0334 0.0044 0.1322 3.8 31.3 13..21 0.008 854.9 237.1 0.0334 0.0004 0.0114 0.3 2.7 21..2 0.030 854.9 237.1 0.0334 0.0014 0.0413 1.2 9.8 21..3 0.010 854.9 237.1 0.0334 0.0005 0.0135 0.4 3.2 tree length for dN: 0.1010 tree length for dS: 3.0269 Time used: 0:17 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 lnL(ntime: 20 np: 23): -4103.587880 +0.000000 13..1 13..14 14..15 15..4 15..16 16..17 17..18 18..6 18..7 17..12 16..8 16..19 19..9 19..20 20..10 20..11 14..5 13..21 21..2 21..3 0.043218 0.093399 0.023086 0.064282 0.169917 0.026267 0.042817 0.209503 0.076463 0.134177 0.350303 0.061419 0.511651 0.042771 0.177342 0.171254 0.102133 0.008797 0.031432 0.010164 3.445434 0.953152 0.014943 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 2.35039 (1: 0.043218, ((4: 0.064282, (((6: 0.209503, 7: 0.076463): 0.042817, 12: 0.134177): 0.026267, 8: 0.350303, (9: 0.511651, (10: 0.177342, 11: 0.171254): 0.042771): 0.061419): 0.169917): 0.023086, 5: 0.102133): 0.093399, (2: 0.031432, 3: 0.010164): 0.008797); (D_melanogaster_Csat-PB: 0.043218, ((D_yakuba_Csat-PB: 0.064282, (((D_biarmipes_Csat-PB: 0.209503, D_suzukii_Csat-PB: 0.076463): 0.042817, D_takahashii_Csat-PB: 0.134177): 0.026267, D_eugracilis_Csat-PB: 0.350303, (D_ficusphila_Csat-PB: 0.511651, (D_rhopaloa_Csat-PB: 0.177342, D_elegans_Csat-PB: 0.171254): 0.042771): 0.061419): 0.169917): 0.023086, D_erecta_Csat-PB: 0.102133): 0.093399, (D_sechellia_Csat-PB: 0.031432, D_simulans_Csat-PB: 0.010164): 0.008797); Detailed output identifying parameters kappa (ts/tv) = 3.44543 dN/dS (w) for site classes (K=2) p: 0.95315 0.04685 w: 0.01494 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.043 854.7 237.3 0.0611 0.0033 0.0543 2.8 12.9 13..14 0.093 854.7 237.3 0.0611 0.0072 0.1174 6.1 27.9 14..15 0.023 854.7 237.3 0.0611 0.0018 0.0290 1.5 6.9 15..4 0.064 854.7 237.3 0.0611 0.0049 0.0808 4.2 19.2 15..16 0.170 854.7 237.3 0.0611 0.0130 0.2136 11.2 50.7 16..17 0.026 854.7 237.3 0.0611 0.0020 0.0330 1.7 7.8 17..18 0.043 854.7 237.3 0.0611 0.0033 0.0538 2.8 12.8 18..6 0.210 854.7 237.3 0.0611 0.0161 0.2634 13.8 62.5 18..7 0.076 854.7 237.3 0.0611 0.0059 0.0961 5.0 22.8 17..12 0.134 854.7 237.3 0.0611 0.0103 0.1687 8.8 40.0 16..8 0.350 854.7 237.3 0.0611 0.0269 0.4404 23.0 104.5 16..19 0.061 854.7 237.3 0.0611 0.0047 0.0772 4.0 18.3 19..9 0.512 854.7 237.3 0.0611 0.0393 0.6432 33.6 152.7 19..20 0.043 854.7 237.3 0.0611 0.0033 0.0538 2.8 12.8 20..10 0.177 854.7 237.3 0.0611 0.0136 0.2229 11.6 52.9 20..11 0.171 854.7 237.3 0.0611 0.0132 0.2153 11.2 51.1 14..5 0.102 854.7 237.3 0.0611 0.0078 0.1284 6.7 30.5 13..21 0.009 854.7 237.3 0.0611 0.0007 0.0111 0.6 2.6 21..2 0.031 854.7 237.3 0.0611 0.0024 0.0395 2.1 9.4 21..3 0.010 854.7 237.3 0.0611 0.0008 0.0128 0.7 3.0 Time used: 0:53 Model 2: PositiveSelection (3 categories) TREE # 1: (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 lnL(ntime: 20 np: 25): -4103.587899 +0.000000 13..1 13..14 14..15 15..4 15..16 16..17 17..18 18..6 18..7 17..12 16..8 16..19 19..9 19..20 20..10 20..11 14..5 13..21 21..2 21..3 0.043220 0.093404 0.023087 0.064285 0.169926 0.026269 0.042819 0.209513 0.076467 0.134184 0.350320 0.061422 0.511676 0.042773 0.177350 0.171262 0.102138 0.008797 0.031434 0.010164 3.445436 0.953151 0.046849 0.014943 297.614764 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 2.35051 (1: 0.043220, ((4: 0.064285, (((6: 0.209513, 7: 0.076467): 0.042819, 12: 0.134184): 0.026269, 8: 0.350320, (9: 0.511676, (10: 0.177350, 11: 0.171262): 0.042773): 0.061422): 0.169926): 0.023087, 5: 0.102138): 0.093404, (2: 0.031434, 3: 0.010164): 0.008797); (D_melanogaster_Csat-PB: 0.043220, ((D_yakuba_Csat-PB: 0.064285, (((D_biarmipes_Csat-PB: 0.209513, D_suzukii_Csat-PB: 0.076467): 0.042819, D_takahashii_Csat-PB: 0.134184): 0.026269, D_eugracilis_Csat-PB: 0.350320, (D_ficusphila_Csat-PB: 0.511676, (D_rhopaloa_Csat-PB: 0.177350, D_elegans_Csat-PB: 0.171262): 0.042773): 0.061422): 0.169926): 0.023087, D_erecta_Csat-PB: 0.102138): 0.093404, (D_sechellia_Csat-PB: 0.031434, D_simulans_Csat-PB: 0.010164): 0.008797); Detailed output identifying parameters kappa (ts/tv) = 3.44544 dN/dS (w) for site classes (K=3) p: 0.95315 0.04685 0.00000 w: 0.01494 1.00000 297.61476 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.043 854.7 237.3 0.0611 0.0033 0.0543 2.8 12.9 13..14 0.093 854.7 237.3 0.0611 0.0072 0.1174 6.1 27.9 14..15 0.023 854.7 237.3 0.0611 0.0018 0.0290 1.5 6.9 15..4 0.064 854.7 237.3 0.0611 0.0049 0.0808 4.2 19.2 15..16 0.170 854.7 237.3 0.0611 0.0131 0.2136 11.2 50.7 16..17 0.026 854.7 237.3 0.0611 0.0020 0.0330 1.7 7.8 17..18 0.043 854.7 237.3 0.0611 0.0033 0.0538 2.8 12.8 18..6 0.210 854.7 237.3 0.0611 0.0161 0.2634 13.8 62.5 18..7 0.076 854.7 237.3 0.0611 0.0059 0.0961 5.0 22.8 17..12 0.134 854.7 237.3 0.0611 0.0103 0.1687 8.8 40.0 16..8 0.350 854.7 237.3 0.0611 0.0269 0.4404 23.0 104.5 16..19 0.061 854.7 237.3 0.0611 0.0047 0.0772 4.0 18.3 19..9 0.512 854.7 237.3 0.0611 0.0393 0.6432 33.6 152.7 19..20 0.043 854.7 237.3 0.0611 0.0033 0.0538 2.8 12.8 20..10 0.177 854.7 237.3 0.0611 0.0136 0.2229 11.6 52.9 20..11 0.171 854.7 237.3 0.0611 0.0132 0.2153 11.2 51.1 14..5 0.102 854.7 237.3 0.0611 0.0078 0.1284 6.7 30.5 13..21 0.009 854.7 237.3 0.0611 0.0007 0.0111 0.6 2.6 21..2 0.031 854.7 237.3 0.0611 0.0024 0.0395 2.1 9.4 21..3 0.010 854.7 237.3 0.0611 0.0008 0.0128 0.7 3.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.741 1.621 +- 0.767 190 S 0.711 1.569 +- 0.702 264 K 0.520 1.334 +- 0.429 349 T 0.528 1.354 +- 0.473 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.794 0.146 0.034 0.012 0.006 0.003 0.002 0.001 0.001 0.001 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 4:26 Model 3: discrete (3 categories) TREE # 1: (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 lnL(ntime: 20 np: 26): -4092.292415 +0.000000 13..1 13..14 14..15 15..4 15..16 16..17 17..18 18..6 18..7 17..12 16..8 16..19 19..9 19..20 20..10 20..11 14..5 13..21 21..2 21..3 0.043100 0.092986 0.022218 0.064805 0.170467 0.026298 0.042411 0.209151 0.077496 0.133462 0.350363 0.060592 0.510634 0.043632 0.176196 0.170762 0.101365 0.008687 0.031306 0.010154 3.415953 0.813833 0.165316 0.000001 0.155384 1.294269 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 2.34609 (1: 0.043100, ((4: 0.064805, (((6: 0.209151, 7: 0.077496): 0.042411, 12: 0.133462): 0.026298, 8: 0.350363, (9: 0.510634, (10: 0.176196, 11: 0.170762): 0.043632): 0.060592): 0.170467): 0.022218, 5: 0.101365): 0.092986, (2: 0.031306, 3: 0.010154): 0.008687); (D_melanogaster_Csat-PB: 0.043100, ((D_yakuba_Csat-PB: 0.064805, (((D_biarmipes_Csat-PB: 0.209151, D_suzukii_Csat-PB: 0.077496): 0.042411, D_takahashii_Csat-PB: 0.133462): 0.026298, D_eugracilis_Csat-PB: 0.350363, (D_ficusphila_Csat-PB: 0.510634, (D_rhopaloa_Csat-PB: 0.176196, D_elegans_Csat-PB: 0.170762): 0.043632): 0.060592): 0.170467): 0.022218, D_erecta_Csat-PB: 0.101365): 0.092986, (D_sechellia_Csat-PB: 0.031306, D_simulans_Csat-PB: 0.010154): 0.008687); Detailed output identifying parameters kappa (ts/tv) = 3.41595 dN/dS (w) for site classes (K=3) p: 0.81383 0.16532 0.02085 w: 0.00000 0.15538 1.29427 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.043 854.8 237.2 0.0527 0.0029 0.0556 2.5 13.2 13..14 0.093 854.8 237.2 0.0527 0.0063 0.1199 5.4 28.4 14..15 0.022 854.8 237.2 0.0527 0.0015 0.0287 1.3 6.8 15..4 0.065 854.8 237.2 0.0527 0.0044 0.0836 3.8 19.8 15..16 0.170 854.8 237.2 0.0527 0.0116 0.2198 9.9 52.2 16..17 0.026 854.8 237.2 0.0527 0.0018 0.0339 1.5 8.0 17..18 0.042 854.8 237.2 0.0527 0.0029 0.0547 2.5 13.0 18..6 0.209 854.8 237.2 0.0527 0.0142 0.2697 12.1 64.0 18..7 0.077 854.8 237.2 0.0527 0.0053 0.0999 4.5 23.7 17..12 0.133 854.8 237.2 0.0527 0.0091 0.1721 7.7 40.8 16..8 0.350 854.8 237.2 0.0527 0.0238 0.4518 20.3 107.2 16..19 0.061 854.8 237.2 0.0527 0.0041 0.0781 3.5 18.5 19..9 0.511 854.8 237.2 0.0527 0.0347 0.6585 29.6 156.2 19..20 0.044 854.8 237.2 0.0527 0.0030 0.0563 2.5 13.3 20..10 0.176 854.8 237.2 0.0527 0.0120 0.2272 10.2 53.9 20..11 0.171 854.8 237.2 0.0527 0.0116 0.2202 9.9 52.2 14..5 0.101 854.8 237.2 0.0527 0.0069 0.1307 5.9 31.0 13..21 0.009 854.8 237.2 0.0527 0.0006 0.0112 0.5 2.7 21..2 0.031 854.8 237.2 0.0527 0.0021 0.0404 1.8 9.6 21..3 0.010 854.8 237.2 0.0527 0.0007 0.0131 0.6 3.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.992** 1.285 176 T 0.580 0.816 190 S 0.997** 1.291 264 K 0.985* 1.278 268 L 0.931 1.216 349 T 0.954* 1.242 Time used: 5:44 Model 7: beta (10 categories) TREE # 1: (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 lnL(ntime: 20 np: 23): -4097.473100 +0.000000 13..1 13..14 14..15 15..4 15..16 16..17 17..18 18..6 18..7 17..12 16..8 16..19 19..9 19..20 20..10 20..11 14..5 13..21 21..2 21..3 0.043179 0.093118 0.022774 0.064531 0.168625 0.026233 0.041792 0.209366 0.077911 0.134908 0.347872 0.060195 0.508858 0.045825 0.176261 0.170121 0.101693 0.008685 0.031341 0.010200 3.403323 0.061370 0.987012 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 2.34349 (1: 0.043179, ((4: 0.064531, (((6: 0.209366, 7: 0.077911): 0.041792, 12: 0.134908): 0.026233, 8: 0.347872, (9: 0.508858, (10: 0.176261, 11: 0.170121): 0.045825): 0.060195): 0.168625): 0.022774, 5: 0.101693): 0.093118, (2: 0.031341, 3: 0.010200): 0.008685); (D_melanogaster_Csat-PB: 0.043179, ((D_yakuba_Csat-PB: 0.064531, (((D_biarmipes_Csat-PB: 0.209366, D_suzukii_Csat-PB: 0.077911): 0.041792, D_takahashii_Csat-PB: 0.134908): 0.026233, D_eugracilis_Csat-PB: 0.347872, (D_ficusphila_Csat-PB: 0.508858, (D_rhopaloa_Csat-PB: 0.176261, D_elegans_Csat-PB: 0.170121): 0.045825): 0.060195): 0.168625): 0.022774, D_erecta_Csat-PB: 0.101693): 0.093118, (D_sechellia_Csat-PB: 0.031341, D_simulans_Csat-PB: 0.010200): 0.008685); Detailed output identifying parameters kappa (ts/tv) = 3.40332 Parameters in M7 (beta): p = 0.06137 q = 0.98701 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00006 0.00091 0.00940 0.07219 0.43985 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.043 854.8 237.2 0.0522 0.0029 0.0558 2.5 13.2 13..14 0.093 854.8 237.2 0.0522 0.0063 0.1203 5.4 28.5 14..15 0.023 854.8 237.2 0.0522 0.0015 0.0294 1.3 7.0 15..4 0.065 854.8 237.2 0.0522 0.0044 0.0833 3.7 19.8 15..16 0.169 854.8 237.2 0.0522 0.0114 0.2178 9.7 51.7 16..17 0.026 854.8 237.2 0.0522 0.0018 0.0339 1.5 8.0 17..18 0.042 854.8 237.2 0.0522 0.0028 0.0540 2.4 12.8 18..6 0.209 854.8 237.2 0.0522 0.0141 0.2704 12.1 64.1 18..7 0.078 854.8 237.2 0.0522 0.0053 0.1006 4.5 23.9 17..12 0.135 854.8 237.2 0.0522 0.0091 0.1742 7.8 41.3 16..8 0.348 854.8 237.2 0.0522 0.0235 0.4493 20.1 106.6 16..19 0.060 854.8 237.2 0.0522 0.0041 0.0777 3.5 18.4 19..9 0.509 854.8 237.2 0.0522 0.0343 0.6572 29.3 155.9 19..20 0.046 854.8 237.2 0.0522 0.0031 0.0592 2.6 14.0 20..10 0.176 854.8 237.2 0.0522 0.0119 0.2276 10.2 54.0 20..11 0.170 854.8 237.2 0.0522 0.0115 0.2197 9.8 52.1 14..5 0.102 854.8 237.2 0.0522 0.0069 0.1313 5.9 31.2 13..21 0.009 854.8 237.2 0.0522 0.0006 0.0112 0.5 2.7 21..2 0.031 854.8 237.2 0.0522 0.0021 0.0405 1.8 9.6 21..3 0.010 854.8 237.2 0.0522 0.0007 0.0132 0.6 3.1 Time used: 9:29 Model 8: beta&w>1 (11 categories) TREE # 1: (1, ((4, (((6, 7), 12), 8, (9, (10, 11)))), 5), (2, 3)); MP score: 615 lnL(ntime: 20 np: 25): -4092.614712 +0.000000 13..1 13..14 14..15 15..4 15..16 16..17 17..18 18..6 18..7 17..12 16..8 16..19 19..9 19..20 20..10 20..11 14..5 13..21 21..2 21..3 0.043110 0.092953 0.022365 0.064682 0.170297 0.026261 0.042394 0.209065 0.077477 0.133506 0.350303 0.060456 0.510749 0.043857 0.176290 0.170843 0.101388 0.008680 0.031295 0.010174 3.417720 0.980876 0.077940 2.246849 1.351673 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 2.34614 (1: 0.043110, ((4: 0.064682, (((6: 0.209065, 7: 0.077477): 0.042394, 12: 0.133506): 0.026261, 8: 0.350303, (9: 0.510749, (10: 0.176290, 11: 0.170843): 0.043857): 0.060456): 0.170297): 0.022365, 5: 0.101388): 0.092953, (2: 0.031295, 3: 0.010174): 0.008680); (D_melanogaster_Csat-PB: 0.043110, ((D_yakuba_Csat-PB: 0.064682, (((D_biarmipes_Csat-PB: 0.209065, D_suzukii_Csat-PB: 0.077477): 0.042394, D_takahashii_Csat-PB: 0.133506): 0.026261, D_eugracilis_Csat-PB: 0.350303, (D_ficusphila_Csat-PB: 0.510749, (D_rhopaloa_Csat-PB: 0.176290, D_elegans_Csat-PB: 0.170843): 0.043857): 0.060456): 0.170297): 0.022365, D_erecta_Csat-PB: 0.101388): 0.092953, (D_sechellia_Csat-PB: 0.031295, D_simulans_Csat-PB: 0.010174): 0.008680); Detailed output identifying parameters kappa (ts/tv) = 3.41772 Parameters in M8 (beta&w>1): p0 = 0.98088 p = 0.07794 q = 2.24685 (p1 = 0.01912) w = 1.35167 dN/dS (w) for site classes (K=11) p: 0.09809 0.09809 0.09809 0.09809 0.09809 0.09809 0.09809 0.09809 0.09809 0.09809 0.01912 w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00015 0.00132 0.00832 0.04315 0.22046 1.35167 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.043 854.8 237.2 0.0527 0.0029 0.0556 2.5 13.2 13..14 0.093 854.8 237.2 0.0527 0.0063 0.1199 5.4 28.4 14..15 0.022 854.8 237.2 0.0527 0.0015 0.0288 1.3 6.8 15..4 0.065 854.8 237.2 0.0527 0.0044 0.0834 3.8 19.8 15..16 0.170 854.8 237.2 0.0527 0.0116 0.2196 9.9 52.1 16..17 0.026 854.8 237.2 0.0527 0.0018 0.0339 1.5 8.0 17..18 0.042 854.8 237.2 0.0527 0.0029 0.0547 2.5 13.0 18..6 0.209 854.8 237.2 0.0527 0.0142 0.2696 12.1 64.0 18..7 0.077 854.8 237.2 0.0527 0.0053 0.0999 4.5 23.7 17..12 0.134 854.8 237.2 0.0527 0.0091 0.1722 7.8 40.8 16..8 0.350 854.8 237.2 0.0527 0.0238 0.4518 20.3 107.2 16..19 0.060 854.8 237.2 0.0527 0.0041 0.0780 3.5 18.5 19..9 0.511 854.8 237.2 0.0527 0.0347 0.6587 29.7 156.3 19..20 0.044 854.8 237.2 0.0527 0.0030 0.0566 2.5 13.4 20..10 0.176 854.8 237.2 0.0527 0.0120 0.2273 10.2 53.9 20..11 0.171 854.8 237.2 0.0527 0.0116 0.2203 9.9 52.3 14..5 0.101 854.8 237.2 0.0527 0.0069 0.1308 5.9 31.0 13..21 0.009 854.8 237.2 0.0527 0.0006 0.0112 0.5 2.7 21..2 0.031 854.8 237.2 0.0527 0.0021 0.0404 1.8 9.6 21..3 0.010 854.8 237.2 0.0527 0.0007 0.0131 0.6 3.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.982* 1.332 190 S 0.991** 1.342 264 K 0.960* 1.306 268 L 0.866 1.200 349 T 0.908 1.248 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.934 1.589 +- 0.491 190 S 0.934 1.588 +- 0.482 264 K 0.803 1.418 +- 0.506 268 L 0.686 1.274 +- 0.558 349 T 0.771 1.384 +- 0.548 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.088 0.907 ws: 0.869 0.116 0.012 0.002 0.001 0.000 0.000 0.000 0.000 0.000 Time used: 14:17
Model 1: NearlyNeutral -4103.58788 Model 2: PositiveSelection -4103.587899 Model 0: one-ratio -4161.750023 Model 3: discrete -4092.292415 Model 7: beta -4097.4731 Model 8: beta&w>1 -4092.614712 Model 0 vs 1 116.32428599999912 Model 2 vs 1 3.80000001314329E-5 Model 8 vs 7 9.716776000000209 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.982* 1.332 190 S 0.991** 1.342 264 K 0.960* 1.306 268 L 0.866 1.200 349 T 0.908 1.248 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Csat-PB) Pr(w>1) post mean +- SE for w 14 T 0.934 1.589 +- 0.491 190 S 0.934 1.588 +- 0.482 264 K 0.803 1.418 +- 0.506 268 L 0.686 1.274 +- 0.558 349 T 0.771 1.384 +- 0.548