--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:51:26 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/fadE23/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1644.41 -1647.46 2 -1644.43 -1647.57 -------------------------------------- TOTAL -1644.42 -1647.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.881699 0.088110 0.338650 1.462084 0.845616 1468.06 1484.53 1.000 r(A<->C){all} 0.164422 0.018283 0.000074 0.439006 0.127064 239.23 240.06 1.001 r(A<->G){all} 0.166553 0.019843 0.000095 0.451560 0.129907 106.64 196.83 1.000 r(A<->T){all} 0.158334 0.019298 0.000010 0.448663 0.120719 241.09 273.84 1.000 r(C<->G){all} 0.162254 0.019710 0.000040 0.441978 0.124404 120.33 178.77 1.002 r(C<->T){all} 0.180578 0.022755 0.000084 0.483378 0.140270 153.75 198.33 1.003 r(G<->T){all} 0.167858 0.020402 0.000050 0.444202 0.129724 148.39 223.10 1.001 pi(A){all} 0.236261 0.000146 0.212782 0.259742 0.236218 988.85 1132.19 1.000 pi(C){all} 0.291451 0.000172 0.265510 0.316320 0.291242 1313.55 1344.10 1.001 pi(G){all} 0.290987 0.000168 0.267402 0.317412 0.290737 1207.59 1227.45 1.000 pi(T){all} 0.181301 0.000127 0.161142 0.205160 0.181016 1335.72 1418.36 1.000 alpha{1,2} 0.419650 0.216206 0.000180 1.356065 0.262052 889.43 1039.19 1.000 alpha{3} 0.457285 0.242008 0.000173 1.409732 0.298038 1224.26 1351.50 1.000 pinvar{all} 0.998709 0.000002 0.995897 0.999999 0.999186 948.94 1079.26 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1568.843758 Model 2: PositiveSelection -1568.843468 Model 0: one-ratio -1568.844034 Model 7: beta -1568.843468 Model 8: beta&w>1 -1568.843468 Model 0 vs 1 5.51999999970576E-4 Model 2 vs 1 5.799999998998828E-4 Model 8 vs 7 0.0
>C1 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C2 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C3 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C4 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C5 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C6 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=400 C1 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C2 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C3 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C4 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C5 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C6 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL ************************************************** C1 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C2 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C3 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C4 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C5 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C6 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS ************************************************** C1 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C2 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C3 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C4 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C5 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C6 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL ************************************************** C1 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C2 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C3 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C4 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C5 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C6 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV ************************************************** C1 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C2 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C3 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C4 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C5 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C6 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF ************************************************** C1 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C2 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C3 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C4 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C5 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C6 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL ************************************************** C1 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C2 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C3 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C4 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C5 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C6 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE ************************************************** C1 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C2 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C3 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C4 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C5 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C6 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK ************************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 400 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 400 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12000] Library Relaxation: Multi_proc [96] Relaxation Summary: [12000]--->[12000] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.533 Mb, Max= 30.980 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C2 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C3 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C4 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C5 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL C6 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL ************************************************** C1 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C2 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C3 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C4 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C5 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS C6 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS ************************************************** C1 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C2 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C3 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C4 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C5 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL C6 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL ************************************************** C1 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C2 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C3 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C4 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C5 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV C6 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV ************************************************** C1 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C2 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C3 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C4 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C5 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF C6 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF ************************************************** C1 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C2 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C3 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C4 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C5 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL C6 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL ************************************************** C1 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C2 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C3 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C4 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C5 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE C6 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE ************************************************** C1 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C2 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C3 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C4 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C5 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK C6 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK ************************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA C2 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA C3 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA C4 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA C5 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA C6 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA ************************************************** C1 GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG C2 GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG C3 GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG C4 GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG C5 GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG C6 GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ************************************************** C1 ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG C2 ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG C3 ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG C4 ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG C5 ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG C6 ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG ************************************************** C1 TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG C2 TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG C3 TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG C4 TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG C5 TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG C6 TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG ************************************************** C1 CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC C2 CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC C3 CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC C4 CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC C5 CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC C6 CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC ************************************************** C1 TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC C2 TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC C3 TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC C4 TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC C5 TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC C6 TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ************************************************** C1 ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA C2 ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA C3 ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA C4 ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA C5 ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA C6 ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA ************************************************** C1 CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG C2 CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG C3 CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG C4 CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG C5 CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG C6 CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG ************************************************** C1 AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC C2 AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC C3 AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC C4 AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC C5 AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC C6 AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC ************************************************** C1 GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG C2 GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG C3 GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG C4 GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG C5 GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG C6 GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG ************************************************** C1 GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG C2 GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG C3 GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG C4 GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG C5 GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG C6 GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG ************************************************** C1 GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC C2 GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC C3 GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC C4 GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC C5 GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC C6 GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ************************************************** C1 ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC C2 ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC C3 ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC C4 ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC C5 ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC C6 ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC ************************************************** C1 TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA C2 TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA C3 TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA C4 TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA C5 TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA C6 TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ************************************************** C1 ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC C2 ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC C3 ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC C4 ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC C5 ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC C6 ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC ************************************************** C1 GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC C2 GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC C3 GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC C4 GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC C5 GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC C6 GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC ************************************************** C1 CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT C2 CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT C3 CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT C4 CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT C5 CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT C6 CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT ************************************************** C1 GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG C2 GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG C3 GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG C4 GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG C5 GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG C6 GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG ************************************************** C1 CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC C2 CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC C3 CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC C4 CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC C5 CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC C6 CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC ************************************************** C1 GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA C2 GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA C3 GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA C4 GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA C5 GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA C6 GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA ************************************************** C1 AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA C2 AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA C3 AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA C4 AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA C5 AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA C6 AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA ************************************************** C1 TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC C2 TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC C3 TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC C4 TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC C5 TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC C6 TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC ************************************************** C1 CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC C2 CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC C3 CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC C4 CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC C5 CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC C6 CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC ************************************************** C1 AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG C2 AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG C3 AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG C4 AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG C5 AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG C6 AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG ************************************************** >C1 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >C2 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >C3 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >C4 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >C5 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >C6 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >C1 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C2 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C3 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C4 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C5 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >C6 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1200 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579776606 Setting output file names to "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1588399013 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9537121348 Seed = 1652119577 Swapseed = 1579776606 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2685.657535 -- -24.965149 Chain 2 -- -2685.657535 -- -24.965149 Chain 3 -- -2685.657535 -- -24.965149 Chain 4 -- -2685.657381 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2685.657535 -- -24.965149 Chain 2 -- -2685.657535 -- -24.965149 Chain 3 -- -2685.657535 -- -24.965149 Chain 4 -- -2685.657535 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2685.658] (-2685.658) (-2685.658) (-2685.657) * [-2685.658] (-2685.658) (-2685.658) (-2685.658) 500 -- (-1666.516) (-1672.959) [-1660.307] (-1668.468) * [-1653.949] (-1672.874) (-1675.483) (-1656.631) -- 0:00:00 1000 -- (-1657.233) (-1665.760) (-1651.752) [-1653.177] * [-1652.711] (-1656.806) (-1671.219) (-1666.169) -- 0:00:00 1500 -- (-1656.883) (-1661.713) [-1653.381] (-1648.105) * (-1657.403) (-1653.474) [-1651.294] (-1662.756) -- 0:00:00 2000 -- [-1654.508] (-1662.685) (-1650.947) (-1650.040) * (-1655.281) [-1652.509] (-1653.974) (-1653.048) -- 0:00:00 2500 -- (-1657.015) (-1651.537) [-1653.480] (-1650.595) * [-1650.173] (-1654.323) (-1658.668) (-1657.210) -- 0:00:00 3000 -- (-1652.905) (-1656.969) (-1653.478) [-1653.834] * (-1647.583) [-1653.805] (-1659.075) (-1655.423) -- 0:00:00 3500 -- [-1649.020] (-1657.914) (-1660.676) (-1653.036) * (-1657.965) (-1652.488) [-1652.018] (-1651.841) -- 0:00:00 4000 -- (-1654.214) (-1657.509) [-1657.138] (-1653.116) * (-1652.680) (-1652.572) (-1657.683) [-1651.506] -- 0:00:00 4500 -- (-1656.235) (-1649.115) [-1655.503] (-1661.556) * [-1654.570] (-1651.238) (-1657.124) (-1658.763) -- 0:00:00 5000 -- (-1654.389) (-1659.289) (-1651.119) [-1659.137] * (-1664.644) (-1651.797) (-1657.060) [-1655.447] -- 0:00:00 Average standard deviation of split frequencies: 0.085710 5500 -- (-1658.299) [-1659.476] (-1658.280) (-1651.179) * (-1658.621) (-1654.716) (-1658.998) [-1654.495] -- 0:00:00 6000 -- (-1657.356) [-1654.502] (-1653.383) (-1660.034) * (-1652.832) (-1659.174) [-1656.698] (-1648.459) -- 0:00:00 6500 -- (-1662.049) (-1657.900) [-1654.590] (-1652.588) * (-1657.034) (-1657.907) (-1654.344) [-1651.230] -- 0:00:00 7000 -- (-1653.067) (-1657.492) (-1667.185) [-1651.699] * [-1653.198] (-1659.675) (-1657.092) (-1655.766) -- 0:00:00 7500 -- (-1658.446) [-1660.747] (-1661.306) (-1658.725) * (-1647.251) (-1652.749) [-1650.235] (-1660.954) -- 0:00:00 8000 -- (-1654.366) [-1653.071] (-1656.740) (-1657.651) * (-1656.619) (-1657.574) [-1648.010] (-1653.560) -- 0:00:00 8500 -- (-1655.512) (-1652.992) (-1644.907) [-1651.095] * (-1658.533) (-1650.719) (-1657.689) [-1652.304] -- 0:00:00 9000 -- (-1650.262) (-1651.505) (-1645.122) [-1653.130] * [-1654.280] (-1656.250) (-1668.034) (-1650.945) -- 0:00:00 9500 -- (-1662.542) [-1656.216] (-1648.369) (-1651.278) * [-1653.114] (-1660.491) (-1654.318) (-1659.589) -- 0:00:00 10000 -- (-1659.774) (-1658.046) [-1644.562] (-1660.832) * (-1654.177) [-1651.642] (-1651.820) (-1653.341) -- 0:00:00 Average standard deviation of split frequencies: 0.075761 10500 -- (-1652.966) (-1658.663) [-1645.194] (-1652.046) * (-1656.280) (-1653.849) (-1653.013) [-1651.686] -- 0:00:00 11000 -- (-1651.965) (-1660.346) (-1646.206) [-1655.069] * (-1650.403) (-1654.495) (-1654.437) [-1652.871] -- 0:00:00 11500 -- (-1652.350) (-1654.551) (-1644.384) [-1650.012] * (-1655.541) [-1652.355] (-1654.759) (-1661.644) -- 0:00:00 12000 -- (-1659.240) (-1654.100) (-1646.165) [-1650.245] * (-1660.192) (-1662.431) [-1654.554] (-1655.254) -- 0:00:00 12500 -- [-1658.291] (-1649.239) (-1644.397) (-1657.006) * (-1654.343) (-1660.982) (-1651.954) [-1655.150] -- 0:00:00 13000 -- [-1652.757] (-1653.157) (-1643.228) (-1658.497) * [-1658.948] (-1653.972) (-1653.444) (-1652.705) -- 0:01:15 13500 -- (-1651.101) (-1654.316) [-1643.334] (-1652.319) * (-1656.187) [-1651.155] (-1653.987) (-1658.793) -- 0:01:13 14000 -- (-1657.850) (-1646.170) [-1644.823] (-1657.161) * [-1652.272] (-1655.285) (-1664.668) (-1647.515) -- 0:01:10 14500 -- [-1649.965] (-1646.101) (-1645.816) (-1664.842) * (-1655.264) (-1652.349) (-1656.583) [-1655.165] -- 0:01:07 15000 -- (-1655.569) (-1645.977) [-1647.421] (-1652.022) * (-1650.518) [-1659.483] (-1658.606) (-1657.823) -- 0:01:05 Average standard deviation of split frequencies: 0.060562 15500 -- [-1654.182] (-1645.394) (-1646.236) (-1652.567) * [-1660.222] (-1651.571) (-1657.905) (-1654.016) -- 0:01:03 16000 -- (-1660.857) (-1647.796) [-1646.762] (-1654.778) * (-1660.649) (-1661.557) [-1649.841] (-1648.848) -- 0:01:01 16500 -- [-1659.606] (-1648.035) (-1643.783) (-1660.491) * [-1650.880] (-1662.742) (-1655.138) (-1650.418) -- 0:00:59 17000 -- (-1651.059) (-1646.551) [-1645.895] (-1649.510) * (-1651.120) (-1651.690) (-1655.039) [-1651.619] -- 0:00:57 17500 -- (-1655.697) (-1646.629) [-1644.474] (-1648.728) * (-1655.978) (-1656.499) (-1655.396) [-1654.226] -- 0:00:56 18000 -- [-1649.147] (-1645.236) (-1642.894) (-1648.414) * [-1649.707] (-1653.353) (-1654.160) (-1657.261) -- 0:00:54 18500 -- (-1649.179) [-1644.748] (-1643.613) (-1650.870) * (-1656.551) [-1654.158] (-1661.403) (-1646.113) -- 0:00:53 19000 -- (-1652.658) (-1644.833) [-1645.633] (-1648.794) * (-1657.044) (-1653.893) (-1650.545) [-1660.215] -- 0:00:51 19500 -- (-1658.998) (-1646.778) [-1645.438] (-1649.160) * (-1656.048) (-1660.915) (-1651.783) [-1652.627] -- 0:00:50 20000 -- (-1654.759) (-1646.611) [-1643.552] (-1644.151) * [-1651.692] (-1663.850) (-1655.340) (-1649.105) -- 0:00:49 Average standard deviation of split frequencies: 0.050987 20500 -- (-1649.882) (-1645.545) (-1643.760) [-1644.534] * [-1651.365] (-1655.190) (-1655.897) (-1654.980) -- 0:00:47 21000 -- [-1650.698] (-1644.474) (-1645.226) (-1644.574) * (-1656.705) [-1656.950] (-1652.192) (-1657.636) -- 0:00:46 21500 -- (-1656.782) [-1643.683] (-1651.048) (-1643.929) * (-1657.705) [-1649.656] (-1662.535) (-1656.585) -- 0:00:45 22000 -- (-1655.395) [-1643.606] (-1644.696) (-1644.794) * (-1654.588) [-1653.835] (-1651.169) (-1659.831) -- 0:00:44 22500 -- (-1651.285) (-1643.961) [-1645.185] (-1645.781) * (-1650.513) (-1665.188) [-1651.667] (-1662.053) -- 0:00:43 23000 -- (-1659.161) [-1643.841] (-1649.182) (-1644.324) * (-1654.637) (-1658.320) [-1657.930] (-1650.547) -- 0:00:42 23500 -- (-1655.342) (-1643.957) [-1644.386] (-1645.303) * [-1651.433] (-1651.063) (-1656.655) (-1651.866) -- 0:00:41 24000 -- (-1668.753) (-1644.094) (-1645.292) [-1644.130] * (-1653.038) (-1648.119) (-1655.458) [-1652.520] -- 0:00:40 24500 -- (-1655.641) (-1644.840) [-1644.575] (-1644.337) * (-1658.852) (-1662.232) [-1653.792] (-1657.605) -- 0:00:39 25000 -- [-1652.289] (-1646.515) (-1645.170) (-1653.726) * (-1656.772) (-1645.662) [-1654.845] (-1661.567) -- 0:00:39 Average standard deviation of split frequencies: 0.049105 25500 -- (-1649.288) (-1649.414) (-1645.743) [-1650.128] * (-1655.064) (-1643.278) (-1657.666) [-1653.079] -- 0:00:38 26000 -- [-1652.221] (-1645.426) (-1646.762) (-1644.683) * (-1655.428) (-1644.225) [-1652.064] (-1655.360) -- 0:00:37 26500 -- (-1656.536) (-1648.354) (-1645.342) [-1644.083] * (-1656.374) (-1644.178) (-1663.054) [-1655.302] -- 0:00:36 27000 -- (-1650.074) (-1648.674) (-1645.558) [-1643.956] * (-1662.666) [-1645.098] (-1668.214) (-1652.165) -- 0:00:36 27500 -- [-1650.882] (-1648.081) (-1646.340) (-1643.658) * (-1647.627) [-1644.453] (-1653.177) (-1651.065) -- 0:00:35 28000 -- (-1651.479) (-1652.867) [-1644.684] (-1646.367) * (-1645.835) (-1643.663) [-1655.656] (-1659.536) -- 0:01:09 28500 -- (-1656.795) [-1644.362] (-1644.736) (-1654.973) * (-1648.874) (-1648.328) [-1654.534] (-1654.515) -- 0:01:08 29000 -- [-1650.158] (-1643.659) (-1645.723) (-1651.462) * (-1646.086) (-1649.314) [-1653.520] (-1657.019) -- 0:01:06 29500 -- (-1661.842) [-1643.659] (-1644.453) (-1648.374) * (-1645.404) (-1650.142) [-1649.718] (-1654.277) -- 0:01:05 30000 -- (-1650.922) (-1645.701) [-1645.320] (-1651.615) * (-1643.074) (-1645.100) [-1654.440] (-1653.638) -- 0:01:04 Average standard deviation of split frequencies: 0.046116 30500 -- (-1665.182) [-1646.862] (-1646.704) (-1648.147) * [-1644.063] (-1646.805) (-1661.287) (-1653.627) -- 0:01:03 31000 -- (-1655.321) [-1644.203] (-1645.741) (-1649.982) * [-1647.846] (-1645.193) (-1651.731) (-1658.738) -- 0:01:02 31500 -- (-1658.176) (-1644.330) (-1648.650) [-1648.835] * (-1643.441) [-1644.696] (-1648.804) (-1653.578) -- 0:01:01 32000 -- (-1658.248) (-1645.822) (-1644.977) [-1645.700] * (-1644.265) (-1646.321) [-1658.220] (-1647.257) -- 0:01:00 32500 -- (-1652.559) (-1643.394) [-1644.179] (-1645.373) * (-1642.793) (-1649.562) [-1654.048] (-1647.803) -- 0:00:59 33000 -- (-1655.214) [-1643.457] (-1647.065) (-1649.677) * [-1643.385] (-1645.417) (-1658.115) (-1653.204) -- 0:00:58 33500 -- (-1653.384) (-1646.315) (-1648.146) [-1645.902] * (-1643.819) (-1644.555) (-1653.944) [-1655.352] -- 0:00:57 34000 -- (-1657.453) (-1646.136) (-1647.821) [-1647.734] * [-1643.933] (-1644.645) (-1657.592) (-1655.926) -- 0:00:56 34500 -- (-1661.783) [-1645.638] (-1646.326) (-1644.572) * (-1648.940) (-1643.938) [-1651.351] (-1658.447) -- 0:00:55 35000 -- (-1657.150) [-1644.960] (-1644.653) (-1645.269) * (-1643.710) (-1644.268) (-1648.815) [-1653.553] -- 0:00:55 Average standard deviation of split frequencies: 0.044376 35500 -- (-1656.295) (-1645.632) [-1643.611] (-1644.379) * (-1646.407) (-1645.536) (-1656.420) [-1652.055] -- 0:00:54 36000 -- [-1652.685] (-1643.366) (-1643.526) (-1646.193) * (-1647.163) [-1644.659] (-1649.610) (-1662.567) -- 0:00:53 36500 -- (-1660.353) (-1644.803) (-1646.408) [-1646.755] * (-1645.580) [-1644.553] (-1648.858) (-1653.674) -- 0:00:52 37000 -- [-1662.845] (-1643.566) (-1645.795) (-1645.703) * (-1645.526) (-1645.226) (-1649.007) [-1659.555] -- 0:00:52 37500 -- (-1661.254) (-1643.713) [-1646.076] (-1644.896) * (-1643.591) (-1645.298) (-1653.150) [-1653.299] -- 0:00:51 38000 -- [-1649.833] (-1645.120) (-1645.596) (-1644.277) * [-1643.385] (-1645.052) (-1652.254) (-1651.479) -- 0:00:50 38500 -- [-1653.278] (-1645.105) (-1644.729) (-1643.810) * (-1642.790) (-1645.485) [-1654.406] (-1650.127) -- 0:00:49 39000 -- [-1649.196] (-1643.551) (-1647.391) (-1643.862) * [-1642.846] (-1646.663) (-1649.890) (-1651.407) -- 0:00:49 39500 -- (-1654.637) (-1646.174) (-1649.980) [-1644.413] * (-1643.395) (-1647.809) [-1657.283] (-1653.783) -- 0:00:48 40000 -- (-1653.720) (-1644.432) [-1644.733] (-1644.076) * (-1643.423) (-1647.040) (-1652.119) [-1656.117] -- 0:00:48 Average standard deviation of split frequencies: 0.044436 40500 -- (-1659.087) [-1646.767] (-1645.528) (-1643.886) * (-1645.236) (-1647.363) (-1649.178) [-1654.642] -- 0:00:47 41000 -- (-1654.614) (-1651.874) [-1645.603] (-1644.274) * (-1645.373) [-1646.642] (-1657.627) (-1654.087) -- 0:00:46 41500 -- (-1645.593) [-1650.230] (-1643.704) (-1649.425) * (-1647.237) [-1646.761] (-1655.393) (-1657.772) -- 0:00:46 42000 -- (-1643.668) (-1650.945) [-1647.373] (-1650.577) * (-1647.916) [-1645.464] (-1654.648) (-1650.356) -- 0:00:45 42500 -- (-1645.745) (-1652.519) [-1643.812] (-1645.080) * [-1645.218] (-1645.296) (-1666.442) (-1653.810) -- 0:00:45 43000 -- [-1644.924] (-1648.184) (-1643.691) (-1644.718) * (-1643.256) (-1646.774) (-1656.772) [-1652.361] -- 0:00:44 43500 -- (-1645.728) [-1643.855] (-1643.598) (-1643.794) * (-1643.041) (-1644.995) (-1654.463) [-1650.330] -- 0:01:05 44000 -- (-1643.687) (-1646.715) [-1643.810] (-1644.083) * (-1643.398) [-1644.327] (-1656.602) (-1652.058) -- 0:01:05 44500 -- (-1646.493) [-1643.565] (-1643.469) (-1642.844) * (-1642.873) [-1644.705] (-1656.963) (-1657.444) -- 0:01:04 45000 -- [-1645.040] (-1644.770) (-1644.005) (-1644.682) * [-1646.262] (-1645.027) (-1661.336) (-1659.829) -- 0:01:03 Average standard deviation of split frequencies: 0.036893 45500 -- (-1644.823) [-1645.343] (-1643.413) (-1645.321) * (-1642.937) (-1645.024) (-1660.781) [-1651.553] -- 0:01:02 46000 -- (-1651.208) [-1649.935] (-1643.936) (-1643.862) * (-1649.019) [-1643.758] (-1663.436) (-1653.346) -- 0:01:02 46500 -- (-1649.951) (-1646.084) (-1643.830) [-1644.377] * (-1643.196) [-1645.955] (-1654.043) (-1652.762) -- 0:01:01 47000 -- [-1648.681] (-1645.393) (-1644.312) (-1645.009) * (-1642.894) [-1647.700] (-1658.067) (-1657.604) -- 0:01:00 47500 -- [-1647.286] (-1645.399) (-1644.352) (-1644.751) * (-1642.786) (-1648.213) [-1662.425] (-1655.279) -- 0:01:00 48000 -- (-1649.330) (-1643.720) (-1644.181) [-1643.978] * (-1643.912) [-1648.171] (-1650.649) (-1658.829) -- 0:00:59 48500 -- (-1645.976) (-1643.698) (-1644.007) [-1643.482] * (-1642.798) [-1646.250] (-1655.367) (-1658.027) -- 0:00:58 49000 -- (-1644.617) (-1643.717) [-1643.547] (-1643.447) * (-1643.141) (-1646.911) (-1662.354) [-1654.051] -- 0:00:58 49500 -- (-1644.703) (-1646.458) (-1645.404) [-1646.481] * (-1643.774) [-1646.031] (-1661.306) (-1653.969) -- 0:00:57 50000 -- (-1645.912) (-1648.104) [-1644.575] (-1644.726) * [-1642.968] (-1646.383) (-1659.041) (-1652.766) -- 0:00:57 Average standard deviation of split frequencies: 0.038196 50500 -- (-1644.059) (-1647.915) [-1645.249] (-1643.952) * (-1647.043) (-1648.298) (-1660.440) [-1650.399] -- 0:00:56 51000 -- [-1644.745] (-1646.522) (-1644.827) (-1645.342) * (-1644.217) [-1646.805] (-1648.441) (-1663.738) -- 0:00:55 51500 -- (-1644.383) (-1646.021) [-1644.834] (-1644.072) * (-1647.019) (-1645.288) (-1653.495) [-1656.210] -- 0:00:55 52000 -- [-1644.103] (-1645.088) (-1644.595) (-1643.852) * (-1646.376) [-1645.413] (-1658.576) (-1657.879) -- 0:00:54 52500 -- (-1644.337) (-1645.808) (-1644.652) [-1643.971] * (-1644.376) (-1645.411) [-1654.216] (-1659.103) -- 0:00:54 53000 -- (-1644.355) (-1645.270) (-1644.682) [-1647.438] * (-1647.145) [-1644.195] (-1652.672) (-1652.250) -- 0:00:53 53500 -- [-1645.685] (-1648.380) (-1643.716) (-1647.654) * (-1644.710) [-1647.837] (-1658.249) (-1655.068) -- 0:00:53 54000 -- (-1644.512) [-1644.764] (-1645.963) (-1645.219) * (-1644.629) [-1645.456] (-1649.765) (-1651.342) -- 0:00:52 54500 -- (-1644.056) (-1644.666) [-1645.963] (-1645.071) * (-1645.912) (-1644.455) [-1652.946] (-1656.292) -- 0:00:52 55000 -- (-1645.073) (-1647.196) [-1645.408] (-1643.542) * (-1646.102) (-1651.577) [-1647.015] (-1655.949) -- 0:00:51 Average standard deviation of split frequencies: 0.036010 55500 -- (-1647.963) (-1645.070) (-1644.534) [-1646.070] * (-1644.644) (-1645.603) [-1656.749] (-1661.467) -- 0:00:51 56000 -- (-1644.977) [-1645.188] (-1644.558) (-1645.142) * (-1644.688) (-1645.374) [-1650.241] (-1658.822) -- 0:00:50 56500 -- [-1645.565] (-1645.296) (-1644.323) (-1644.674) * (-1644.559) [-1645.569] (-1654.144) (-1661.072) -- 0:00:50 57000 -- [-1643.927] (-1646.223) (-1646.936) (-1644.578) * (-1643.411) [-1643.253] (-1654.877) (-1659.846) -- 0:00:49 57500 -- (-1643.912) (-1649.522) [-1644.518] (-1644.809) * [-1645.069] (-1643.400) (-1652.111) (-1656.853) -- 0:00:49 58000 -- [-1643.289] (-1645.656) (-1644.254) (-1646.340) * [-1643.874] (-1643.360) (-1652.462) (-1663.717) -- 0:00:48 58500 -- [-1643.312] (-1646.020) (-1643.852) (-1650.068) * (-1645.939) (-1643.583) [-1654.071] (-1651.028) -- 0:00:48 59000 -- (-1646.438) [-1644.769] (-1647.341) (-1646.455) * (-1645.446) (-1644.161) [-1660.340] (-1654.537) -- 0:01:03 59500 -- (-1647.912) (-1644.960) [-1643.483] (-1645.094) * (-1647.249) (-1643.963) (-1652.908) [-1650.156] -- 0:01:03 60000 -- (-1646.905) (-1646.434) (-1645.468) [-1645.550] * (-1643.891) (-1643.968) (-1657.653) [-1652.486] -- 0:01:02 Average standard deviation of split frequencies: 0.033535 60500 -- (-1648.283) [-1644.149] (-1645.714) (-1646.415) * (-1645.935) (-1645.892) (-1653.761) [-1649.396] -- 0:01:02 61000 -- (-1645.314) (-1645.429) [-1645.857] (-1647.162) * (-1646.690) (-1645.003) [-1650.471] (-1656.863) -- 0:01:01 61500 -- (-1645.432) (-1644.652) (-1643.992) [-1644.949] * (-1646.906) (-1646.074) [-1657.503] (-1651.370) -- 0:01:01 62000 -- (-1644.002) (-1644.350) (-1644.520) [-1645.574] * (-1645.462) (-1646.105) (-1654.285) [-1651.252] -- 0:01:00 62500 -- [-1645.204] (-1649.733) (-1644.557) (-1645.821) * [-1644.141] (-1650.106) (-1659.010) (-1658.233) -- 0:01:00 63000 -- [-1644.023] (-1650.237) (-1648.076) (-1645.131) * (-1643.770) (-1645.730) [-1648.691] (-1649.425) -- 0:00:59 63500 -- (-1644.018) (-1643.875) (-1646.460) [-1644.148] * [-1644.779] (-1645.577) (-1653.763) (-1650.554) -- 0:00:58 64000 -- (-1646.646) [-1643.711] (-1646.215) (-1644.554) * [-1644.348] (-1644.210) (-1651.512) (-1650.880) -- 0:00:58 64500 -- (-1646.551) (-1647.601) [-1644.346] (-1643.801) * (-1643.803) (-1646.240) (-1652.961) [-1648.636] -- 0:00:58 65000 -- (-1650.746) (-1646.540) (-1644.494) [-1643.469] * (-1643.240) (-1648.300) [-1655.317] (-1655.166) -- 0:00:57 Average standard deviation of split frequencies: 0.028570 65500 -- (-1648.718) (-1644.275) [-1643.338] (-1644.541) * (-1644.915) (-1645.423) [-1648.539] (-1656.093) -- 0:00:57 66000 -- [-1646.155] (-1646.522) (-1643.821) (-1646.562) * (-1644.821) (-1644.103) (-1658.095) [-1647.632] -- 0:00:56 66500 -- (-1644.237) (-1645.126) (-1653.628) [-1648.685] * (-1647.467) (-1644.567) (-1651.276) [-1649.493] -- 0:00:56 67000 -- (-1643.458) [-1645.874] (-1645.684) (-1645.995) * (-1645.490) (-1645.126) (-1654.257) [-1651.499] -- 0:00:55 67500 -- (-1644.549) (-1645.412) [-1645.032] (-1643.733) * [-1646.549] (-1646.707) (-1663.171) (-1652.822) -- 0:00:55 68000 -- (-1646.361) [-1643.528] (-1645.887) (-1644.647) * (-1644.592) (-1646.631) [-1652.572] (-1653.291) -- 0:00:54 68500 -- (-1645.513) (-1646.254) (-1646.168) [-1644.064] * (-1645.338) (-1645.168) [-1652.251] (-1655.276) -- 0:00:54 69000 -- (-1650.390) [-1645.870] (-1645.423) (-1647.291) * [-1648.610] (-1646.691) (-1652.138) (-1660.627) -- 0:00:53 69500 -- (-1650.920) [-1645.297] (-1644.334) (-1645.915) * (-1648.799) [-1646.247] (-1653.275) (-1654.125) -- 0:00:53 70000 -- (-1653.414) (-1646.291) (-1645.351) [-1644.663] * (-1649.710) (-1646.220) [-1651.447] (-1656.685) -- 0:00:53 Average standard deviation of split frequencies: 0.030019 70500 -- (-1645.454) (-1644.784) [-1645.396] (-1646.795) * (-1648.680) (-1651.894) [-1649.741] (-1660.892) -- 0:00:52 71000 -- (-1648.373) (-1647.006) (-1643.567) [-1643.507] * (-1643.965) (-1644.710) [-1654.137] (-1654.332) -- 0:00:52 71500 -- (-1647.630) [-1646.899] (-1643.754) (-1644.424) * (-1643.469) (-1646.400) [-1657.610] (-1654.283) -- 0:00:51 72000 -- [-1648.593] (-1646.006) (-1645.336) (-1644.934) * (-1646.360) [-1645.219] (-1651.633) (-1652.977) -- 0:00:51 72500 -- (-1647.306) (-1649.823) [-1643.672] (-1650.406) * (-1649.390) (-1643.953) [-1655.209] (-1652.469) -- 0:00:51 73000 -- (-1646.654) (-1645.439) [-1645.395] (-1652.724) * (-1647.080) [-1643.353] (-1649.102) (-1652.848) -- 0:00:50 73500 -- (-1645.923) (-1645.090) [-1645.667] (-1644.068) * [-1646.193] (-1646.350) (-1654.984) (-1653.062) -- 0:00:50 74000 -- [-1643.111] (-1645.101) (-1654.802) (-1646.465) * (-1646.219) (-1645.521) (-1653.815) [-1649.089] -- 0:01:02 74500 -- (-1643.144) (-1643.967) [-1650.294] (-1646.065) * (-1648.823) [-1644.379] (-1652.974) (-1654.599) -- 0:01:02 75000 -- (-1643.134) (-1643.958) [-1645.850] (-1645.964) * (-1647.548) [-1644.138] (-1658.178) (-1652.906) -- 0:01:01 Average standard deviation of split frequencies: 0.027365 75500 -- (-1643.217) (-1643.840) [-1645.914] (-1644.241) * (-1644.381) [-1643.627] (-1655.556) (-1648.525) -- 0:01:01 76000 -- (-1643.476) (-1644.016) [-1646.347] (-1648.334) * [-1644.909] (-1646.165) (-1655.889) (-1655.841) -- 0:01:00 76500 -- (-1643.158) (-1644.901) [-1647.179] (-1653.035) * (-1644.799) [-1646.060] (-1664.650) (-1655.742) -- 0:01:00 77000 -- (-1643.280) (-1645.990) [-1645.837] (-1645.482) * (-1648.792) (-1644.511) [-1646.267] (-1651.495) -- 0:00:59 77500 -- (-1643.526) [-1646.892] (-1645.599) (-1645.021) * (-1645.849) (-1644.833) (-1651.038) [-1648.640] -- 0:00:59 78000 -- [-1644.042] (-1644.664) (-1645.939) (-1645.224) * (-1646.911) [-1644.706] (-1660.561) (-1663.716) -- 0:00:59 78500 -- (-1645.666) (-1653.362) (-1650.420) [-1644.038] * [-1645.826] (-1648.978) (-1659.568) (-1659.966) -- 0:00:58 79000 -- (-1645.043) (-1644.951) (-1649.268) [-1643.986] * (-1646.627) (-1647.370) [-1652.716] (-1653.657) -- 0:00:58 79500 -- (-1644.240) [-1645.346] (-1647.116) (-1644.035) * (-1649.108) [-1647.300] (-1650.116) (-1652.850) -- 0:00:57 80000 -- (-1644.044) (-1644.269) [-1643.430] (-1649.746) * (-1648.554) (-1648.984) [-1656.842] (-1655.516) -- 0:00:57 Average standard deviation of split frequencies: 0.028245 80500 -- (-1646.423) (-1643.194) [-1644.042] (-1653.167) * [-1645.285] (-1647.933) (-1653.712) (-1653.898) -- 0:00:57 81000 -- [-1645.071] (-1643.826) (-1644.089) (-1648.782) * [-1645.930] (-1647.637) (-1656.341) (-1657.405) -- 0:00:56 81500 -- (-1644.631) (-1643.820) [-1646.210] (-1643.974) * (-1649.017) (-1649.092) [-1650.990] (-1656.571) -- 0:00:56 82000 -- (-1645.018) (-1643.691) (-1648.143) [-1643.956] * (-1653.860) (-1644.365) [-1655.788] (-1654.435) -- 0:00:55 82500 -- [-1647.669] (-1643.206) (-1644.992) (-1643.453) * (-1647.517) (-1645.394) (-1651.183) [-1655.549] -- 0:00:55 83000 -- (-1645.879) (-1642.986) [-1643.714] (-1645.240) * (-1646.892) (-1644.910) [-1657.171] (-1653.851) -- 0:00:55 83500 -- (-1650.245) (-1643.724) [-1643.927] (-1644.425) * (-1646.697) [-1645.302] (-1652.142) (-1656.198) -- 0:00:54 84000 -- [-1645.925] (-1643.060) (-1643.681) (-1647.968) * (-1648.795) (-1647.945) (-1651.966) [-1650.859] -- 0:00:54 84500 -- (-1647.695) (-1646.165) (-1646.011) [-1644.706] * (-1645.929) (-1647.363) [-1653.315] (-1654.712) -- 0:00:54 85000 -- (-1646.553) (-1646.448) [-1645.390] (-1648.858) * (-1646.158) [-1646.727] (-1670.131) (-1653.732) -- 0:00:53 Average standard deviation of split frequencies: 0.026189 85500 -- (-1645.944) [-1644.467] (-1646.408) (-1645.578) * (-1646.462) (-1645.264) [-1651.882] (-1648.829) -- 0:00:53 86000 -- (-1645.416) (-1644.454) [-1645.005] (-1646.731) * (-1646.814) (-1647.428) (-1659.977) [-1653.433] -- 0:00:53 86500 -- [-1644.771] (-1643.386) (-1642.827) (-1647.007) * (-1646.188) (-1643.537) [-1650.651] (-1663.961) -- 0:00:52 87000 -- (-1644.932) (-1644.402) (-1643.398) [-1644.864] * (-1647.541) (-1643.947) [-1653.171] (-1655.096) -- 0:00:52 87500 -- (-1645.132) (-1644.916) (-1645.533) [-1647.675] * [-1645.365] (-1643.875) (-1652.346) (-1654.284) -- 0:00:52 88000 -- (-1644.218) (-1645.654) [-1646.568] (-1647.087) * (-1646.046) (-1651.380) [-1658.104] (-1660.712) -- 0:00:51 88500 -- (-1644.974) [-1644.867] (-1645.720) (-1648.092) * (-1645.050) [-1647.950] (-1657.961) (-1653.971) -- 0:00:51 89000 -- (-1644.939) (-1644.072) (-1646.183) [-1644.679] * (-1647.912) (-1646.140) (-1654.910) [-1655.430] -- 0:00:51 89500 -- (-1644.849) (-1644.138) (-1644.777) [-1645.455] * [-1647.691] (-1645.828) (-1650.543) (-1656.386) -- 0:01:01 90000 -- (-1644.918) [-1644.084] (-1644.857) (-1643.876) * (-1644.828) [-1643.374] (-1657.602) (-1656.607) -- 0:01:00 Average standard deviation of split frequencies: 0.025708 90500 -- (-1644.846) (-1644.339) [-1645.149] (-1644.978) * [-1645.755] (-1644.969) (-1653.684) (-1652.564) -- 0:01:00 91000 -- (-1649.907) (-1647.883) (-1644.346) [-1644.562] * [-1645.046] (-1644.423) (-1648.427) (-1656.011) -- 0:00:59 91500 -- (-1651.302) (-1647.935) (-1643.749) [-1644.510] * (-1646.010) (-1643.865) [-1658.174] (-1656.798) -- 0:00:59 92000 -- [-1647.099] (-1648.546) (-1643.712) (-1645.065) * (-1649.876) (-1643.656) [-1647.647] (-1654.406) -- 0:00:59 92500 -- (-1643.033) (-1647.293) [-1644.226] (-1644.969) * (-1645.151) [-1644.709] (-1654.245) (-1655.776) -- 0:00:58 93000 -- (-1643.054) (-1648.290) [-1644.565] (-1648.459) * (-1645.670) [-1643.018] (-1663.250) (-1651.843) -- 0:00:58 93500 -- [-1645.008] (-1647.486) (-1645.193) (-1649.829) * (-1643.631) (-1644.954) (-1662.059) [-1655.091] -- 0:00:58 94000 -- (-1646.104) [-1644.748] (-1645.819) (-1648.792) * (-1643.676) (-1645.365) (-1649.320) [-1653.970] -- 0:00:57 94500 -- (-1646.732) [-1645.674] (-1645.691) (-1646.680) * [-1644.611] (-1643.903) (-1652.928) (-1647.692) -- 0:00:57 95000 -- (-1649.093) (-1644.616) [-1644.809] (-1645.868) * [-1643.634] (-1643.975) (-1666.318) (-1652.682) -- 0:00:57 Average standard deviation of split frequencies: 0.024552 95500 -- [-1646.855] (-1644.536) (-1644.983) (-1645.698) * (-1643.622) (-1645.907) [-1647.305] (-1653.683) -- 0:00:56 96000 -- (-1647.103) [-1646.312] (-1645.444) (-1647.043) * (-1643.897) (-1646.886) (-1657.594) [-1651.785] -- 0:00:56 96500 -- (-1644.356) [-1646.985] (-1644.906) (-1644.881) * (-1643.831) (-1644.044) [-1653.956] (-1650.367) -- 0:00:56 97000 -- (-1643.473) (-1644.828) [-1645.646] (-1646.142) * (-1644.046) (-1644.902) [-1651.582] (-1658.530) -- 0:00:55 97500 -- [-1643.474] (-1643.972) (-1646.171) (-1646.526) * (-1643.476) [-1645.395] (-1657.464) (-1659.466) -- 0:00:55 98000 -- [-1645.671] (-1643.826) (-1643.979) (-1646.526) * (-1645.253) (-1644.050) [-1653.173] (-1661.471) -- 0:00:55 98500 -- [-1644.965] (-1645.657) (-1645.114) (-1645.587) * (-1643.213) (-1643.818) [-1655.643] (-1658.706) -- 0:00:54 99000 -- (-1643.557) (-1645.528) (-1646.310) [-1644.876] * (-1643.559) (-1643.545) (-1650.934) [-1653.530] -- 0:00:54 99500 -- [-1644.494] (-1644.843) (-1646.994) (-1644.244) * (-1645.523) (-1645.239) [-1648.464] (-1661.040) -- 0:00:54 100000 -- (-1643.888) (-1645.042) (-1647.522) [-1644.733] * (-1644.065) [-1647.642] (-1654.875) (-1659.278) -- 0:00:54 Average standard deviation of split frequencies: 0.023180 100500 -- (-1644.458) (-1645.735) (-1645.138) [-1644.971] * [-1644.076] (-1653.492) (-1666.679) (-1657.765) -- 0:00:53 101000 -- (-1644.510) (-1644.980) [-1644.801] (-1644.279) * (-1647.194) [-1646.368] (-1662.544) (-1657.561) -- 0:00:53 101500 -- (-1644.442) (-1643.878) (-1645.349) [-1646.716] * (-1646.919) (-1644.159) (-1654.923) [-1652.508] -- 0:00:53 102000 -- (-1644.610) (-1643.034) [-1643.145] (-1644.628) * (-1646.107) [-1644.972] (-1655.649) (-1657.002) -- 0:00:52 102500 -- (-1644.361) [-1645.016] (-1643.868) (-1646.808) * (-1645.430) (-1645.416) [-1650.319] (-1657.774) -- 0:00:52 103000 -- (-1644.534) (-1644.392) [-1642.810] (-1647.509) * (-1644.327) [-1645.500] (-1654.754) (-1649.337) -- 0:00:52 103500 -- (-1643.193) [-1645.545] (-1643.242) (-1647.230) * (-1643.733) [-1644.798] (-1654.571) (-1657.908) -- 0:00:51 104000 -- (-1643.168) (-1643.584) (-1645.815) [-1644.667] * (-1647.420) [-1644.522] (-1657.191) (-1651.832) -- 0:00:51 104500 -- (-1643.698) (-1648.019) [-1644.497] (-1644.726) * (-1647.411) [-1644.381] (-1659.366) (-1649.603) -- 0:00:51 105000 -- (-1645.128) (-1652.231) (-1645.142) [-1644.412] * (-1643.109) (-1645.560) (-1653.676) [-1656.022] -- 0:00:59 Average standard deviation of split frequencies: 0.022236 105500 -- (-1643.408) (-1647.996) (-1644.787) [-1644.492] * (-1643.164) (-1649.051) (-1654.316) [-1650.251] -- 0:00:59 106000 -- (-1645.022) [-1649.320] (-1643.936) (-1646.066) * [-1644.603] (-1648.922) (-1658.112) (-1652.647) -- 0:00:59 106500 -- [-1646.296] (-1649.798) (-1644.263) (-1645.840) * (-1644.423) (-1646.138) [-1651.351] (-1657.042) -- 0:00:58 107000 -- (-1643.929) (-1644.835) [-1645.805] (-1644.576) * [-1645.454] (-1647.076) (-1663.459) (-1653.905) -- 0:00:58 107500 -- (-1642.893) (-1648.137) [-1645.231] (-1645.454) * (-1645.582) (-1645.885) [-1655.928] (-1653.650) -- 0:00:58 108000 -- [-1643.365] (-1650.509) (-1646.566) (-1643.696) * (-1643.858) [-1647.941] (-1657.745) (-1653.512) -- 0:00:57 108500 -- (-1643.795) (-1643.680) [-1645.917] (-1648.320) * (-1643.614) (-1649.524) [-1655.011] (-1650.857) -- 0:00:57 109000 -- (-1644.753) (-1643.732) (-1646.326) [-1644.273] * [-1644.647] (-1645.072) (-1659.018) (-1653.893) -- 0:00:57 109500 -- (-1644.341) (-1645.365) [-1648.036] (-1644.339) * [-1645.436] (-1645.347) (-1660.158) (-1650.742) -- 0:00:56 110000 -- (-1643.539) (-1645.299) (-1648.043) [-1644.735] * (-1645.677) [-1643.483] (-1654.285) (-1654.873) -- 0:00:56 Average standard deviation of split frequencies: 0.025110 110500 -- (-1644.342) (-1645.466) (-1644.880) [-1646.843] * [-1646.013] (-1644.512) (-1653.359) (-1659.444) -- 0:00:56 111000 -- (-1643.133) (-1644.200) [-1644.444] (-1646.927) * (-1645.904) (-1646.324) (-1649.514) [-1649.310] -- 0:00:56 111500 -- [-1643.723] (-1643.173) (-1643.114) (-1643.939) * [-1647.089] (-1644.357) (-1663.491) (-1657.127) -- 0:00:55 112000 -- (-1646.778) [-1643.630] (-1643.437) (-1646.475) * (-1646.857) (-1644.470) (-1659.181) [-1649.654] -- 0:00:55 112500 -- (-1645.852) (-1642.968) (-1644.067) [-1645.491] * (-1643.282) [-1645.242] (-1653.717) (-1656.833) -- 0:00:55 113000 -- [-1646.108] (-1646.419) (-1643.986) (-1653.171) * (-1642.944) (-1646.930) [-1655.736] (-1654.181) -- 0:00:54 113500 -- (-1648.891) [-1645.486] (-1648.101) (-1645.534) * (-1642.929) (-1645.175) [-1654.061] (-1653.843) -- 0:00:54 114000 -- (-1646.867) (-1643.746) (-1645.120) [-1644.468] * [-1644.035] (-1645.186) (-1659.164) (-1658.092) -- 0:00:54 114500 -- (-1644.938) [-1643.736] (-1644.112) (-1648.691) * (-1643.428) (-1648.670) [-1651.550] (-1655.160) -- 0:00:54 115000 -- (-1644.980) [-1644.329] (-1645.317) (-1645.686) * (-1643.500) [-1646.722] (-1657.047) (-1656.019) -- 0:00:53 Average standard deviation of split frequencies: 0.024597 115500 -- (-1645.390) [-1643.643] (-1643.492) (-1645.984) * (-1643.459) (-1647.507) (-1650.463) [-1650.183] -- 0:00:53 116000 -- (-1643.619) (-1644.463) [-1644.873] (-1644.066) * [-1643.408] (-1646.601) (-1655.744) (-1659.972) -- 0:00:53 116500 -- (-1643.022) (-1643.559) [-1644.134] (-1644.701) * (-1646.509) [-1643.610] (-1653.201) (-1651.310) -- 0:00:53 117000 -- [-1644.298] (-1644.244) (-1644.836) (-1645.663) * (-1643.547) (-1643.590) (-1652.311) [-1652.181] -- 0:00:52 117500 -- [-1644.130] (-1647.103) (-1642.902) (-1648.388) * (-1645.056) [-1643.867] (-1655.154) (-1654.969) -- 0:00:52 118000 -- (-1645.181) (-1645.512) (-1643.330) [-1645.908] * [-1643.961] (-1643.126) (-1655.710) (-1652.846) -- 0:00:52 118500 -- (-1643.888) [-1649.366] (-1645.686) (-1646.173) * (-1645.269) (-1643.456) [-1650.474] (-1650.773) -- 0:00:52 119000 -- [-1645.022] (-1648.965) (-1644.255) (-1646.942) * (-1648.424) (-1643.259) [-1650.494] (-1657.176) -- 0:00:51 119500 -- (-1645.325) (-1648.267) (-1644.129) [-1645.518] * [-1648.320] (-1645.102) (-1656.827) (-1674.860) -- 0:00:51 120000 -- (-1645.053) (-1647.784) (-1644.092) [-1647.613] * (-1645.316) (-1645.464) [-1652.319] (-1648.799) -- 0:00:51 Average standard deviation of split frequencies: 0.024879 120500 -- (-1644.183) (-1648.651) (-1643.826) [-1643.795] * (-1644.299) [-1645.068] (-1660.953) (-1646.915) -- 0:00:58 121000 -- (-1644.359) (-1650.012) (-1644.110) [-1647.089] * (-1645.264) (-1645.164) (-1651.453) [-1643.383] -- 0:00:58 121500 -- (-1644.861) [-1647.454] (-1644.000) (-1645.074) * (-1643.152) [-1648.409] (-1650.117) (-1644.208) -- 0:00:57 122000 -- (-1645.072) [-1644.921] (-1644.456) (-1643.474) * (-1644.769) [-1644.898] (-1653.591) (-1644.790) -- 0:00:57 122500 -- [-1644.912] (-1645.710) (-1643.616) (-1644.186) * (-1643.692) (-1643.967) (-1659.002) [-1644.150] -- 0:00:57 123000 -- (-1644.453) (-1644.614) (-1644.390) [-1645.752] * (-1644.868) [-1645.531] (-1651.132) (-1644.260) -- 0:00:57 123500 -- [-1648.016] (-1644.307) (-1644.991) (-1650.891) * (-1646.883) [-1644.818] (-1656.643) (-1644.272) -- 0:00:56 124000 -- [-1644.885] (-1644.529) (-1644.279) (-1644.568) * [-1645.433] (-1648.015) (-1655.138) (-1643.951) -- 0:00:56 124500 -- (-1649.857) (-1645.046) (-1644.926) [-1643.726] * (-1643.376) (-1645.971) [-1654.353] (-1644.535) -- 0:00:56 125000 -- (-1649.252) (-1645.870) (-1645.342) [-1648.006] * [-1644.071] (-1644.697) (-1658.270) (-1643.645) -- 0:00:56 Average standard deviation of split frequencies: 0.022635 125500 -- (-1646.032) [-1643.882] (-1645.195) (-1643.864) * [-1643.212] (-1644.471) (-1658.036) (-1644.690) -- 0:00:55 126000 -- (-1645.789) (-1644.129) (-1644.580) [-1644.901] * [-1643.230] (-1646.067) (-1655.192) (-1643.745) -- 0:00:55 126500 -- (-1645.614) (-1648.915) [-1645.137] (-1644.954) * (-1643.912) [-1646.588] (-1658.637) (-1644.499) -- 0:00:55 127000 -- (-1646.569) (-1648.556) [-1645.003] (-1646.090) * [-1644.263] (-1646.414) (-1652.003) (-1644.801) -- 0:00:54 127500 -- (-1645.325) [-1647.339] (-1644.398) (-1646.762) * [-1643.916] (-1645.886) (-1650.542) (-1643.695) -- 0:00:54 128000 -- (-1643.982) (-1645.753) [-1644.398] (-1644.121) * (-1644.342) (-1644.892) [-1651.034] (-1643.988) -- 0:00:54 128500 -- [-1643.886] (-1645.638) (-1644.934) (-1644.284) * (-1647.185) (-1645.471) (-1652.787) [-1645.233] -- 0:00:54 129000 -- (-1643.831) (-1646.508) [-1644.339] (-1648.522) * (-1643.915) (-1645.614) [-1651.720] (-1645.690) -- 0:00:54 129500 -- (-1647.467) [-1643.392] (-1646.803) (-1643.140) * (-1644.209) (-1644.539) [-1652.981] (-1644.139) -- 0:00:53 130000 -- [-1643.555] (-1643.001) (-1645.235) (-1643.212) * (-1643.907) (-1647.763) (-1655.380) [-1642.826] -- 0:00:53 Average standard deviation of split frequencies: 0.018940 130500 -- (-1643.268) (-1643.409) [-1643.849] (-1643.079) * [-1646.041] (-1645.391) (-1654.834) (-1645.246) -- 0:00:53 131000 -- (-1644.589) [-1643.823] (-1645.213) (-1643.473) * [-1645.793] (-1643.779) (-1652.775) (-1645.738) -- 0:00:53 131500 -- (-1646.737) (-1643.288) [-1643.912] (-1644.234) * (-1647.878) (-1643.458) [-1658.542] (-1644.916) -- 0:00:52 132000 -- (-1647.214) [-1643.932] (-1643.529) (-1645.539) * (-1645.472) [-1643.620] (-1656.525) (-1646.339) -- 0:00:52 132500 -- (-1645.861) (-1645.422) (-1644.431) [-1644.023] * (-1643.812) (-1643.751) (-1652.473) [-1643.568] -- 0:00:52 133000 -- (-1644.928) [-1644.700] (-1645.099) (-1644.850) * (-1643.652) (-1646.694) [-1651.818] (-1643.692) -- 0:00:52 133500 -- [-1648.381] (-1644.089) (-1644.233) (-1646.117) * (-1645.704) (-1647.742) (-1656.197) [-1644.178] -- 0:00:51 134000 -- (-1644.362) [-1645.582] (-1645.406) (-1646.425) * (-1646.811) (-1644.850) [-1652.400] (-1644.340) -- 0:00:51 134500 -- (-1648.092) (-1646.714) [-1645.327] (-1646.251) * (-1647.412) (-1647.874) [-1653.518] (-1645.140) -- 0:00:51 135000 -- (-1646.289) (-1646.054) [-1644.623] (-1647.393) * (-1646.252) (-1644.017) (-1653.115) [-1646.229] -- 0:00:51 Average standard deviation of split frequencies: 0.018973 135500 -- (-1649.749) (-1643.510) [-1646.023] (-1647.684) * (-1646.130) (-1644.635) [-1655.494] (-1645.480) -- 0:00:51 136000 -- [-1643.304] (-1647.801) (-1643.621) (-1647.409) * (-1644.257) (-1644.774) (-1656.192) [-1643.911] -- 0:00:57 136500 -- (-1643.289) (-1645.409) [-1643.605] (-1649.394) * (-1646.859) (-1643.849) (-1654.978) [-1644.346] -- 0:00:56 137000 -- (-1642.733) (-1645.307) (-1645.168) [-1649.295] * (-1644.525) [-1645.706] (-1654.698) (-1643.960) -- 0:00:56 137500 -- (-1644.557) (-1645.324) [-1643.724] (-1648.778) * (-1645.305) (-1643.247) [-1654.295] (-1646.018) -- 0:00:56 138000 -- (-1645.990) (-1643.940) [-1643.866] (-1644.952) * [-1647.793] (-1643.620) (-1655.006) (-1643.956) -- 0:00:56 138500 -- (-1643.994) (-1646.248) (-1644.421) [-1648.038] * (-1648.863) (-1644.005) (-1659.524) [-1643.956] -- 0:00:55 139000 -- (-1644.984) (-1643.097) [-1644.909] (-1644.310) * [-1645.673] (-1645.850) (-1662.489) (-1644.708) -- 0:00:55 139500 -- [-1644.634] (-1643.187) (-1646.444) (-1644.264) * [-1644.285] (-1646.489) (-1656.213) (-1644.380) -- 0:00:55 140000 -- (-1645.996) (-1645.822) (-1645.267) [-1648.490] * [-1643.765] (-1644.147) (-1655.226) (-1643.215) -- 0:00:55 Average standard deviation of split frequencies: 0.019549 140500 -- [-1643.439] (-1644.338) (-1646.073) (-1645.577) * [-1644.293] (-1644.943) (-1655.447) (-1643.235) -- 0:00:55 141000 -- (-1643.437) [-1645.621] (-1647.138) (-1648.523) * (-1644.364) [-1645.609] (-1651.049) (-1643.162) -- 0:00:54 141500 -- [-1643.664] (-1642.869) (-1644.595) (-1649.915) * (-1646.102) (-1648.999) (-1652.347) [-1645.762] -- 0:00:54 142000 -- (-1644.251) [-1643.575] (-1644.796) (-1645.833) * (-1645.380) (-1644.932) [-1652.528] (-1644.199) -- 0:00:54 142500 -- (-1643.865) (-1647.365) [-1644.396] (-1643.824) * (-1645.901) (-1643.096) [-1658.901] (-1643.621) -- 0:00:54 143000 -- (-1645.031) (-1646.755) [-1645.406] (-1644.681) * (-1646.948) (-1643.686) [-1653.682] (-1646.071) -- 0:00:53 143500 -- (-1645.906) (-1645.780) [-1643.766] (-1645.270) * (-1646.001) [-1643.686] (-1655.970) (-1645.887) -- 0:00:53 144000 -- [-1645.524] (-1645.279) (-1643.860) (-1645.236) * (-1647.491) (-1645.373) [-1653.660] (-1643.890) -- 0:00:53 144500 -- [-1647.292] (-1647.834) (-1643.460) (-1646.404) * (-1646.951) (-1644.587) [-1649.269] (-1648.614) -- 0:00:53 145000 -- (-1649.408) (-1648.660) (-1644.664) [-1644.959] * (-1649.856) [-1643.557] (-1653.969) (-1647.530) -- 0:00:53 Average standard deviation of split frequencies: 0.017758 145500 -- (-1648.606) (-1647.491) [-1643.542] (-1645.449) * (-1646.268) (-1647.282) [-1650.672] (-1648.972) -- 0:00:52 146000 -- (-1646.064) (-1646.718) [-1643.862] (-1645.142) * [-1644.957] (-1645.170) (-1651.667) (-1646.784) -- 0:00:52 146500 -- [-1645.660] (-1646.107) (-1643.153) (-1648.163) * (-1642.788) (-1643.856) [-1650.272] (-1646.835) -- 0:00:52 147000 -- (-1645.429) (-1645.255) (-1643.919) [-1645.063] * (-1643.022) (-1643.660) [-1648.475] (-1646.438) -- 0:00:52 147500 -- (-1649.462) (-1645.432) [-1644.119] (-1645.736) * [-1643.507] (-1645.297) (-1646.209) (-1648.121) -- 0:00:52 148000 -- (-1644.977) [-1645.123] (-1643.693) (-1649.780) * (-1644.077) (-1645.603) [-1645.259] (-1645.795) -- 0:00:51 148500 -- (-1645.888) (-1645.685) [-1643.889] (-1651.800) * (-1646.610) [-1646.051] (-1645.597) (-1645.642) -- 0:00:51 149000 -- (-1644.637) (-1647.097) (-1646.463) [-1646.161] * (-1646.588) [-1644.664] (-1643.889) (-1645.517) -- 0:00:51 149500 -- [-1649.574] (-1643.103) (-1647.898) (-1643.358) * (-1644.432) (-1646.047) (-1644.157) [-1646.647] -- 0:00:51 150000 -- (-1648.911) (-1649.819) (-1647.726) [-1644.804] * (-1643.722) (-1647.237) [-1644.446] (-1644.863) -- 0:00:51 Average standard deviation of split frequencies: 0.018947 150500 -- (-1646.687) [-1644.855] (-1645.635) (-1649.804) * (-1647.743) (-1645.985) (-1644.403) [-1645.175] -- 0:00:50 151000 -- (-1646.261) [-1643.418] (-1644.073) (-1648.818) * (-1649.496) (-1643.300) [-1644.975] (-1645.688) -- 0:00:50 151500 -- [-1644.406] (-1643.759) (-1644.273) (-1647.295) * (-1651.270) [-1644.331] (-1645.202) (-1644.786) -- 0:00:56 152000 -- [-1647.825] (-1648.099) (-1642.963) (-1647.524) * [-1644.280] (-1645.030) (-1643.716) (-1643.705) -- 0:00:55 152500 -- (-1648.734) [-1648.118] (-1649.807) (-1647.521) * (-1646.709) (-1644.799) (-1643.606) [-1644.164] -- 0:00:55 153000 -- (-1646.607) (-1643.867) [-1646.200] (-1647.302) * [-1646.416] (-1644.639) (-1643.487) (-1646.599) -- 0:00:55 153500 -- (-1646.015) (-1644.921) (-1648.885) [-1647.095] * (-1643.167) (-1644.639) [-1646.603] (-1644.645) -- 0:00:55 154000 -- (-1646.673) [-1646.956] (-1646.964) (-1646.580) * (-1646.409) (-1648.404) [-1645.060] (-1644.116) -- 0:00:54 154500 -- (-1644.163) (-1645.535) (-1642.841) [-1647.380] * [-1646.409] (-1643.601) (-1646.373) (-1647.021) -- 0:00:54 155000 -- (-1646.022) (-1647.677) [-1643.162] (-1648.151) * (-1643.691) [-1643.592] (-1644.659) (-1647.256) -- 0:00:54 Average standard deviation of split frequencies: 0.018970 155500 -- (-1648.648) [-1644.077] (-1643.162) (-1645.004) * (-1643.722) (-1643.615) [-1645.636] (-1645.598) -- 0:00:54 156000 -- [-1645.265] (-1645.114) (-1646.632) (-1649.412) * (-1643.839) [-1644.370] (-1647.644) (-1646.879) -- 0:00:54 156500 -- (-1644.591) (-1645.995) (-1643.485) [-1646.143] * (-1644.293) (-1643.858) [-1649.315] (-1643.815) -- 0:00:53 157000 -- [-1645.122] (-1643.785) (-1645.464) (-1646.692) * (-1644.872) (-1645.633) [-1646.516] (-1647.134) -- 0:00:53 157500 -- (-1645.420) (-1643.643) [-1644.740] (-1644.227) * [-1644.297] (-1643.823) (-1646.392) (-1647.332) -- 0:00:53 158000 -- [-1644.699] (-1643.391) (-1645.702) (-1644.666) * (-1647.531) [-1643.628] (-1645.760) (-1644.442) -- 0:00:53 158500 -- (-1643.979) [-1643.738] (-1646.252) (-1644.840) * (-1644.615) (-1644.700) [-1643.632] (-1645.973) -- 0:00:53 159000 -- (-1644.640) (-1646.845) [-1643.438] (-1643.943) * [-1643.191] (-1643.636) (-1644.906) (-1644.089) -- 0:00:52 159500 -- [-1644.294] (-1646.840) (-1649.745) (-1645.321) * [-1643.436] (-1643.583) (-1653.033) (-1647.303) -- 0:00:52 160000 -- (-1645.324) (-1644.947) [-1646.805] (-1647.827) * (-1645.179) (-1643.349) (-1653.399) [-1646.076] -- 0:00:52 Average standard deviation of split frequencies: 0.019071 160500 -- (-1643.858) (-1647.607) (-1646.046) [-1646.218] * (-1643.779) (-1644.706) (-1650.594) [-1646.180] -- 0:00:52 161000 -- (-1643.517) (-1645.368) (-1646.070) [-1646.396] * (-1645.688) [-1647.840] (-1649.990) (-1644.178) -- 0:00:52 161500 -- (-1644.010) (-1645.160) [-1644.723] (-1645.436) * (-1645.702) (-1645.041) (-1650.108) [-1643.025] -- 0:00:51 162000 -- (-1643.024) [-1645.050] (-1644.396) (-1646.167) * (-1645.138) (-1643.249) (-1651.364) [-1643.748] -- 0:00:51 162500 -- (-1643.379) (-1646.746) [-1644.261] (-1645.344) * (-1645.316) (-1643.281) (-1644.835) [-1644.456] -- 0:00:51 163000 -- (-1643.379) (-1645.809) (-1645.103) [-1644.753] * (-1646.894) (-1644.116) (-1644.530) [-1650.632] -- 0:00:51 163500 -- (-1644.331) (-1645.275) [-1644.896] (-1645.286) * (-1643.585) (-1649.142) (-1645.767) [-1651.556] -- 0:00:51 164000 -- (-1644.273) [-1645.060] (-1644.972) (-1646.415) * (-1643.340) (-1646.405) [-1644.794] (-1649.841) -- 0:00:50 164500 -- (-1646.170) (-1643.517) [-1644.211] (-1645.308) * (-1643.275) (-1644.062) [-1643.905] (-1646.343) -- 0:00:50 165000 -- (-1643.946) (-1648.486) [-1644.340] (-1645.589) * (-1644.762) (-1645.257) [-1643.169] (-1647.402) -- 0:00:50 Average standard deviation of split frequencies: 0.018932 165500 -- (-1644.126) (-1647.016) [-1645.625] (-1648.622) * (-1645.023) [-1647.169] (-1645.076) (-1648.192) -- 0:00:50 166000 -- (-1645.778) (-1645.040) [-1644.071] (-1648.461) * (-1645.665) (-1646.860) [-1646.170] (-1646.229) -- 0:00:50 166500 -- (-1646.075) (-1647.939) (-1645.558) [-1648.588] * (-1649.458) [-1645.614] (-1646.069) (-1647.210) -- 0:00:50 167000 -- (-1648.237) [-1644.109] (-1643.738) (-1649.148) * [-1643.703] (-1643.207) (-1648.430) (-1646.497) -- 0:00:54 167500 -- [-1643.968] (-1644.126) (-1643.567) (-1644.281) * (-1643.865) (-1643.236) [-1645.829] (-1647.205) -- 0:00:54 168000 -- (-1643.157) [-1644.348] (-1643.638) (-1644.281) * (-1643.581) (-1643.847) (-1645.540) [-1644.885] -- 0:00:54 168500 -- (-1643.140) (-1644.475) [-1643.501] (-1644.326) * (-1643.681) (-1645.540) [-1643.781] (-1645.696) -- 0:00:54 169000 -- (-1645.490) [-1643.184] (-1643.328) (-1645.306) * (-1643.770) [-1643.599] (-1644.691) (-1646.988) -- 0:00:54 169500 -- (-1645.862) [-1643.414] (-1644.358) (-1646.463) * (-1644.109) (-1646.160) [-1644.600] (-1645.737) -- 0:00:53 170000 -- [-1644.710] (-1644.622) (-1647.240) (-1643.073) * (-1643.840) (-1646.364) (-1644.025) [-1645.127] -- 0:00:53 Average standard deviation of split frequencies: 0.019642 170500 -- (-1644.397) (-1644.737) (-1643.377) [-1643.048] * (-1645.286) [-1643.908] (-1644.109) (-1643.426) -- 0:00:53 171000 -- [-1643.565] (-1644.724) (-1643.000) (-1642.962) * [-1644.801] (-1643.272) (-1646.788) (-1643.868) -- 0:00:53 171500 -- [-1644.577] (-1643.329) (-1646.624) (-1643.795) * [-1644.727] (-1643.308) (-1646.600) (-1643.676) -- 0:00:53 172000 -- (-1644.978) [-1646.233] (-1646.233) (-1648.085) * (-1647.110) [-1645.687] (-1644.930) (-1643.705) -- 0:00:52 172500 -- (-1645.190) (-1646.913) (-1645.990) [-1644.577] * (-1648.172) [-1644.930] (-1645.813) (-1646.620) -- 0:00:52 173000 -- (-1646.205) (-1644.225) (-1644.080) [-1646.855] * [-1643.179] (-1645.575) (-1646.632) (-1649.082) -- 0:00:52 173500 -- (-1644.766) (-1646.196) (-1643.648) [-1645.335] * (-1644.415) [-1645.186] (-1646.577) (-1644.412) -- 0:00:52 174000 -- (-1646.074) [-1643.979] (-1642.743) (-1643.401) * (-1645.137) (-1646.324) (-1643.218) [-1645.764] -- 0:00:52 174500 -- (-1645.241) (-1643.665) [-1645.191] (-1643.393) * (-1645.507) [-1646.034] (-1643.484) (-1649.513) -- 0:00:52 175000 -- [-1650.180] (-1645.348) (-1644.834) (-1647.367) * (-1649.751) (-1647.156) (-1647.446) [-1646.538] -- 0:00:51 Average standard deviation of split frequencies: 0.019344 175500 -- (-1645.805) (-1643.533) (-1647.156) [-1645.974] * (-1646.798) [-1646.783] (-1646.655) (-1646.813) -- 0:00:51 176000 -- [-1643.512] (-1643.556) (-1648.588) (-1643.820) * (-1646.233) [-1645.453] (-1646.419) (-1645.810) -- 0:00:51 176500 -- [-1643.512] (-1645.071) (-1648.990) (-1643.445) * (-1646.455) (-1644.217) (-1647.511) [-1645.216] -- 0:00:51 177000 -- (-1645.251) (-1644.324) [-1645.751] (-1643.472) * (-1645.678) [-1645.379] (-1645.413) (-1646.585) -- 0:00:51 177500 -- [-1646.037] (-1642.928) (-1648.125) (-1646.151) * (-1644.733) (-1645.436) (-1645.137) [-1645.916] -- 0:00:50 178000 -- (-1645.155) [-1642.903] (-1647.753) (-1647.358) * (-1644.664) [-1644.208] (-1647.130) (-1645.249) -- 0:00:50 178500 -- (-1646.944) (-1645.172) [-1647.605] (-1647.997) * (-1643.730) (-1645.391) (-1649.523) [-1648.382] -- 0:00:50 179000 -- (-1646.980) [-1643.209] (-1643.989) (-1647.879) * (-1643.193) [-1644.786] (-1645.508) (-1644.811) -- 0:00:50 179500 -- (-1644.662) (-1643.967) (-1644.584) [-1644.382] * [-1643.235] (-1645.349) (-1646.305) (-1644.063) -- 0:00:50 180000 -- [-1644.154] (-1645.136) (-1645.145) (-1646.515) * [-1646.946] (-1648.176) (-1645.037) (-1644.838) -- 0:00:50 Average standard deviation of split frequencies: 0.018700 180500 -- [-1645.707] (-1643.479) (-1645.134) (-1643.903) * (-1647.157) (-1652.440) [-1644.024] (-1644.297) -- 0:00:49 181000 -- (-1644.882) (-1644.823) [-1645.752] (-1644.797) * (-1645.027) (-1650.933) [-1645.447] (-1647.208) -- 0:00:49 181500 -- (-1645.243) [-1643.732] (-1645.498) (-1645.116) * [-1644.434] (-1644.982) (-1643.635) (-1645.537) -- 0:00:49 182000 -- (-1645.180) [-1643.446] (-1645.393) (-1643.612) * [-1645.252] (-1646.853) (-1646.144) (-1645.157) -- 0:00:53 182500 -- (-1645.585) (-1643.775) [-1643.460] (-1646.823) * (-1644.345) (-1646.298) [-1643.623] (-1649.446) -- 0:00:53 183000 -- (-1645.679) [-1643.307] (-1643.644) (-1647.813) * (-1646.623) (-1646.652) [-1643.169] (-1651.740) -- 0:00:53 183500 -- (-1645.095) (-1644.674) (-1646.249) [-1644.637] * [-1646.055] (-1646.886) (-1643.011) (-1649.874) -- 0:00:53 184000 -- (-1644.424) (-1646.664) [-1647.303] (-1643.564) * (-1649.973) (-1645.387) [-1644.040] (-1645.941) -- 0:00:53 184500 -- [-1645.519] (-1644.053) (-1645.687) (-1644.574) * [-1644.780] (-1644.923) (-1643.507) (-1646.558) -- 0:00:53 185000 -- (-1646.061) (-1643.987) (-1645.756) [-1643.129] * (-1647.948) (-1644.562) [-1643.134] (-1645.288) -- 0:00:52 Average standard deviation of split frequencies: 0.017882 185500 -- [-1644.709] (-1644.534) (-1648.470) (-1642.782) * (-1645.146) [-1646.644] (-1649.138) (-1644.321) -- 0:00:52 186000 -- [-1644.151] (-1644.763) (-1645.863) (-1643.185) * [-1647.705] (-1651.541) (-1648.732) (-1645.229) -- 0:00:52 186500 -- [-1644.151] (-1644.351) (-1643.744) (-1642.741) * (-1644.658) (-1645.815) [-1643.818] (-1645.754) -- 0:00:52 187000 -- (-1644.091) (-1645.660) [-1643.555] (-1642.764) * [-1645.205] (-1644.874) (-1644.943) (-1647.032) -- 0:00:52 187500 -- (-1644.691) [-1644.098] (-1645.769) (-1642.792) * [-1644.488] (-1645.027) (-1644.813) (-1647.289) -- 0:00:52 188000 -- (-1644.539) (-1644.084) (-1645.465) [-1643.435] * (-1643.938) (-1646.214) [-1644.659] (-1645.197) -- 0:00:51 188500 -- (-1644.644) [-1644.059] (-1644.065) (-1643.924) * [-1645.425] (-1646.190) (-1646.600) (-1648.566) -- 0:00:51 189000 -- (-1644.509) (-1643.694) [-1645.393] (-1643.996) * [-1645.301] (-1647.942) (-1649.452) (-1645.066) -- 0:00:51 189500 -- (-1644.936) (-1643.169) [-1645.393] (-1643.305) * [-1643.690] (-1649.829) (-1648.945) (-1646.097) -- 0:00:51 190000 -- (-1644.658) [-1642.925] (-1647.189) (-1642.890) * (-1644.537) (-1646.132) (-1648.198) [-1646.897] -- 0:00:51 Average standard deviation of split frequencies: 0.018818 190500 -- (-1648.112) [-1643.322] (-1644.774) (-1643.938) * (-1643.658) (-1644.435) [-1645.632] (-1646.152) -- 0:00:50 191000 -- [-1644.903] (-1643.322) (-1651.905) (-1643.211) * (-1644.502) [-1644.775] (-1648.529) (-1645.573) -- 0:00:50 191500 -- (-1644.717) (-1642.935) (-1643.378) [-1647.670] * [-1646.457] (-1644.959) (-1644.298) (-1647.036) -- 0:00:50 192000 -- (-1645.020) [-1644.597] (-1643.983) (-1644.702) * (-1643.704) [-1645.038] (-1643.651) (-1648.289) -- 0:00:50 192500 -- (-1645.882) (-1643.829) (-1644.301) [-1644.456] * [-1643.628] (-1645.523) (-1644.421) (-1644.395) -- 0:00:50 193000 -- (-1646.236) [-1643.635] (-1643.585) (-1645.568) * (-1645.503) [-1644.068] (-1644.112) (-1644.611) -- 0:00:50 193500 -- [-1643.662] (-1643.615) (-1646.991) (-1647.579) * [-1644.773] (-1644.043) (-1644.564) (-1645.443) -- 0:00:50 194000 -- (-1645.673) [-1644.751] (-1644.938) (-1648.791) * (-1647.622) (-1646.873) [-1644.700] (-1645.567) -- 0:00:49 194500 -- (-1644.616) (-1644.644) [-1644.305] (-1647.054) * (-1646.188) [-1644.395] (-1644.764) (-1644.919) -- 0:00:49 195000 -- (-1644.679) (-1643.917) (-1643.178) [-1644.465] * (-1649.243) (-1643.536) (-1643.310) [-1645.301] -- 0:00:49 Average standard deviation of split frequencies: 0.017905 195500 -- (-1646.128) [-1644.015] (-1643.525) (-1644.107) * (-1647.205) [-1643.648] (-1643.310) (-1645.559) -- 0:00:49 196000 -- (-1645.938) (-1643.480) [-1644.051] (-1643.127) * (-1647.756) [-1643.543] (-1643.247) (-1646.195) -- 0:00:49 196500 -- (-1645.184) (-1645.517) (-1644.358) [-1643.116] * (-1643.584) [-1643.398] (-1643.977) (-1648.784) -- 0:00:49 197000 -- [-1645.489] (-1644.563) (-1644.362) (-1650.175) * (-1645.610) (-1644.723) (-1645.977) [-1646.252] -- 0:00:48 197500 -- (-1643.666) (-1643.810) [-1643.727] (-1648.349) * (-1644.668) [-1645.115] (-1643.473) (-1643.719) -- 0:00:52 198000 -- (-1645.668) (-1644.772) [-1645.315] (-1646.115) * (-1645.940) (-1645.585) [-1644.877] (-1643.587) -- 0:00:52 198500 -- [-1647.623] (-1647.991) (-1646.101) (-1647.424) * [-1644.613] (-1644.685) (-1644.575) (-1645.859) -- 0:00:52 199000 -- (-1647.605) (-1645.950) [-1643.745] (-1644.184) * (-1644.588) (-1645.537) (-1645.985) [-1645.771] -- 0:00:52 199500 -- (-1647.825) (-1647.094) (-1643.538) [-1644.390] * (-1645.981) (-1645.332) (-1645.667) [-1643.330] -- 0:00:52 200000 -- (-1649.961) [-1647.469] (-1644.284) (-1644.115) * (-1647.746) (-1646.950) (-1647.320) [-1644.392] -- 0:00:51 Average standard deviation of split frequencies: 0.017619 200500 -- (-1651.149) [-1644.851] (-1649.962) (-1646.227) * (-1647.694) (-1646.456) (-1644.445) [-1643.359] -- 0:00:51 201000 -- (-1647.294) [-1644.486] (-1647.078) (-1646.241) * (-1643.666) (-1645.222) (-1644.695) [-1645.601] -- 0:00:51 201500 -- (-1644.676) (-1643.649) [-1645.201] (-1647.252) * (-1644.091) (-1646.652) (-1646.718) [-1644.586] -- 0:00:51 202000 -- (-1646.613) [-1644.844] (-1644.254) (-1645.276) * [-1644.084] (-1646.104) (-1646.594) (-1644.453) -- 0:00:51 202500 -- (-1646.492) [-1643.878] (-1644.628) (-1646.844) * [-1644.607] (-1645.732) (-1645.254) (-1643.996) -- 0:00:51 203000 -- (-1649.729) [-1644.174] (-1649.959) (-1649.392) * (-1644.218) (-1646.417) (-1645.253) [-1643.900] -- 0:00:51 203500 -- [-1647.929] (-1646.733) (-1643.968) (-1648.303) * (-1646.795) (-1646.615) [-1647.559] (-1644.155) -- 0:00:50 204000 -- (-1644.131) (-1644.898) (-1643.235) [-1645.189] * [-1645.340] (-1645.430) (-1646.279) (-1644.827) -- 0:00:50 204500 -- (-1645.215) (-1644.263) [-1645.406] (-1643.279) * [-1644.994] (-1644.486) (-1646.069) (-1644.532) -- 0:00:50 205000 -- (-1644.829) (-1647.235) [-1645.322] (-1643.906) * (-1645.698) (-1646.314) (-1645.042) [-1644.522] -- 0:00:50 Average standard deviation of split frequencies: 0.017849 205500 -- (-1647.857) [-1644.817] (-1645.095) (-1645.699) * (-1644.179) (-1644.502) (-1643.983) [-1644.791] -- 0:00:50 206000 -- (-1644.589) (-1647.181) [-1645.433] (-1645.650) * (-1645.160) [-1644.877] (-1643.712) (-1643.846) -- 0:00:50 206500 -- (-1645.636) (-1647.326) (-1645.691) [-1643.872] * (-1644.344) [-1644.070] (-1643.984) (-1644.673) -- 0:00:49 207000 -- (-1650.803) (-1645.469) (-1644.438) [-1643.916] * (-1643.302) (-1644.560) (-1644.154) [-1643.963] -- 0:00:49 207500 -- [-1645.655] (-1645.861) (-1643.769) (-1643.936) * [-1642.899] (-1646.823) (-1643.321) (-1643.893) -- 0:00:49 208000 -- (-1643.639) (-1645.101) [-1643.721] (-1644.864) * (-1643.948) [-1647.767] (-1647.784) (-1645.095) -- 0:00:49 208500 -- (-1645.081) [-1644.371] (-1644.208) (-1643.380) * [-1644.031] (-1646.092) (-1646.045) (-1648.211) -- 0:00:49 209000 -- (-1644.639) [-1645.267] (-1649.677) (-1645.930) * (-1648.671) [-1645.200] (-1648.538) (-1647.501) -- 0:00:49 209500 -- [-1643.969] (-1648.766) (-1647.753) (-1645.368) * (-1644.789) (-1646.470) [-1644.460] (-1644.651) -- 0:00:49 210000 -- (-1644.391) (-1644.854) [-1647.738] (-1646.184) * (-1644.766) (-1647.429) (-1645.315) [-1648.451] -- 0:00:48 Average standard deviation of split frequencies: 0.016606 210500 -- (-1644.099) (-1645.425) [-1643.974] (-1647.183) * (-1646.125) (-1643.350) (-1646.160) [-1650.451] -- 0:00:48 211000 -- (-1645.710) (-1645.250) [-1643.930] (-1645.977) * (-1644.315) (-1643.448) (-1648.766) [-1644.956] -- 0:00:48 211500 -- (-1642.995) (-1645.213) [-1643.541] (-1643.668) * (-1649.068) (-1643.448) (-1646.155) [-1643.507] -- 0:00:48 212000 -- [-1642.980] (-1644.385) (-1642.847) (-1643.658) * [-1647.757] (-1643.552) (-1649.171) (-1643.709) -- 0:00:48 212500 -- (-1646.531) (-1644.418) (-1646.923) [-1645.382] * (-1645.915) [-1643.552] (-1645.824) (-1644.158) -- 0:00:48 213000 -- (-1648.211) (-1643.210) (-1646.399) [-1645.113] * (-1645.947) (-1643.552) (-1647.766) [-1644.344] -- 0:00:51 213500 -- (-1645.756) (-1645.364) (-1646.771) [-1643.105] * (-1646.578) (-1647.349) (-1646.035) [-1645.547] -- 0:00:51 214000 -- (-1649.451) (-1645.473) [-1647.562] (-1645.417) * (-1646.905) [-1643.451] (-1647.476) (-1643.628) -- 0:00:51 214500 -- (-1648.159) (-1645.266) [-1644.370] (-1644.360) * (-1646.588) [-1644.996] (-1647.376) (-1644.847) -- 0:00:51 215000 -- (-1650.053) [-1644.534] (-1649.928) (-1646.881) * (-1647.504) (-1645.169) [-1646.256] (-1644.224) -- 0:00:51 Average standard deviation of split frequencies: 0.015507 215500 -- (-1647.568) (-1644.910) [-1643.904] (-1647.244) * (-1647.016) [-1644.566] (-1646.789) (-1647.676) -- 0:00:50 216000 -- (-1647.314) (-1643.884) [-1643.945] (-1647.523) * (-1643.164) (-1646.103) [-1645.575] (-1645.632) -- 0:00:50 216500 -- (-1646.075) (-1644.817) (-1644.627) [-1643.503] * (-1644.129) (-1645.726) (-1647.055) [-1644.388] -- 0:00:50 217000 -- (-1644.393) [-1645.078] (-1644.680) (-1643.171) * (-1646.103) (-1649.775) (-1645.990) [-1644.244] -- 0:00:50 217500 -- (-1645.162) (-1648.519) (-1645.291) [-1643.904] * [-1644.700] (-1644.103) (-1646.678) (-1645.778) -- 0:00:50 218000 -- (-1643.988) [-1644.477] (-1644.212) (-1644.517) * (-1643.825) (-1645.180) (-1646.988) [-1644.683] -- 0:00:50 218500 -- [-1643.267] (-1645.443) (-1643.506) (-1648.528) * [-1643.913] (-1645.222) (-1647.522) (-1644.442) -- 0:00:50 219000 -- [-1643.290] (-1643.763) (-1643.536) (-1647.194) * [-1645.230] (-1647.908) (-1646.792) (-1644.757) -- 0:00:49 219500 -- (-1643.183) [-1644.145] (-1646.418) (-1646.257) * [-1643.430] (-1646.298) (-1645.418) (-1645.524) -- 0:00:49 220000 -- (-1644.771) (-1643.559) [-1645.084] (-1644.733) * [-1646.646] (-1648.167) (-1647.886) (-1643.237) -- 0:00:49 Average standard deviation of split frequencies: 0.015291 220500 -- [-1644.781] (-1643.655) (-1646.295) (-1645.492) * (-1645.371) (-1644.867) (-1644.145) [-1643.781] -- 0:00:49 221000 -- (-1648.924) (-1643.760) (-1644.801) [-1646.625] * [-1643.476] (-1644.179) (-1643.804) (-1643.224) -- 0:00:49 221500 -- [-1644.163] (-1644.034) (-1646.199) (-1643.604) * (-1644.140) (-1645.802) [-1644.482] (-1643.297) -- 0:00:49 222000 -- (-1645.542) (-1648.579) (-1644.356) [-1643.678] * (-1643.959) (-1645.282) (-1644.378) [-1643.996] -- 0:00:49 222500 -- (-1644.718) (-1646.369) [-1646.064] (-1643.919) * (-1643.069) [-1648.846] (-1645.314) (-1646.964) -- 0:00:48 223000 -- (-1645.369) [-1644.146] (-1645.607) (-1644.259) * (-1643.022) (-1646.229) [-1643.706] (-1645.659) -- 0:00:48 223500 -- [-1645.927] (-1643.647) (-1645.036) (-1644.450) * [-1645.658] (-1647.471) (-1644.081) (-1643.832) -- 0:00:48 224000 -- (-1643.867) [-1643.457] (-1643.910) (-1645.591) * (-1647.354) [-1645.070] (-1646.547) (-1645.200) -- 0:00:48 224500 -- (-1644.774) (-1643.460) [-1644.509] (-1645.619) * (-1647.888) [-1643.539] (-1644.491) (-1645.684) -- 0:00:48 225000 -- [-1645.592] (-1644.254) (-1644.787) (-1645.673) * (-1645.717) (-1645.943) (-1648.633) [-1644.579] -- 0:00:48 Average standard deviation of split frequencies: 0.017016 225500 -- (-1644.410) (-1644.155) [-1645.384] (-1645.029) * [-1645.463] (-1644.980) (-1647.120) (-1644.575) -- 0:00:48 226000 -- (-1644.499) (-1644.581) (-1646.542) [-1644.971] * (-1645.297) (-1643.661) (-1645.942) [-1643.128] -- 0:00:47 226500 -- (-1649.323) (-1643.647) (-1642.941) [-1647.349] * (-1643.302) [-1643.514] (-1646.132) (-1644.105) -- 0:00:47 227000 -- (-1644.233) (-1651.190) (-1642.887) [-1648.917] * (-1645.263) (-1648.359) [-1643.447] (-1648.009) -- 0:00:47 227500 -- (-1644.278) (-1647.159) [-1642.864] (-1646.393) * (-1645.070) [-1645.207] (-1644.018) (-1646.359) -- 0:00:47 228000 -- [-1643.399] (-1651.315) (-1645.604) (-1645.902) * (-1647.609) (-1643.507) (-1645.224) [-1647.160] -- 0:00:47 228500 -- (-1644.368) (-1649.353) [-1644.774] (-1646.513) * (-1646.227) (-1645.682) (-1643.915) [-1646.687] -- 0:00:50 229000 -- [-1644.482] (-1649.045) (-1644.520) (-1648.305) * (-1645.449) [-1643.905] (-1646.464) (-1647.052) -- 0:00:50 229500 -- (-1646.243) (-1645.224) [-1644.720] (-1646.422) * (-1646.360) (-1643.139) [-1646.174] (-1644.674) -- 0:00:50 230000 -- (-1644.540) [-1647.227] (-1643.291) (-1648.889) * [-1646.039] (-1647.004) (-1646.243) (-1646.149) -- 0:00:50 Average standard deviation of split frequencies: 0.016995 230500 -- (-1649.392) (-1644.860) (-1643.332) [-1644.067] * (-1645.468) (-1643.964) (-1645.151) [-1644.608] -- 0:00:50 231000 -- (-1647.219) [-1644.794] (-1644.259) (-1646.885) * (-1653.925) (-1643.952) (-1646.304) [-1645.384] -- 0:00:49 231500 -- [-1645.092] (-1643.891) (-1645.483) (-1644.930) * (-1651.747) [-1644.719] (-1645.923) (-1645.780) -- 0:00:49 232000 -- (-1644.980) [-1648.718] (-1645.004) (-1644.627) * (-1647.505) (-1644.121) (-1647.640) [-1649.351] -- 0:00:49 232500 -- (-1645.391) (-1648.872) (-1646.692) [-1646.435] * (-1645.255) [-1644.121] (-1646.091) (-1644.532) -- 0:00:49 233000 -- (-1644.808) (-1647.940) [-1643.891] (-1649.034) * [-1643.837] (-1645.423) (-1644.905) (-1644.280) -- 0:00:49 233500 -- (-1645.749) (-1644.771) [-1645.239] (-1650.231) * (-1647.044) [-1643.562] (-1644.473) (-1645.152) -- 0:00:49 234000 -- (-1645.226) [-1642.934] (-1645.278) (-1648.481) * (-1647.173) [-1643.015] (-1645.722) (-1645.361) -- 0:00:49 234500 -- [-1645.376] (-1643.172) (-1645.749) (-1646.753) * (-1647.718) (-1644.546) (-1645.986) [-1645.812] -- 0:00:48 235000 -- (-1645.098) [-1644.865] (-1645.223) (-1644.890) * (-1647.053) (-1647.739) [-1644.074] (-1646.144) -- 0:00:48 Average standard deviation of split frequencies: 0.018088 235500 -- [-1649.307] (-1644.975) (-1644.313) (-1643.339) * (-1648.908) [-1645.811] (-1646.334) (-1646.043) -- 0:00:48 236000 -- (-1649.159) (-1649.835) [-1645.908] (-1647.732) * (-1643.827) (-1646.325) [-1646.090] (-1645.482) -- 0:00:48 236500 -- (-1649.283) (-1647.792) [-1644.074] (-1644.112) * (-1643.648) (-1647.675) (-1646.294) [-1646.809] -- 0:00:48 237000 -- (-1644.975) (-1645.409) (-1651.113) [-1643.405] * (-1643.305) (-1645.665) (-1646.211) [-1647.421] -- 0:00:48 237500 -- (-1646.723) [-1644.924] (-1648.811) (-1647.043) * [-1645.007] (-1643.994) (-1644.985) (-1649.463) -- 0:00:48 238000 -- [-1645.003] (-1644.326) (-1649.448) (-1644.862) * (-1644.571) (-1643.744) (-1646.572) [-1649.723] -- 0:00:48 238500 -- (-1647.163) (-1643.516) (-1646.761) [-1643.474] * (-1643.792) (-1645.017) [-1646.232] (-1644.737) -- 0:00:47 239000 -- [-1646.862] (-1645.342) (-1648.851) (-1643.427) * (-1646.095) [-1644.403] (-1644.943) (-1646.644) -- 0:00:47 239500 -- (-1644.387) (-1646.491) [-1644.815] (-1649.835) * (-1644.089) [-1643.596] (-1644.179) (-1645.488) -- 0:00:47 240000 -- (-1645.698) [-1645.512] (-1646.305) (-1647.894) * (-1646.919) (-1643.759) (-1644.898) [-1646.716] -- 0:00:47 Average standard deviation of split frequencies: 0.017017 240500 -- [-1647.233] (-1644.872) (-1648.462) (-1645.380) * (-1644.080) [-1645.806] (-1646.593) (-1643.429) -- 0:00:47 241000 -- (-1644.192) (-1646.688) [-1657.286] (-1645.288) * (-1644.547) [-1645.079] (-1645.993) (-1644.373) -- 0:00:47 241500 -- (-1644.628) (-1648.247) (-1647.328) [-1644.579] * (-1644.087) [-1643.940] (-1646.936) (-1644.537) -- 0:00:47 242000 -- (-1645.160) (-1645.779) [-1647.362] (-1643.314) * (-1649.288) [-1643.263] (-1644.510) (-1643.968) -- 0:00:46 242500 -- (-1646.033) [-1644.537] (-1644.027) (-1644.652) * (-1644.444) (-1648.312) [-1645.653] (-1643.561) -- 0:00:46 243000 -- (-1644.096) (-1644.820) (-1645.596) [-1644.903] * (-1644.315) (-1647.762) (-1645.455) [-1643.869] -- 0:00:46 243500 -- (-1645.291) (-1646.911) [-1645.383] (-1646.304) * [-1643.944] (-1646.178) (-1644.252) (-1644.955) -- 0:00:46 244000 -- (-1645.217) (-1643.914) (-1646.860) [-1643.779] * [-1644.971] (-1646.613) (-1644.710) (-1644.680) -- 0:00:49 244500 -- (-1645.088) [-1643.725] (-1650.050) (-1644.921) * [-1644.976] (-1646.722) (-1644.536) (-1647.538) -- 0:00:49 245000 -- (-1646.922) (-1643.350) (-1647.444) [-1644.718] * (-1644.304) [-1649.782] (-1643.970) (-1647.505) -- 0:00:49 Average standard deviation of split frequencies: 0.019056 245500 -- (-1644.674) (-1643.503) [-1644.594] (-1643.683) * (-1643.894) (-1649.665) [-1646.683] (-1650.826) -- 0:00:49 246000 -- [-1643.778] (-1647.971) (-1646.882) (-1643.707) * [-1644.123] (-1644.221) (-1648.493) (-1646.022) -- 0:00:49 246500 -- (-1644.845) [-1643.390] (-1648.045) (-1643.904) * (-1644.115) (-1644.005) (-1646.552) [-1645.447] -- 0:00:48 247000 -- (-1643.130) (-1643.995) (-1644.341) [-1644.453] * [-1645.140] (-1645.324) (-1644.711) (-1643.286) -- 0:00:48 247500 -- [-1643.628] (-1643.741) (-1648.407) (-1646.459) * [-1647.799] (-1645.777) (-1645.412) (-1644.412) -- 0:00:48 248000 -- (-1643.683) (-1643.297) (-1644.990) [-1644.870] * (-1644.996) (-1643.294) (-1645.980) [-1650.875] -- 0:00:48 248500 -- [-1645.129] (-1642.989) (-1652.349) (-1644.616) * [-1644.748] (-1643.256) (-1643.512) (-1653.033) -- 0:00:48 249000 -- (-1644.161) [-1643.423] (-1649.850) (-1644.384) * [-1648.013] (-1643.114) (-1645.547) (-1649.658) -- 0:00:48 249500 -- (-1647.393) (-1644.884) (-1645.714) [-1644.321] * (-1648.840) [-1644.885] (-1644.381) (-1646.094) -- 0:00:48 250000 -- (-1645.457) (-1642.844) [-1644.524] (-1644.178) * (-1646.546) [-1644.954] (-1644.007) (-1647.138) -- 0:00:48 Average standard deviation of split frequencies: 0.017343 250500 -- (-1649.544) (-1644.449) (-1645.816) [-1643.632] * (-1645.671) (-1644.028) [-1644.911] (-1646.465) -- 0:00:47 251000 -- (-1647.901) (-1646.836) (-1644.296) [-1644.413] * [-1644.626] (-1645.730) (-1645.153) (-1653.750) -- 0:00:47 251500 -- (-1645.488) (-1645.623) (-1645.085) [-1643.977] * (-1643.925) (-1644.564) (-1649.247) [-1645.944] -- 0:00:47 252000 -- (-1647.348) (-1648.049) (-1646.723) [-1642.766] * [-1646.439] (-1644.890) (-1649.913) (-1643.268) -- 0:00:47 252500 -- [-1646.477] (-1644.755) (-1644.276) (-1643.308) * [-1644.209] (-1647.118) (-1648.486) (-1644.676) -- 0:00:47 253000 -- (-1649.537) (-1643.872) (-1643.698) [-1643.329] * [-1644.620] (-1644.437) (-1650.477) (-1645.505) -- 0:00:47 253500 -- (-1647.935) (-1645.591) [-1645.161] (-1643.125) * (-1647.397) [-1645.974] (-1643.507) (-1646.158) -- 0:00:47 254000 -- (-1644.723) (-1647.324) [-1647.537] (-1644.720) * (-1643.842) (-1646.437) [-1645.315] (-1645.734) -- 0:00:46 254500 -- (-1643.384) (-1647.575) [-1644.642] (-1644.858) * [-1642.930] (-1646.279) (-1645.266) (-1645.168) -- 0:00:46 255000 -- (-1644.319) [-1644.542] (-1643.510) (-1647.033) * (-1644.800) (-1647.675) (-1643.124) [-1649.850] -- 0:00:46 Average standard deviation of split frequencies: 0.017873 255500 -- (-1644.698) [-1643.537] (-1643.854) (-1649.293) * [-1644.138] (-1645.703) (-1643.111) (-1647.234) -- 0:00:46 256000 -- (-1643.718) [-1643.219] (-1643.346) (-1643.695) * [-1643.154] (-1645.882) (-1648.991) (-1643.059) -- 0:00:46 256500 -- (-1643.613) (-1646.519) (-1646.421) [-1646.045] * [-1643.347] (-1657.318) (-1647.854) (-1645.259) -- 0:00:46 257000 -- (-1645.618) (-1646.464) (-1643.118) [-1645.526] * [-1643.759] (-1659.584) (-1644.753) (-1645.122) -- 0:00:46 257500 -- [-1646.569] (-1645.300) (-1649.238) (-1644.647) * (-1646.353) [-1646.523] (-1643.713) (-1646.896) -- 0:00:46 258000 -- (-1644.650) (-1646.565) (-1651.650) [-1645.643] * (-1644.552) (-1644.949) [-1644.201] (-1643.416) -- 0:00:46 258500 -- (-1644.856) (-1648.912) [-1645.180] (-1643.719) * (-1644.026) [-1646.804] (-1646.383) (-1644.323) -- 0:00:45 259000 -- (-1643.152) [-1644.789] (-1646.223) (-1650.662) * (-1646.945) (-1645.187) (-1645.343) [-1644.519] -- 0:00:45 259500 -- (-1643.160) [-1645.723] (-1646.384) (-1647.907) * (-1647.122) (-1643.625) [-1646.508] (-1644.615) -- 0:00:45 260000 -- (-1644.084) [-1644.319] (-1648.838) (-1643.863) * (-1647.098) [-1645.901] (-1644.725) (-1643.569) -- 0:00:48 Average standard deviation of split frequencies: 0.017067 260500 -- [-1643.375] (-1647.340) (-1648.352) (-1648.148) * (-1646.470) (-1647.217) [-1643.607] (-1648.174) -- 0:00:48 261000 -- [-1643.649] (-1646.868) (-1650.737) (-1647.960) * (-1647.031) [-1644.619] (-1644.217) (-1653.034) -- 0:00:48 261500 -- [-1643.705] (-1644.969) (-1646.140) (-1646.177) * (-1647.328) [-1647.913] (-1643.455) (-1651.011) -- 0:00:48 262000 -- [-1643.957] (-1645.533) (-1645.202) (-1643.713) * [-1644.671] (-1650.032) (-1644.530) (-1650.879) -- 0:00:47 262500 -- [-1644.350] (-1644.802) (-1644.575) (-1643.604) * (-1643.503) (-1649.787) (-1644.389) [-1649.276] -- 0:00:47 263000 -- (-1645.186) (-1644.659) (-1644.575) [-1643.599] * (-1646.316) (-1646.546) [-1644.027] (-1647.678) -- 0:00:47 263500 -- [-1644.856] (-1644.936) (-1644.976) (-1643.419) * (-1646.652) (-1645.181) (-1644.110) [-1647.326] -- 0:00:47 264000 -- (-1648.387) [-1647.836] (-1645.970) (-1646.387) * (-1644.890) (-1646.062) [-1643.773] (-1648.739) -- 0:00:47 264500 -- (-1646.269) (-1647.772) [-1645.467] (-1646.702) * (-1644.879) (-1645.989) [-1643.552] (-1644.924) -- 0:00:47 265000 -- (-1647.480) (-1645.791) [-1646.348] (-1643.708) * (-1643.481) (-1648.068) (-1644.342) [-1645.474] -- 0:00:47 Average standard deviation of split frequencies: 0.016061 265500 -- [-1646.341] (-1645.640) (-1644.555) (-1649.618) * [-1643.658] (-1650.689) (-1647.455) (-1644.739) -- 0:00:47 266000 -- [-1647.587] (-1644.152) (-1644.807) (-1647.743) * [-1642.739] (-1644.347) (-1643.575) (-1642.950) -- 0:00:46 266500 -- (-1646.387) (-1644.045) [-1645.189] (-1644.678) * (-1643.350) [-1643.876] (-1645.231) (-1643.181) -- 0:00:46 267000 -- (-1645.835) (-1644.572) [-1647.582] (-1648.013) * (-1646.986) (-1643.789) [-1643.191] (-1645.039) -- 0:00:46 267500 -- (-1646.020) [-1643.926] (-1643.419) (-1645.987) * (-1648.987) (-1643.878) (-1643.633) [-1644.950] -- 0:00:46 268000 -- (-1644.271) (-1649.423) (-1647.386) [-1644.701] * (-1647.035) (-1643.880) (-1643.639) [-1646.204] -- 0:00:46 268500 -- (-1644.249) (-1645.556) [-1645.435] (-1646.591) * (-1646.929) (-1649.893) (-1643.350) [-1645.740] -- 0:00:46 269000 -- (-1647.217) (-1644.802) (-1644.850) [-1645.018] * (-1647.216) (-1645.486) (-1644.989) [-1645.645] -- 0:00:46 269500 -- (-1643.932) (-1646.655) (-1649.665) [-1646.597] * [-1644.659] (-1646.116) (-1647.025) (-1645.491) -- 0:00:46 270000 -- [-1644.408] (-1644.750) (-1649.052) (-1644.607) * [-1643.302] (-1645.689) (-1646.321) (-1652.830) -- 0:00:45 Average standard deviation of split frequencies: 0.016110 270500 -- [-1643.966] (-1644.486) (-1648.238) (-1644.598) * [-1644.687] (-1647.372) (-1647.848) (-1650.799) -- 0:00:45 271000 -- [-1644.115] (-1645.383) (-1648.361) (-1646.771) * [-1644.236] (-1645.779) (-1644.251) (-1645.784) -- 0:00:45 271500 -- (-1645.556) (-1651.415) (-1644.996) [-1644.123] * (-1644.493) [-1643.951] (-1648.750) (-1643.806) -- 0:00:45 272000 -- (-1646.561) (-1644.057) [-1645.115] (-1643.582) * [-1643.375] (-1643.344) (-1647.657) (-1644.697) -- 0:00:45 272500 -- (-1644.618) (-1648.561) (-1645.797) [-1645.515] * (-1643.051) [-1645.688] (-1645.845) (-1643.692) -- 0:00:45 273000 -- (-1645.075) (-1644.757) (-1651.121) [-1645.738] * (-1647.506) [-1646.257] (-1647.404) (-1644.736) -- 0:00:45 273500 -- [-1645.937] (-1644.826) (-1649.608) (-1646.185) * (-1645.898) (-1651.632) (-1646.176) [-1646.959] -- 0:00:45 274000 -- (-1645.970) (-1643.851) [-1644.822] (-1645.679) * (-1645.993) (-1649.666) (-1644.940) [-1646.967] -- 0:00:45 274500 -- (-1646.656) [-1644.545] (-1645.739) (-1644.825) * [-1645.649] (-1647.568) (-1647.654) (-1646.887) -- 0:00:44 275000 -- (-1645.677) (-1644.064) (-1646.913) [-1644.951] * (-1648.787) (-1646.273) (-1653.274) [-1643.953] -- 0:00:47 Average standard deviation of split frequencies: 0.014304 275500 -- (-1644.704) [-1643.614] (-1648.564) (-1644.637) * (-1649.181) (-1643.450) [-1646.554] (-1652.821) -- 0:00:47 276000 -- (-1644.983) [-1643.614] (-1643.588) (-1644.637) * (-1645.546) [-1643.866] (-1646.847) (-1646.045) -- 0:00:47 276500 -- (-1643.952) [-1644.498] (-1643.632) (-1644.449) * (-1646.643) (-1644.210) [-1644.245] (-1645.246) -- 0:00:47 277000 -- (-1646.754) (-1645.463) (-1644.627) [-1643.978] * (-1646.610) (-1644.257) (-1644.366) [-1644.949] -- 0:00:46 277500 -- (-1650.815) (-1647.142) (-1648.242) [-1644.227] * (-1645.951) [-1644.433] (-1646.285) (-1644.745) -- 0:00:46 278000 -- (-1649.735) (-1647.761) [-1646.156] (-1644.391) * (-1645.709) (-1645.765) [-1643.394] (-1643.786) -- 0:00:46 278500 -- (-1643.875) (-1649.994) (-1645.486) [-1644.641] * (-1644.668) (-1645.593) (-1645.254) [-1645.832] -- 0:00:46 279000 -- (-1648.001) (-1648.769) [-1647.641] (-1647.720) * (-1644.088) (-1646.230) [-1646.147] (-1645.355) -- 0:00:46 279500 -- (-1646.114) (-1645.837) (-1654.170) [-1646.090] * [-1644.858] (-1646.916) (-1645.512) (-1643.657) -- 0:00:46 280000 -- [-1650.249] (-1645.739) (-1649.518) (-1650.058) * (-1644.819) (-1647.827) [-1643.549] (-1644.505) -- 0:00:46 Average standard deviation of split frequencies: 0.016271 280500 -- (-1648.290) (-1645.990) (-1652.223) [-1649.555] * [-1643.581] (-1651.857) (-1645.632) (-1642.913) -- 0:00:46 281000 -- (-1648.741) (-1647.773) [-1643.836] (-1643.630) * (-1643.675) (-1644.117) (-1644.029) [-1643.750] -- 0:00:46 281500 -- (-1644.928) (-1645.951) (-1643.861) [-1645.241] * (-1643.422) (-1645.389) [-1643.433] (-1646.475) -- 0:00:45 282000 -- (-1645.129) [-1649.435] (-1644.489) (-1647.364) * [-1643.364] (-1644.938) (-1643.450) (-1644.959) -- 0:00:45 282500 -- (-1644.390) (-1648.425) [-1645.171] (-1643.854) * (-1643.560) (-1647.876) (-1644.296) [-1645.137] -- 0:00:45 283000 -- [-1644.120] (-1644.072) (-1644.950) (-1644.261) * (-1643.364) (-1644.869) [-1644.595] (-1645.009) -- 0:00:45 283500 -- [-1645.570] (-1643.809) (-1644.720) (-1647.589) * (-1645.078) (-1643.628) [-1643.938] (-1646.173) -- 0:00:45 284000 -- (-1643.632) [-1643.684] (-1644.400) (-1646.126) * (-1644.049) (-1644.907) [-1643.593] (-1646.251) -- 0:00:45 284500 -- (-1645.658) (-1643.613) (-1644.207) [-1644.288] * [-1643.505] (-1645.735) (-1643.061) (-1646.227) -- 0:00:45 285000 -- (-1645.387) (-1645.935) (-1648.332) [-1648.910] * (-1642.828) [-1645.254] (-1642.813) (-1644.582) -- 0:00:45 Average standard deviation of split frequencies: 0.015865 285500 -- [-1646.070] (-1644.142) (-1646.585) (-1644.955) * (-1644.020) (-1644.928) [-1643.847] (-1643.926) -- 0:00:45 286000 -- (-1645.751) [-1644.951] (-1643.185) (-1647.567) * (-1645.295) [-1643.552] (-1644.555) (-1644.999) -- 0:00:44 286500 -- (-1645.927) (-1647.891) (-1644.196) [-1643.421] * [-1643.381] (-1644.064) (-1644.226) (-1645.340) -- 0:00:44 287000 -- (-1645.684) (-1646.733) [-1646.039] (-1643.746) * (-1643.632) (-1644.131) (-1642.964) [-1645.410] -- 0:00:44 287500 -- [-1645.273] (-1649.350) (-1646.062) (-1647.362) * (-1645.572) (-1643.660) [-1643.443] (-1645.450) -- 0:00:44 288000 -- (-1644.289) (-1647.769) (-1644.638) [-1644.232] * (-1646.978) (-1645.843) (-1646.382) [-1644.775] -- 0:00:44 288500 -- (-1643.956) (-1649.430) (-1643.610) [-1644.065] * (-1645.943) (-1648.259) (-1648.345) [-1645.716] -- 0:00:44 289000 -- (-1645.384) (-1650.146) (-1648.352) [-1643.993] * (-1643.743) (-1649.680) (-1646.848) [-1644.930] -- 0:00:44 289500 -- (-1643.234) (-1644.671) [-1647.243] (-1644.341) * (-1644.154) (-1647.919) [-1644.014] (-1645.378) -- 0:00:44 290000 -- [-1645.442] (-1644.021) (-1645.997) (-1643.485) * (-1644.134) (-1645.067) [-1645.497] (-1646.276) -- 0:00:44 Average standard deviation of split frequencies: 0.015914 290500 -- (-1645.186) (-1645.085) [-1644.268] (-1643.802) * (-1642.897) (-1644.908) [-1646.623] (-1645.727) -- 0:00:46 291000 -- (-1644.537) [-1644.994] (-1645.234) (-1643.801) * (-1645.114) [-1644.662] (-1647.130) (-1644.201) -- 0:00:46 291500 -- [-1644.535] (-1645.565) (-1644.584) (-1643.412) * (-1646.035) (-1646.233) (-1647.508) [-1645.064] -- 0:00:46 292000 -- (-1643.155) [-1645.594] (-1645.421) (-1645.204) * (-1646.760) [-1645.734] (-1646.117) (-1644.578) -- 0:00:46 292500 -- (-1644.842) (-1643.535) [-1648.277] (-1644.833) * [-1646.346] (-1646.080) (-1645.844) (-1646.018) -- 0:00:45 293000 -- [-1644.599] (-1644.369) (-1649.889) (-1644.048) * (-1646.346) [-1644.142] (-1646.764) (-1643.915) -- 0:00:45 293500 -- [-1643.875] (-1644.524) (-1651.000) (-1643.797) * (-1645.785) [-1645.863] (-1646.060) (-1645.153) -- 0:00:45 294000 -- (-1643.661) (-1644.072) [-1647.463] (-1648.336) * [-1644.768] (-1644.763) (-1647.561) (-1645.556) -- 0:00:45 294500 -- (-1645.796) [-1644.993] (-1646.015) (-1646.761) * (-1649.732) [-1647.156] (-1644.756) (-1647.808) -- 0:00:45 295000 -- [-1646.186] (-1646.601) (-1643.264) (-1644.246) * (-1644.953) (-1652.797) [-1645.155] (-1645.784) -- 0:00:45 Average standard deviation of split frequencies: 0.016822 295500 -- (-1644.114) (-1648.786) [-1644.741] (-1643.209) * (-1648.986) [-1646.169] (-1645.171) (-1645.291) -- 0:00:45 296000 -- (-1644.786) (-1645.256) [-1644.059] (-1645.876) * (-1648.208) (-1646.285) (-1644.962) [-1645.583] -- 0:00:45 296500 -- (-1645.407) (-1645.067) (-1644.991) [-1643.896] * [-1644.114] (-1646.106) (-1645.010) (-1647.151) -- 0:00:45 297000 -- [-1645.316] (-1643.686) (-1644.109) (-1643.659) * (-1643.513) (-1646.329) (-1645.610) [-1647.286] -- 0:00:44 297500 -- (-1647.315) (-1649.514) [-1645.689] (-1644.863) * (-1644.000) [-1644.124] (-1644.026) (-1644.680) -- 0:00:44 298000 -- (-1647.621) [-1647.870] (-1643.656) (-1646.099) * (-1643.244) (-1643.547) [-1644.359] (-1648.541) -- 0:00:44 298500 -- (-1645.979) (-1646.860) [-1647.976] (-1645.741) * [-1643.263] (-1643.552) (-1643.486) (-1648.971) -- 0:00:44 299000 -- (-1644.979) (-1644.462) (-1646.248) [-1647.523] * [-1643.877] (-1643.658) (-1643.251) (-1647.385) -- 0:00:44 299500 -- [-1643.645] (-1644.900) (-1647.866) (-1650.979) * [-1645.318] (-1643.254) (-1644.495) (-1650.400) -- 0:00:44 300000 -- (-1650.330) [-1644.993] (-1644.440) (-1644.835) * (-1644.326) (-1647.841) (-1644.919) [-1644.325] -- 0:00:44 Average standard deviation of split frequencies: 0.016757 300500 -- [-1645.635] (-1647.037) (-1643.709) (-1644.574) * (-1644.885) (-1648.780) [-1644.514] (-1645.007) -- 0:00:44 301000 -- (-1645.669) [-1644.672] (-1647.873) (-1647.211) * [-1646.097] (-1649.985) (-1645.517) (-1645.282) -- 0:00:44 301500 -- [-1645.203] (-1649.624) (-1645.242) (-1647.686) * (-1644.969) (-1646.226) (-1646.777) [-1644.386] -- 0:00:44 302000 -- (-1646.045) (-1649.685) [-1644.778] (-1644.881) * (-1645.569) (-1644.031) [-1644.741] (-1645.551) -- 0:00:43 302500 -- [-1649.315] (-1647.291) (-1646.137) (-1644.676) * (-1644.289) (-1644.288) (-1643.761) [-1646.115] -- 0:00:43 303000 -- (-1644.485) [-1643.931] (-1644.415) (-1645.506) * (-1650.267) (-1644.876) [-1644.513] (-1644.688) -- 0:00:43 303500 -- (-1643.392) (-1644.168) [-1647.700] (-1645.354) * (-1650.314) (-1648.310) (-1644.769) [-1647.457] -- 0:00:43 304000 -- [-1647.708] (-1646.412) (-1650.111) (-1645.274) * (-1648.346) [-1646.759] (-1647.021) (-1644.052) -- 0:00:43 304500 -- (-1647.135) (-1645.384) (-1644.978) [-1644.289] * [-1645.591] (-1644.512) (-1647.498) (-1647.286) -- 0:00:45 305000 -- (-1644.404) [-1644.891] (-1646.073) (-1647.656) * (-1646.150) [-1644.710] (-1646.245) (-1646.887) -- 0:00:45 Average standard deviation of split frequencies: 0.017138 305500 -- (-1644.240) (-1644.489) (-1650.216) [-1644.306] * [-1644.376] (-1643.742) (-1643.665) (-1644.092) -- 0:00:45 306000 -- (-1644.011) (-1643.779) (-1643.772) [-1644.285] * (-1645.670) (-1643.493) [-1644.448] (-1643.606) -- 0:00:45 306500 -- (-1644.521) (-1648.005) (-1645.448) [-1643.522] * (-1645.806) (-1644.421) (-1643.622) [-1644.198] -- 0:00:45 307000 -- (-1643.944) [-1646.644] (-1644.150) (-1643.634) * (-1644.297) (-1643.975) [-1643.032] (-1643.447) -- 0:00:45 307500 -- (-1643.638) (-1644.547) [-1643.650] (-1643.902) * (-1644.063) (-1644.942) (-1644.325) [-1644.770] -- 0:00:45 308000 -- (-1643.360) (-1644.061) (-1644.564) [-1646.152] * [-1644.338] (-1647.543) (-1643.675) (-1645.199) -- 0:00:44 308500 -- (-1644.178) (-1646.432) [-1648.313] (-1645.065) * (-1646.176) (-1644.722) (-1644.057) [-1643.373] -- 0:00:44 309000 -- (-1647.294) (-1648.164) (-1644.426) [-1645.157] * (-1648.114) (-1652.069) (-1644.724) [-1644.237] -- 0:00:44 309500 -- (-1644.800) [-1644.123] (-1644.795) (-1646.820) * [-1644.355] (-1645.796) (-1651.021) (-1645.902) -- 0:00:44 310000 -- (-1644.567) [-1645.288] (-1648.369) (-1645.867) * (-1644.117) (-1645.679) (-1645.721) [-1648.792] -- 0:00:44 Average standard deviation of split frequencies: 0.016028 310500 -- (-1644.773) [-1649.177] (-1644.753) (-1644.489) * [-1645.970] (-1644.828) (-1646.714) (-1648.889) -- 0:00:44 311000 -- [-1644.706] (-1643.889) (-1646.879) (-1645.937) * (-1643.972) (-1643.798) [-1644.208] (-1644.458) -- 0:00:44 311500 -- (-1646.267) (-1644.482) [-1645.449] (-1644.132) * [-1645.702] (-1643.876) (-1643.177) (-1644.499) -- 0:00:44 312000 -- (-1645.288) (-1644.393) (-1644.417) [-1646.661] * [-1646.509] (-1645.418) (-1643.180) (-1644.899) -- 0:00:44 312500 -- (-1646.347) (-1643.822) [-1643.507] (-1646.129) * [-1646.823] (-1646.921) (-1644.167) (-1645.711) -- 0:00:44 313000 -- (-1646.693) (-1644.307) [-1643.546] (-1650.932) * (-1644.905) (-1645.469) (-1643.463) [-1644.517] -- 0:00:43 313500 -- (-1645.570) [-1643.317] (-1647.081) (-1654.324) * (-1646.006) (-1646.003) (-1643.421) [-1647.023] -- 0:00:43 314000 -- [-1646.568] (-1644.709) (-1645.268) (-1644.472) * (-1645.638) (-1645.667) [-1644.397] (-1646.937) -- 0:00:43 314500 -- (-1646.983) (-1644.071) [-1646.387] (-1643.466) * [-1645.589] (-1643.999) (-1644.702) (-1644.829) -- 0:00:43 315000 -- (-1646.080) [-1645.639] (-1643.292) (-1643.295) * [-1643.353] (-1644.615) (-1643.784) (-1654.189) -- 0:00:43 Average standard deviation of split frequencies: 0.015384 315500 -- (-1646.668) [-1644.137] (-1644.259) (-1645.781) * [-1643.353] (-1643.983) (-1644.702) (-1643.513) -- 0:00:43 316000 -- (-1646.391) [-1643.789] (-1644.684) (-1643.487) * (-1643.873) (-1646.546) [-1643.924] (-1644.434) -- 0:00:43 316500 -- [-1646.893] (-1644.142) (-1644.754) (-1644.137) * (-1645.144) (-1646.542) [-1643.658] (-1644.083) -- 0:00:43 317000 -- (-1646.128) (-1645.180) [-1646.806] (-1643.464) * (-1644.584) [-1647.576] (-1643.462) (-1644.240) -- 0:00:43 317500 -- (-1648.463) (-1646.985) (-1646.430) [-1650.483] * (-1643.913) (-1645.280) [-1643.725] (-1643.179) -- 0:00:42 318000 -- (-1646.269) (-1643.968) (-1646.679) [-1645.854] * [-1644.479] (-1644.661) (-1643.725) (-1648.398) -- 0:00:42 318500 -- (-1644.454) [-1644.818] (-1647.102) (-1647.652) * [-1648.215] (-1645.896) (-1643.726) (-1647.114) -- 0:00:42 319000 -- (-1647.612) [-1645.302] (-1647.317) (-1647.265) * (-1644.737) [-1644.609] (-1643.602) (-1645.825) -- 0:00:44 319500 -- (-1648.343) (-1646.444) [-1650.518] (-1645.926) * (-1645.486) (-1643.210) (-1643.540) [-1646.877] -- 0:00:44 320000 -- (-1649.027) [-1651.054] (-1647.936) (-1644.931) * (-1645.022) (-1644.130) [-1643.358] (-1648.828) -- 0:00:44 Average standard deviation of split frequencies: 0.014609 320500 -- (-1646.747) [-1648.326] (-1644.951) (-1644.738) * (-1646.561) (-1650.768) [-1644.155] (-1646.071) -- 0:00:44 321000 -- [-1645.941] (-1648.204) (-1643.794) (-1646.141) * (-1644.682) (-1646.962) (-1644.445) [-1643.145] -- 0:00:44 321500 -- [-1647.801] (-1645.898) (-1643.973) (-1649.179) * (-1645.181) (-1643.379) (-1645.807) [-1643.069] -- 0:00:44 322000 -- (-1645.677) (-1645.898) [-1645.344] (-1644.803) * [-1645.934] (-1644.293) (-1645.590) (-1646.474) -- 0:00:44 322500 -- [-1644.484] (-1643.994) (-1644.478) (-1646.677) * [-1647.172] (-1645.584) (-1645.715) (-1651.508) -- 0:00:44 323000 -- (-1644.327) (-1646.387) (-1645.118) [-1643.721] * [-1648.759] (-1645.518) (-1645.189) (-1645.770) -- 0:00:44 323500 -- (-1645.402) (-1643.947) (-1645.332) [-1644.617] * (-1645.972) (-1645.053) [-1644.339] (-1645.254) -- 0:00:43 324000 -- (-1647.796) (-1644.204) [-1647.255] (-1644.629) * (-1647.399) [-1646.091] (-1645.471) (-1644.204) -- 0:00:43 324500 -- (-1647.139) [-1645.907] (-1646.973) (-1644.666) * (-1647.374) (-1644.886) [-1644.391] (-1642.783) -- 0:00:43 325000 -- [-1645.779] (-1645.345) (-1644.182) (-1645.412) * (-1648.047) [-1647.856] (-1644.433) (-1648.861) -- 0:00:43 Average standard deviation of split frequencies: 0.013780 325500 -- [-1646.137] (-1645.567) (-1643.990) (-1646.047) * (-1647.062) (-1647.589) (-1644.348) [-1645.231] -- 0:00:43 326000 -- (-1645.240) (-1646.135) (-1643.668) [-1644.888] * (-1644.221) (-1647.211) (-1645.353) [-1643.295] -- 0:00:43 326500 -- (-1648.271) (-1645.224) [-1645.935] (-1646.087) * (-1643.355) (-1644.572) [-1644.913] (-1645.127) -- 0:00:43 327000 -- (-1644.313) (-1647.528) (-1645.895) [-1644.179] * (-1644.179) (-1643.839) [-1644.674] (-1645.653) -- 0:00:43 327500 -- (-1646.702) [-1643.416] (-1644.449) (-1644.061) * [-1643.554] (-1643.401) (-1646.382) (-1646.557) -- 0:00:43 328000 -- (-1644.883) (-1643.391) [-1644.887] (-1645.376) * (-1644.065) [-1644.776] (-1647.073) (-1646.303) -- 0:00:43 328500 -- (-1643.629) [-1643.039] (-1644.653) (-1644.763) * (-1643.265) [-1644.082] (-1646.032) (-1644.602) -- 0:00:42 329000 -- [-1644.367] (-1644.759) (-1645.461) (-1645.972) * (-1643.905) [-1647.059] (-1645.519) (-1645.435) -- 0:00:42 329500 -- [-1646.855] (-1648.051) (-1644.008) (-1644.656) * (-1644.936) (-1645.190) (-1643.955) [-1644.378] -- 0:00:42 330000 -- (-1644.039) [-1650.808] (-1645.986) (-1646.234) * (-1645.054) (-1644.559) [-1644.565] (-1646.327) -- 0:00:42 Average standard deviation of split frequencies: 0.014523 330500 -- (-1645.080) (-1647.092) [-1644.063] (-1643.616) * (-1645.932) (-1645.771) [-1645.252] (-1645.783) -- 0:00:42 331000 -- (-1644.804) (-1645.884) (-1643.636) [-1642.932] * (-1644.883) (-1646.095) (-1644.755) [-1644.639] -- 0:00:42 331500 -- [-1643.293] (-1645.216) (-1646.202) (-1643.115) * (-1648.569) (-1645.622) (-1644.247) [-1644.437] -- 0:00:42 332000 -- [-1644.976] (-1646.961) (-1647.160) (-1643.675) * (-1649.364) (-1645.515) (-1643.898) [-1645.435] -- 0:00:42 332500 -- (-1644.383) [-1643.087] (-1649.420) (-1645.082) * (-1643.108) [-1646.015] (-1648.099) (-1644.004) -- 0:00:42 333000 -- (-1643.534) [-1644.353] (-1645.266) (-1644.465) * (-1645.167) (-1648.208) [-1644.069] (-1643.922) -- 0:00:42 333500 -- [-1645.011] (-1644.109) (-1645.086) (-1644.070) * (-1646.994) (-1647.029) (-1645.547) [-1646.017] -- 0:00:41 334000 -- (-1645.011) (-1644.286) [-1644.052] (-1646.174) * [-1645.194] (-1646.458) (-1648.334) (-1644.942) -- 0:00:43 334500 -- (-1643.716) (-1647.087) [-1645.859] (-1644.541) * (-1646.898) (-1647.650) [-1646.821] (-1648.676) -- 0:00:43 335000 -- [-1645.785] (-1644.475) (-1645.043) (-1643.177) * (-1646.873) (-1648.125) (-1643.432) [-1646.147] -- 0:00:43 Average standard deviation of split frequencies: 0.013855 335500 -- (-1643.928) (-1644.512) (-1645.258) [-1643.274] * (-1646.279) [-1645.985] (-1653.947) (-1647.460) -- 0:00:43 336000 -- (-1643.130) (-1643.059) (-1645.504) [-1644.914] * (-1644.539) (-1645.187) (-1653.866) [-1644.324] -- 0:00:43 336500 -- (-1643.536) (-1643.256) [-1645.045] (-1645.748) * [-1644.571] (-1644.694) (-1648.354) (-1647.972) -- 0:00:43 337000 -- [-1647.450] (-1642.759) (-1646.726) (-1642.920) * (-1645.172) (-1644.871) [-1645.574] (-1647.439) -- 0:00:43 337500 -- (-1644.293) (-1643.866) [-1645.918] (-1643.986) * (-1644.439) (-1643.234) (-1647.164) [-1645.133] -- 0:00:43 338000 -- (-1652.202) (-1643.853) (-1645.277) [-1643.850] * [-1644.314] (-1644.343) (-1645.575) (-1644.649) -- 0:00:43 338500 -- (-1648.047) [-1643.443] (-1644.094) (-1645.900) * [-1643.635] (-1646.570) (-1644.340) (-1652.424) -- 0:00:42 339000 -- (-1643.594) (-1643.998) (-1643.723) [-1646.380] * (-1645.414) (-1646.496) (-1645.299) [-1652.874] -- 0:00:42 339500 -- (-1643.521) (-1647.031) (-1645.145) [-1645.549] * (-1643.319) [-1643.791] (-1645.572) (-1650.082) -- 0:00:42 340000 -- (-1643.097) (-1647.081) [-1643.518] (-1644.022) * (-1644.031) (-1645.553) [-1645.046] (-1649.040) -- 0:00:42 Average standard deviation of split frequencies: 0.014703 340500 -- (-1643.512) (-1647.529) [-1644.999] (-1647.404) * (-1643.920) (-1646.356) (-1644.287) [-1647.721] -- 0:00:42 341000 -- [-1643.414] (-1645.116) (-1645.005) (-1645.803) * (-1644.791) (-1647.251) (-1644.775) [-1645.076] -- 0:00:42 341500 -- [-1643.393] (-1644.884) (-1644.774) (-1655.006) * (-1643.483) (-1646.721) [-1644.377] (-1646.535) -- 0:00:42 342000 -- [-1645.860] (-1645.886) (-1647.292) (-1645.588) * (-1644.036) [-1649.969] (-1647.242) (-1648.419) -- 0:00:42 342500 -- (-1644.585) [-1644.728] (-1646.111) (-1644.564) * (-1644.514) (-1646.966) (-1643.491) [-1649.677] -- 0:00:42 343000 -- [-1646.008] (-1645.114) (-1645.473) (-1645.846) * (-1650.146) (-1644.873) [-1648.753] (-1648.981) -- 0:00:42 343500 -- (-1645.303) (-1645.543) (-1644.716) [-1643.925] * (-1643.777) (-1647.008) [-1646.399] (-1646.757) -- 0:00:42 344000 -- [-1645.305] (-1644.210) (-1644.374) (-1646.306) * (-1643.703) (-1645.639) (-1648.190) [-1646.305] -- 0:00:41 344500 -- [-1646.612] (-1644.210) (-1643.567) (-1647.410) * (-1643.536) [-1647.613] (-1647.106) (-1647.007) -- 0:00:41 345000 -- (-1644.864) (-1643.695) [-1643.189] (-1646.448) * [-1644.257] (-1645.804) (-1645.866) (-1644.505) -- 0:00:41 Average standard deviation of split frequencies: 0.014266 345500 -- (-1643.595) [-1645.078] (-1650.910) (-1645.906) * (-1643.492) (-1645.460) [-1648.068] (-1644.304) -- 0:00:41 346000 -- (-1643.557) [-1645.035] (-1648.078) (-1646.853) * (-1643.426) [-1645.544] (-1648.266) (-1644.257) -- 0:00:41 346500 -- (-1643.557) (-1645.309) [-1643.408] (-1646.210) * (-1643.233) (-1642.805) (-1645.159) [-1645.591] -- 0:00:41 347000 -- (-1645.718) (-1644.892) (-1645.153) [-1643.897] * (-1643.634) (-1642.836) [-1643.366] (-1647.329) -- 0:00:41 347500 -- (-1647.952) (-1644.654) (-1645.863) [-1647.324] * (-1643.748) (-1642.866) [-1645.809] (-1647.326) -- 0:00:41 348000 -- (-1647.793) (-1648.968) [-1647.357] (-1646.449) * (-1643.827) (-1643.192) [-1646.398] (-1645.825) -- 0:00:41 348500 -- [-1644.792] (-1646.273) (-1646.511) (-1643.998) * [-1644.121] (-1644.132) (-1646.918) (-1645.276) -- 0:00:41 349000 -- (-1645.083) (-1647.019) (-1648.197) [-1643.998] * [-1647.688] (-1646.669) (-1648.674) (-1645.598) -- 0:00:42 349500 -- (-1645.907) (-1647.454) (-1646.034) [-1643.998] * [-1647.143] (-1644.796) (-1654.500) (-1648.218) -- 0:00:42 350000 -- (-1645.840) (-1649.961) (-1647.719) [-1644.932] * (-1643.944) (-1643.904) (-1645.825) [-1644.435] -- 0:00:42 Average standard deviation of split frequencies: 0.014392 350500 -- (-1643.870) (-1647.582) [-1649.376] (-1643.459) * (-1648.339) (-1644.817) (-1651.886) [-1643.994] -- 0:00:42 351000 -- (-1643.474) (-1647.045) (-1643.988) [-1644.833] * (-1652.661) [-1645.106] (-1644.518) (-1645.033) -- 0:00:42 351500 -- (-1644.766) (-1647.045) (-1643.363) [-1643.737] * (-1644.511) (-1647.917) (-1644.444) [-1643.781] -- 0:00:42 352000 -- [-1644.036] (-1644.410) (-1643.184) (-1645.652) * [-1645.722] (-1646.712) (-1643.542) (-1645.441) -- 0:00:42 352500 -- (-1642.869) (-1644.182) [-1643.146] (-1646.567) * (-1643.691) (-1646.840) [-1643.383] (-1643.983) -- 0:00:42 353000 -- [-1643.348] (-1644.119) (-1645.203) (-1645.769) * (-1643.691) [-1645.845] (-1643.701) (-1644.275) -- 0:00:42 353500 -- [-1643.500] (-1643.626) (-1644.793) (-1647.330) * [-1643.691] (-1644.568) (-1644.084) (-1644.012) -- 0:00:42 354000 -- (-1643.192) [-1643.511] (-1645.835) (-1642.949) * (-1645.030) (-1645.086) [-1643.803] (-1644.176) -- 0:00:41 354500 -- [-1642.947] (-1644.380) (-1643.732) (-1642.949) * [-1644.995] (-1644.685) (-1643.500) (-1643.893) -- 0:00:41 355000 -- (-1643.043) [-1644.204] (-1644.594) (-1646.509) * (-1643.844) (-1646.116) [-1645.549] (-1644.453) -- 0:00:41 Average standard deviation of split frequencies: 0.014021 355500 -- (-1643.005) (-1646.392) [-1644.160] (-1644.915) * [-1643.790] (-1648.010) (-1648.185) (-1645.088) -- 0:00:41 356000 -- [-1645.586] (-1645.261) (-1648.799) (-1643.905) * (-1646.220) [-1648.197] (-1648.663) (-1644.164) -- 0:00:41 356500 -- (-1644.255) (-1644.220) [-1644.028] (-1644.703) * (-1644.125) (-1647.357) [-1648.624] (-1645.986) -- 0:00:41 357000 -- (-1644.499) (-1646.189) (-1644.681) [-1645.164] * [-1644.595] (-1648.579) (-1645.542) (-1645.986) -- 0:00:41 357500 -- (-1643.819) (-1645.543) [-1643.688] (-1643.191) * [-1644.214] (-1645.164) (-1644.010) (-1644.791) -- 0:00:41 358000 -- (-1645.045) (-1647.459) [-1643.794] (-1648.129) * [-1643.876] (-1645.888) (-1648.076) (-1647.303) -- 0:00:41 358500 -- (-1644.948) (-1643.331) (-1649.015) [-1648.421] * (-1643.174) [-1646.317] (-1644.037) (-1645.153) -- 0:00:41 359000 -- [-1643.195] (-1643.331) (-1644.597) (-1656.785) * [-1643.160] (-1646.997) (-1644.705) (-1647.667) -- 0:00:41 359500 -- (-1645.263) (-1644.408) (-1644.650) [-1645.922] * (-1643.192) (-1645.257) [-1645.169] (-1644.146) -- 0:00:40 360000 -- (-1646.952) (-1647.337) (-1645.867) [-1646.132] * (-1643.136) (-1647.649) [-1643.867] (-1645.328) -- 0:00:40 Average standard deviation of split frequencies: 0.013561 360500 -- [-1644.854] (-1644.985) (-1646.126) (-1645.147) * [-1645.476] (-1644.878) (-1643.586) (-1645.685) -- 0:00:40 361000 -- (-1644.781) [-1643.957] (-1647.459) (-1644.055) * [-1644.462] (-1645.182) (-1643.514) (-1647.086) -- 0:00:40 361500 -- (-1643.712) (-1646.613) [-1644.948] (-1645.401) * [-1645.883] (-1646.413) (-1644.496) (-1646.741) -- 0:00:40 362000 -- (-1645.052) (-1647.350) [-1645.876] (-1645.538) * [-1644.136] (-1643.269) (-1644.096) (-1644.572) -- 0:00:40 362500 -- (-1643.345) [-1645.237] (-1645.395) (-1646.202) * [-1645.219] (-1643.274) (-1645.011) (-1646.022) -- 0:00:40 363000 -- (-1644.542) [-1646.618] (-1644.625) (-1646.416) * (-1644.905) (-1645.786) (-1643.957) [-1645.030] -- 0:00:40 363500 -- (-1648.144) (-1648.292) [-1647.409] (-1644.470) * [-1646.931] (-1647.185) (-1643.553) (-1646.265) -- 0:00:42 364000 -- (-1648.467) (-1645.041) (-1646.801) [-1646.282] * [-1644.533] (-1648.823) (-1643.552) (-1643.958) -- 0:00:41 364500 -- (-1644.046) [-1644.130] (-1648.210) (-1645.918) * [-1643.697] (-1642.980) (-1646.290) (-1645.577) -- 0:00:41 365000 -- (-1645.933) [-1645.478] (-1645.350) (-1645.767) * (-1644.159) [-1643.982] (-1646.558) (-1646.162) -- 0:00:41 Average standard deviation of split frequencies: 0.013846 365500 -- (-1645.641) (-1644.018) [-1645.661] (-1645.794) * [-1647.978] (-1643.258) (-1646.957) (-1646.438) -- 0:00:41 366000 -- (-1645.359) [-1644.840] (-1649.261) (-1648.915) * (-1647.078) (-1644.376) [-1649.453] (-1647.157) -- 0:00:41 366500 -- (-1645.078) [-1645.876] (-1646.568) (-1647.189) * (-1643.626) (-1649.369) [-1645.509] (-1644.127) -- 0:00:41 367000 -- (-1643.591) [-1645.443] (-1645.695) (-1645.862) * (-1646.657) (-1645.846) [-1645.313] (-1650.666) -- 0:00:41 367500 -- (-1643.790) [-1645.785] (-1654.236) (-1643.977) * [-1647.641] (-1650.091) (-1644.325) (-1648.594) -- 0:00:41 368000 -- (-1643.034) [-1643.623] (-1650.505) (-1643.988) * (-1646.104) (-1645.717) [-1646.791] (-1645.390) -- 0:00:41 368500 -- (-1646.814) [-1643.970] (-1644.841) (-1644.180) * (-1646.703) [-1646.006] (-1644.945) (-1644.038) -- 0:00:41 369000 -- [-1647.086] (-1644.324) (-1645.605) (-1645.406) * (-1645.723) (-1645.006) [-1643.867] (-1643.523) -- 0:00:41 369500 -- (-1645.856) (-1644.966) [-1644.095] (-1644.747) * (-1645.936) [-1644.692] (-1645.639) (-1643.581) -- 0:00:40 370000 -- (-1645.495) (-1644.988) (-1649.889) [-1644.141] * (-1646.614) (-1646.968) [-1645.405] (-1645.932) -- 0:00:40 Average standard deviation of split frequencies: 0.013195 370500 -- (-1643.902) [-1644.122] (-1644.905) (-1644.003) * (-1650.640) (-1646.615) (-1646.190) [-1643.741] -- 0:00:40 371000 -- (-1645.075) (-1643.386) [-1645.117] (-1643.569) * (-1643.331) [-1645.837] (-1643.947) (-1643.237) -- 0:00:40 371500 -- (-1644.702) (-1645.187) [-1646.717] (-1643.635) * (-1652.636) (-1644.848) [-1645.987] (-1644.183) -- 0:00:40 372000 -- (-1647.702) (-1647.170) (-1647.911) [-1645.604] * (-1643.213) (-1644.919) [-1645.761] (-1645.452) -- 0:00:40 372500 -- (-1645.130) [-1642.924] (-1643.384) (-1647.351) * [-1643.199] (-1644.128) (-1646.597) (-1645.562) -- 0:00:40 373000 -- (-1649.842) [-1643.402] (-1644.123) (-1645.250) * (-1643.162) [-1644.438] (-1643.955) (-1643.832) -- 0:00:40 373500 -- [-1644.866] (-1645.070) (-1644.793) (-1646.530) * (-1643.523) (-1646.087) [-1644.127] (-1643.812) -- 0:00:40 374000 -- (-1644.432) [-1645.910] (-1643.181) (-1645.187) * (-1643.258) (-1644.889) (-1647.412) [-1643.348] -- 0:00:40 374500 -- (-1646.746) [-1649.338] (-1643.799) (-1647.991) * (-1644.539) (-1648.068) (-1644.269) [-1643.359] -- 0:00:40 375000 -- (-1648.699) (-1644.109) [-1645.899] (-1644.968) * (-1644.325) (-1643.840) [-1648.118] (-1643.629) -- 0:00:40 Average standard deviation of split frequencies: 0.012772 375500 -- (-1647.437) (-1644.109) [-1644.348] (-1644.253) * [-1645.969] (-1648.854) (-1645.646) (-1643.511) -- 0:00:39 376000 -- [-1650.057] (-1646.290) (-1647.858) (-1644.684) * [-1644.690] (-1644.705) (-1646.197) (-1644.452) -- 0:00:39 376500 -- [-1645.780] (-1643.036) (-1644.672) (-1643.908) * [-1645.467] (-1645.040) (-1651.610) (-1644.436) -- 0:00:39 377000 -- (-1644.432) (-1645.796) (-1645.006) [-1643.912] * (-1643.763) (-1646.928) [-1648.465] (-1644.449) -- 0:00:39 377500 -- (-1645.083) [-1643.479] (-1644.428) (-1643.720) * (-1643.679) [-1645.039] (-1648.224) (-1643.964) -- 0:00:41 378000 -- (-1645.163) [-1643.964] (-1644.454) (-1651.094) * (-1643.707) (-1645.778) [-1645.507] (-1643.648) -- 0:00:41 378500 -- [-1643.750] (-1645.115) (-1643.618) (-1644.729) * (-1646.808) (-1645.563) (-1646.071) [-1645.391] -- 0:00:41 379000 -- [-1645.579] (-1646.692) (-1644.991) (-1646.031) * [-1645.161] (-1647.285) (-1644.872) (-1643.798) -- 0:00:40 379500 -- (-1647.730) [-1644.967] (-1644.987) (-1645.198) * [-1646.668] (-1648.234) (-1645.941) (-1645.301) -- 0:00:40 380000 -- (-1648.504) (-1645.795) (-1647.932) [-1645.322] * (-1644.705) [-1645.007] (-1648.586) (-1645.278) -- 0:00:40 Average standard deviation of split frequencies: 0.013622 380500 -- (-1646.013) [-1643.060] (-1647.655) (-1644.598) * [-1644.813] (-1647.830) (-1647.346) (-1651.701) -- 0:00:40 381000 -- (-1645.667) (-1644.635) (-1645.847) [-1644.598] * (-1643.687) [-1647.169] (-1644.587) (-1644.398) -- 0:00:40 381500 -- (-1645.490) (-1647.771) (-1645.236) [-1642.966] * [-1644.159] (-1646.597) (-1645.277) (-1644.926) -- 0:00:40 382000 -- (-1644.925) (-1644.322) (-1643.944) [-1643.650] * (-1645.186) (-1649.683) [-1643.431] (-1645.354) -- 0:00:40 382500 -- (-1644.097) (-1646.427) (-1647.949) [-1643.405] * (-1644.879) (-1644.092) (-1644.972) [-1644.283] -- 0:00:40 383000 -- (-1644.697) [-1644.650] (-1645.418) (-1643.964) * (-1649.267) (-1644.557) [-1645.573] (-1646.632) -- 0:00:40 383500 -- (-1645.202) [-1644.839] (-1644.937) (-1645.534) * (-1648.732) [-1643.532] (-1644.604) (-1644.807) -- 0:00:40 384000 -- (-1644.303) (-1643.452) [-1646.341] (-1645.109) * [-1645.983] (-1644.677) (-1645.865) (-1644.388) -- 0:00:40 384500 -- (-1644.695) (-1646.113) (-1643.809) [-1644.445] * (-1645.751) [-1643.791] (-1644.450) (-1645.459) -- 0:00:40 385000 -- (-1648.454) (-1645.133) (-1643.992) [-1644.594] * (-1643.271) (-1645.248) (-1643.543) [-1644.546] -- 0:00:39 Average standard deviation of split frequencies: 0.013815 385500 -- (-1644.525) (-1644.074) (-1643.670) [-1645.278] * (-1646.254) (-1647.563) (-1643.467) [-1646.244] -- 0:00:39 386000 -- (-1644.762) (-1644.210) [-1645.521] (-1644.040) * (-1650.221) (-1645.971) (-1646.175) [-1647.773] -- 0:00:39 386500 -- (-1645.201) (-1648.482) (-1648.363) [-1645.146] * (-1649.954) (-1644.703) [-1643.335] (-1646.760) -- 0:00:39 387000 -- [-1646.012] (-1648.261) (-1653.395) (-1647.783) * (-1646.022) [-1644.029] (-1643.587) (-1645.439) -- 0:00:39 387500 -- (-1645.405) (-1644.652) [-1644.478] (-1647.267) * (-1645.311) [-1644.395] (-1643.176) (-1643.852) -- 0:00:39 388000 -- (-1649.322) (-1644.974) [-1643.114] (-1650.352) * (-1646.318) (-1644.317) (-1643.228) [-1645.587] -- 0:00:39 388500 -- [-1646.496] (-1645.867) (-1643.125) (-1643.931) * (-1643.990) (-1645.290) (-1650.970) [-1643.947] -- 0:00:39 389000 -- [-1644.327] (-1646.291) (-1642.767) (-1643.287) * [-1644.139] (-1648.834) (-1650.685) (-1643.834) -- 0:00:39 389500 -- (-1643.713) (-1647.493) [-1642.871] (-1643.880) * (-1644.132) [-1645.987] (-1647.683) (-1646.491) -- 0:00:39 390000 -- [-1646.177] (-1644.815) (-1643.019) (-1650.860) * (-1643.830) (-1646.646) [-1645.745] (-1646.219) -- 0:00:39 Average standard deviation of split frequencies: 0.013726 390500 -- [-1645.893] (-1644.092) (-1643.631) (-1643.971) * (-1643.830) (-1648.121) [-1646.054] (-1646.492) -- 0:00:39 391000 -- (-1647.215) [-1643.688] (-1644.509) (-1651.145) * (-1646.091) (-1646.361) (-1647.194) [-1644.517] -- 0:00:38 391500 -- (-1645.212) (-1644.425) [-1644.512] (-1644.665) * (-1646.279) (-1645.511) [-1645.205] (-1644.703) -- 0:00:38 392000 -- (-1644.649) (-1646.529) [-1643.610] (-1646.716) * (-1644.113) (-1646.728) (-1646.306) [-1649.325] -- 0:00:40 392500 -- [-1644.072] (-1645.315) (-1643.233) (-1643.384) * [-1644.868] (-1644.388) (-1644.267) (-1646.181) -- 0:00:40 393000 -- (-1643.725) (-1644.643) (-1643.231) [-1643.523] * (-1644.893) (-1644.439) [-1644.429] (-1643.854) -- 0:00:40 393500 -- [-1643.265] (-1643.978) (-1643.107) (-1644.760) * [-1644.557] (-1649.393) (-1644.059) (-1643.851) -- 0:00:40 394000 -- [-1645.052] (-1647.370) (-1643.413) (-1643.814) * (-1644.997) (-1645.519) (-1643.778) [-1644.172] -- 0:00:39 394500 -- [-1644.688] (-1643.520) (-1644.488) (-1650.227) * (-1643.397) [-1643.512] (-1644.060) (-1643.663) -- 0:00:39 395000 -- (-1644.639) (-1645.213) (-1644.894) [-1644.852] * (-1644.979) (-1643.977) [-1645.850] (-1643.650) -- 0:00:39 Average standard deviation of split frequencies: 0.014880 395500 -- [-1644.847] (-1647.080) (-1648.382) (-1647.160) * (-1644.050) [-1643.845] (-1644.796) (-1643.650) -- 0:00:39 396000 -- (-1645.378) (-1646.039) (-1648.948) [-1646.189] * (-1645.199) (-1645.835) (-1645.165) [-1643.485] -- 0:00:39 396500 -- [-1643.598] (-1648.629) (-1646.221) (-1643.285) * (-1643.428) (-1644.197) (-1645.313) [-1646.041] -- 0:00:39 397000 -- (-1644.975) (-1646.740) [-1648.773] (-1645.811) * [-1643.521] (-1646.714) (-1647.494) (-1643.902) -- 0:00:39 397500 -- (-1644.017) [-1645.813] (-1644.263) (-1647.112) * [-1645.514] (-1648.367) (-1647.495) (-1644.098) -- 0:00:39 398000 -- (-1646.941) [-1645.114] (-1644.330) (-1645.518) * (-1645.692) (-1645.893) [-1644.399] (-1649.264) -- 0:00:39 398500 -- (-1644.042) (-1644.567) (-1645.158) [-1646.026] * (-1643.318) (-1644.111) (-1644.649) [-1645.473] -- 0:00:39 399000 -- (-1645.158) [-1643.999] (-1647.433) (-1644.154) * (-1644.658) [-1646.098] (-1645.174) (-1646.611) -- 0:00:39 399500 -- [-1644.288] (-1643.345) (-1645.393) (-1648.249) * (-1644.993) [-1644.968] (-1645.144) (-1645.185) -- 0:00:39 400000 -- (-1646.608) [-1644.639] (-1643.880) (-1643.884) * (-1644.096) [-1645.405] (-1646.717) (-1644.186) -- 0:00:39 Average standard deviation of split frequencies: 0.013677 400500 -- [-1644.922] (-1648.843) (-1643.805) (-1646.868) * (-1642.876) [-1645.875] (-1645.758) (-1643.864) -- 0:00:38 401000 -- (-1644.824) [-1647.093] (-1643.592) (-1646.359) * (-1645.806) (-1643.037) (-1644.678) [-1644.012] -- 0:00:38 401500 -- (-1647.933) (-1647.404) (-1644.579) [-1649.507] * (-1645.822) (-1644.663) (-1644.058) [-1646.431] -- 0:00:38 402000 -- [-1646.622] (-1643.866) (-1643.384) (-1643.110) * (-1644.870) (-1644.681) [-1645.635] (-1648.862) -- 0:00:38 402500 -- [-1647.413] (-1643.661) (-1643.803) (-1643.832) * [-1644.879] (-1643.737) (-1644.241) (-1645.094) -- 0:00:38 403000 -- [-1646.958] (-1645.533) (-1643.779) (-1643.172) * (-1645.027) (-1644.601) (-1644.367) [-1644.339] -- 0:00:38 403500 -- (-1648.262) (-1645.248) [-1643.934] (-1643.848) * (-1646.140) (-1644.647) [-1644.749] (-1645.052) -- 0:00:38 404000 -- (-1645.979) (-1645.386) (-1648.281) [-1644.226] * (-1643.111) [-1645.747] (-1645.118) (-1646.629) -- 0:00:38 404500 -- (-1646.336) [-1643.219] (-1646.203) (-1644.251) * (-1643.925) (-1644.334) (-1644.634) [-1649.341] -- 0:00:38 405000 -- (-1645.495) [-1645.767] (-1645.926) (-1648.734) * (-1643.166) (-1645.970) [-1644.627] (-1644.791) -- 0:00:38 Average standard deviation of split frequencies: 0.013861 405500 -- [-1643.906] (-1648.702) (-1644.259) (-1649.654) * (-1643.408) [-1643.096] (-1644.849) (-1644.832) -- 0:00:38 406000 -- (-1644.047) (-1645.477) [-1647.571] (-1648.844) * [-1643.749] (-1643.129) (-1644.189) (-1643.137) -- 0:00:38 406500 -- (-1643.033) (-1646.274) [-1645.099] (-1646.367) * (-1643.618) [-1642.910] (-1644.660) (-1643.130) -- 0:00:37 407000 -- [-1644.080] (-1647.859) (-1650.992) (-1644.803) * [-1644.067] (-1643.121) (-1645.231) (-1649.265) -- 0:00:39 407500 -- (-1643.548) (-1643.754) (-1644.556) [-1644.893] * (-1644.602) [-1643.768] (-1647.077) (-1644.186) -- 0:00:39 408000 -- (-1645.611) [-1645.548] (-1644.689) (-1645.348) * (-1645.372) (-1643.768) [-1646.105] (-1643.455) -- 0:00:39 408500 -- (-1643.738) (-1647.026) [-1646.625] (-1644.842) * (-1645.286) [-1644.460] (-1648.625) (-1645.592) -- 0:00:39 409000 -- (-1643.726) [-1644.401] (-1647.415) (-1644.575) * [-1645.404] (-1645.801) (-1650.272) (-1644.214) -- 0:00:39 409500 -- [-1643.152] (-1644.072) (-1646.195) (-1648.472) * (-1644.951) [-1645.513] (-1646.131) (-1643.907) -- 0:00:38 410000 -- (-1643.201) (-1643.971) (-1647.054) [-1644.501] * (-1645.473) [-1643.912] (-1647.222) (-1647.015) -- 0:00:38 Average standard deviation of split frequencies: 0.012986 410500 -- (-1644.339) [-1642.960] (-1643.851) (-1645.613) * [-1645.739] (-1644.274) (-1644.754) (-1643.450) -- 0:00:38 411000 -- (-1646.398) (-1643.237) [-1642.874] (-1644.828) * (-1643.818) (-1645.481) (-1644.411) [-1644.745] -- 0:00:38 411500 -- (-1644.765) [-1643.825] (-1645.271) (-1645.694) * (-1645.210) (-1644.194) [-1647.266] (-1645.555) -- 0:00:38 412000 -- (-1645.878) (-1643.283) [-1644.675] (-1645.952) * [-1645.028] (-1643.798) (-1644.046) (-1646.027) -- 0:00:38 412500 -- (-1645.848) (-1645.150) [-1644.102] (-1644.329) * (-1644.628) (-1649.528) [-1643.448] (-1646.046) -- 0:00:38 413000 -- (-1646.887) (-1645.731) [-1643.284] (-1645.824) * (-1647.306) [-1645.656] (-1650.551) (-1648.339) -- 0:00:38 413500 -- (-1644.242) (-1645.909) (-1645.485) [-1645.608] * (-1647.015) (-1646.848) [-1642.893] (-1646.403) -- 0:00:38 414000 -- (-1644.565) [-1645.344] (-1646.435) (-1643.969) * (-1646.244) (-1644.065) (-1643.471) [-1649.054] -- 0:00:38 414500 -- (-1645.719) (-1645.840) (-1646.107) [-1643.986] * (-1646.957) (-1645.750) (-1643.758) [-1647.109] -- 0:00:38 415000 -- (-1644.266) [-1648.965] (-1648.758) (-1644.107) * (-1644.916) (-1644.387) [-1644.883] (-1646.596) -- 0:00:38 Average standard deviation of split frequencies: 0.014094 415500 -- (-1644.097) [-1646.600] (-1649.379) (-1646.383) * (-1643.824) [-1645.697] (-1644.041) (-1646.111) -- 0:00:37 416000 -- (-1644.600) (-1646.412) [-1649.107] (-1646.453) * (-1644.073) (-1646.574) [-1644.991] (-1646.464) -- 0:00:37 416500 -- (-1643.601) (-1644.153) (-1646.136) [-1646.406] * (-1644.403) [-1645.991] (-1645.322) (-1646.841) -- 0:00:37 417000 -- (-1644.687) (-1643.469) [-1644.481] (-1648.746) * (-1645.308) [-1644.915] (-1643.427) (-1645.452) -- 0:00:37 417500 -- (-1648.106) (-1646.122) [-1643.409] (-1644.422) * [-1645.536] (-1644.969) (-1643.596) (-1644.294) -- 0:00:37 418000 -- (-1646.710) (-1644.568) (-1649.140) [-1645.180] * (-1646.115) (-1644.961) [-1646.089] (-1645.913) -- 0:00:37 418500 -- (-1647.495) (-1647.833) (-1644.559) [-1650.371] * (-1644.911) (-1645.190) [-1647.050] (-1643.786) -- 0:00:37 419000 -- (-1645.132) (-1647.949) (-1644.670) [-1646.812] * (-1645.580) (-1645.402) [-1648.252] (-1645.682) -- 0:00:37 419500 -- (-1644.862) (-1644.407) (-1643.989) [-1646.844] * (-1645.910) (-1646.185) (-1648.148) [-1644.734] -- 0:00:37 420000 -- [-1645.412] (-1643.785) (-1646.618) (-1645.100) * (-1643.224) (-1644.147) [-1643.160] (-1650.017) -- 0:00:37 Average standard deviation of split frequencies: 0.013728 420500 -- (-1645.226) [-1647.306] (-1651.950) (-1643.178) * (-1646.487) (-1644.269) (-1643.184) [-1648.130] -- 0:00:37 421000 -- (-1645.099) [-1646.470] (-1648.112) (-1643.349) * [-1650.814] (-1646.243) (-1643.985) (-1643.167) -- 0:00:37 421500 -- (-1646.054) (-1647.522) (-1647.558) [-1643.695] * (-1649.146) (-1645.572) (-1644.162) [-1646.179] -- 0:00:37 422000 -- (-1645.657) (-1648.182) (-1644.775) [-1644.252] * (-1646.634) (-1645.562) [-1645.496] (-1643.998) -- 0:00:38 422500 -- (-1645.380) (-1647.597) [-1645.287] (-1644.612) * (-1646.544) (-1647.525) [-1648.471] (-1643.950) -- 0:00:38 423000 -- (-1644.294) (-1644.621) (-1646.769) [-1643.855] * (-1646.130) [-1645.594] (-1644.877) (-1644.301) -- 0:00:38 423500 -- (-1645.043) (-1646.192) (-1645.684) [-1643.855] * (-1649.617) (-1644.083) [-1645.519] (-1646.266) -- 0:00:38 424000 -- (-1645.951) (-1647.666) [-1645.873] (-1648.469) * (-1649.715) [-1643.508] (-1644.693) (-1643.382) -- 0:00:38 424500 -- [-1648.079] (-1643.965) (-1648.913) (-1645.918) * [-1642.987] (-1643.359) (-1645.880) (-1644.245) -- 0:00:37 425000 -- (-1643.419) [-1643.349] (-1643.518) (-1645.452) * [-1645.510] (-1646.624) (-1644.666) (-1647.500) -- 0:00:37 Average standard deviation of split frequencies: 0.014386 425500 -- [-1644.058] (-1645.218) (-1644.611) (-1650.675) * (-1648.424) [-1643.580] (-1645.661) (-1650.148) -- 0:00:37 426000 -- (-1645.401) [-1645.880] (-1646.306) (-1646.902) * (-1646.152) (-1643.635) [-1644.151] (-1647.730) -- 0:00:37 426500 -- (-1643.427) [-1644.286] (-1643.101) (-1645.107) * (-1647.407) (-1643.495) [-1644.959] (-1645.878) -- 0:00:37 427000 -- (-1643.027) [-1644.014] (-1643.015) (-1646.562) * (-1644.806) [-1648.438] (-1647.768) (-1644.647) -- 0:00:37 427500 -- (-1642.967) (-1645.985) [-1646.691] (-1646.499) * (-1646.500) (-1649.776) (-1646.832) [-1645.585] -- 0:00:37 428000 -- (-1643.308) (-1644.414) [-1644.664] (-1647.772) * (-1645.275) (-1649.237) (-1646.141) [-1644.177] -- 0:00:37 428500 -- (-1643.849) [-1644.784] (-1646.863) (-1645.237) * (-1645.037) (-1647.479) (-1648.035) [-1645.169] -- 0:00:37 429000 -- [-1644.139] (-1648.368) (-1644.074) (-1644.607) * [-1645.290] (-1644.588) (-1645.428) (-1644.649) -- 0:00:37 429500 -- (-1644.275) [-1645.634] (-1644.625) (-1644.810) * (-1648.011) [-1644.305] (-1645.736) (-1645.233) -- 0:00:37 430000 -- (-1644.716) [-1643.518] (-1645.559) (-1644.696) * (-1646.676) (-1646.184) [-1643.903] (-1647.607) -- 0:00:37 Average standard deviation of split frequencies: 0.013682 430500 -- (-1647.203) (-1644.891) [-1646.223] (-1646.709) * (-1646.663) (-1645.090) (-1643.775) [-1644.809] -- 0:00:37 431000 -- (-1647.528) (-1646.916) [-1647.608] (-1646.430) * (-1648.310) [-1645.614] (-1644.294) (-1643.677) -- 0:00:36 431500 -- (-1652.016) (-1645.982) (-1646.498) [-1643.791] * [-1644.424] (-1648.031) (-1646.026) (-1643.177) -- 0:00:36 432000 -- (-1646.832) (-1647.464) [-1643.575] (-1644.307) * (-1646.626) (-1646.828) [-1644.234] (-1643.150) -- 0:00:36 432500 -- (-1646.370) (-1645.923) [-1647.860] (-1645.850) * (-1648.246) (-1647.691) (-1643.512) [-1644.956] -- 0:00:36 433000 -- (-1645.666) [-1644.032] (-1650.126) (-1643.655) * (-1647.649) (-1645.745) (-1643.087) [-1644.988] -- 0:00:36 433500 -- (-1644.464) (-1649.757) (-1646.594) [-1646.017] * (-1645.877) (-1647.573) [-1643.153] (-1645.913) -- 0:00:36 434000 -- (-1646.864) [-1650.738] (-1644.449) (-1643.637) * (-1646.051) (-1643.720) [-1645.488] (-1646.199) -- 0:00:36 434500 -- (-1644.990) [-1646.502] (-1646.111) (-1643.571) * (-1647.410) [-1645.418] (-1644.011) (-1646.499) -- 0:00:36 435000 -- [-1643.480] (-1645.702) (-1645.955) (-1644.374) * (-1647.579) (-1646.974) (-1645.339) [-1644.016] -- 0:00:36 Average standard deviation of split frequencies: 0.013785 435500 -- (-1650.990) [-1644.255] (-1642.848) (-1643.768) * (-1644.540) (-1643.566) (-1644.496) [-1644.768] -- 0:00:36 436000 -- (-1642.975) [-1646.179] (-1646.599) (-1644.760) * (-1649.656) (-1645.573) (-1646.534) [-1644.631] -- 0:00:36 436500 -- (-1644.473) (-1647.330) [-1645.613] (-1647.080) * (-1645.341) (-1643.607) (-1644.879) [-1644.902] -- 0:00:36 437000 -- (-1644.035) (-1643.502) (-1653.012) [-1645.737] * [-1647.534] (-1642.993) (-1645.446) (-1644.021) -- 0:00:36 437500 -- [-1647.439] (-1643.253) (-1647.173) (-1646.004) * [-1646.880] (-1643.072) (-1645.774) (-1643.178) -- 0:00:37 438000 -- (-1646.222) (-1644.753) (-1644.621) [-1647.650] * (-1644.302) (-1644.988) [-1646.045] (-1647.644) -- 0:00:37 438500 -- [-1644.640] (-1650.155) (-1645.245) (-1646.002) * (-1646.548) (-1647.180) (-1645.667) [-1647.768] -- 0:00:37 439000 -- [-1646.361] (-1646.209) (-1645.312) (-1646.098) * (-1647.577) [-1647.440] (-1647.360) (-1644.878) -- 0:00:37 439500 -- (-1647.927) [-1644.231] (-1643.120) (-1647.362) * (-1646.202) (-1646.257) (-1650.047) [-1645.824] -- 0:00:36 440000 -- [-1644.667] (-1644.778) (-1645.144) (-1645.225) * (-1645.570) [-1643.560] (-1649.544) (-1646.841) -- 0:00:36 Average standard deviation of split frequencies: 0.014107 440500 -- [-1644.248] (-1645.274) (-1646.731) (-1648.622) * [-1644.080] (-1644.639) (-1648.611) (-1649.236) -- 0:00:36 441000 -- (-1647.849) (-1645.984) [-1643.840] (-1645.707) * (-1644.272) (-1648.121) (-1648.980) [-1646.284] -- 0:00:36 441500 -- (-1649.042) (-1647.255) [-1646.484] (-1644.485) * (-1644.467) (-1651.941) (-1645.531) [-1648.850] -- 0:00:36 442000 -- [-1645.651] (-1645.892) (-1643.637) (-1645.936) * [-1644.620] (-1648.224) (-1646.644) (-1646.576) -- 0:00:36 442500 -- (-1646.430) (-1648.505) (-1646.497) [-1643.487] * (-1646.942) (-1646.109) (-1645.860) [-1645.498] -- 0:00:36 443000 -- (-1646.494) [-1643.868] (-1643.683) (-1644.323) * (-1646.845) (-1647.910) (-1647.173) [-1648.362] -- 0:00:36 443500 -- (-1645.396) (-1646.679) [-1643.677] (-1644.269) * [-1645.147] (-1647.858) (-1644.791) (-1645.293) -- 0:00:36 444000 -- (-1644.371) (-1646.420) (-1643.923) [-1644.849] * (-1644.474) (-1646.602) (-1645.893) [-1647.381] -- 0:00:36 444500 -- (-1645.410) (-1647.811) (-1643.339) [-1643.055] * (-1644.464) [-1644.612] (-1644.729) (-1646.429) -- 0:00:36 445000 -- (-1644.448) (-1646.917) (-1644.813) [-1645.113] * (-1645.720) [-1645.279] (-1645.330) (-1645.558) -- 0:00:36 Average standard deviation of split frequencies: 0.013807 445500 -- (-1644.620) (-1644.916) (-1644.086) [-1644.966] * [-1644.320] (-1644.953) (-1644.403) (-1644.263) -- 0:00:36 446000 -- (-1646.204) (-1646.065) (-1644.616) [-1646.180] * (-1644.206) (-1643.587) (-1646.289) [-1643.924] -- 0:00:36 446500 -- (-1646.797) [-1644.789] (-1645.892) (-1647.129) * (-1643.173) (-1643.956) (-1646.251) [-1645.838] -- 0:00:35 447000 -- (-1647.225) [-1644.474] (-1646.109) (-1648.239) * (-1647.609) [-1644.341] (-1644.296) (-1643.704) -- 0:00:35 447500 -- (-1646.990) (-1645.123) (-1647.736) [-1646.052] * [-1644.991] (-1643.611) (-1645.293) (-1646.398) -- 0:00:35 448000 -- (-1646.405) [-1645.823] (-1645.983) (-1646.760) * (-1645.796) [-1646.238] (-1647.889) (-1644.908) -- 0:00:35 448500 -- (-1643.504) [-1646.908] (-1644.697) (-1646.706) * [-1643.488] (-1644.343) (-1646.072) (-1644.738) -- 0:00:35 449000 -- (-1645.214) (-1645.910) [-1645.435] (-1643.705) * [-1644.806] (-1643.751) (-1645.981) (-1646.031) -- 0:00:35 449500 -- (-1644.624) [-1649.352] (-1645.649) (-1644.361) * (-1644.820) (-1644.705) (-1644.784) [-1645.003] -- 0:00:35 450000 -- [-1645.033] (-1647.057) (-1644.686) (-1643.311) * [-1643.837] (-1645.608) (-1644.568) (-1646.225) -- 0:00:35 Average standard deviation of split frequencies: 0.014121 450500 -- (-1645.394) (-1647.962) [-1644.845] (-1643.315) * (-1643.467) [-1644.463] (-1645.912) (-1644.521) -- 0:00:35 451000 -- (-1646.858) (-1647.017) [-1645.374] (-1645.410) * (-1643.352) (-1644.179) (-1643.538) [-1646.946] -- 0:00:35 451500 -- (-1648.110) (-1647.505) [-1643.353] (-1645.287) * [-1643.893] (-1644.988) (-1643.568) (-1645.832) -- 0:00:35 452000 -- [-1645.013] (-1647.149) (-1642.919) (-1648.134) * [-1644.968] (-1647.252) (-1643.107) (-1644.882) -- 0:00:35 452500 -- (-1644.328) [-1645.386] (-1648.442) (-1644.753) * (-1647.472) (-1646.964) (-1644.041) [-1644.340] -- 0:00:36 453000 -- (-1645.017) (-1646.396) (-1644.239) [-1646.536] * (-1645.493) (-1651.139) [-1643.260] (-1644.360) -- 0:00:36 453500 -- [-1644.835] (-1645.773) (-1644.858) (-1644.181) * (-1643.622) [-1644.592] (-1647.678) (-1644.619) -- 0:00:36 454000 -- [-1645.066] (-1646.210) (-1646.692) (-1645.600) * [-1644.186] (-1647.131) (-1643.268) (-1644.999) -- 0:00:36 454500 -- (-1643.050) (-1647.866) (-1648.732) [-1645.102] * (-1645.453) (-1645.612) (-1646.803) [-1645.367] -- 0:00:36 455000 -- [-1644.776] (-1647.825) (-1648.344) (-1647.177) * (-1647.034) (-1645.223) [-1646.414] (-1645.165) -- 0:00:35 Average standard deviation of split frequencies: 0.014215 455500 -- (-1645.922) (-1644.990) [-1644.394] (-1645.741) * (-1647.548) (-1648.979) [-1643.530] (-1644.543) -- 0:00:35 456000 -- (-1645.796) (-1645.222) (-1645.219) [-1647.309] * (-1645.172) (-1646.876) [-1643.543] (-1645.794) -- 0:00:35 456500 -- (-1646.354) (-1648.604) [-1648.590] (-1646.183) * (-1645.340) (-1649.160) [-1643.573] (-1646.250) -- 0:00:35 457000 -- [-1644.773] (-1644.814) (-1646.551) (-1645.686) * [-1643.522] (-1644.932) (-1644.214) (-1645.682) -- 0:00:35 457500 -- (-1647.313) (-1645.842) (-1648.838) [-1646.994] * (-1646.910) (-1645.139) (-1644.240) [-1646.303] -- 0:00:35 458000 -- (-1645.742) [-1644.025] (-1645.091) (-1653.152) * (-1645.573) [-1644.259] (-1644.204) (-1644.470) -- 0:00:35 458500 -- (-1646.466) [-1645.279] (-1644.506) (-1644.963) * (-1644.803) [-1646.922] (-1644.014) (-1644.405) -- 0:00:35 459000 -- [-1646.658] (-1647.229) (-1645.785) (-1643.838) * (-1643.838) [-1644.147] (-1644.737) (-1643.550) -- 0:00:35 459500 -- (-1647.028) (-1643.194) [-1643.179] (-1645.365) * [-1644.142] (-1649.467) (-1644.425) (-1644.693) -- 0:00:35 460000 -- [-1645.348] (-1643.979) (-1644.193) (-1644.782) * (-1643.648) (-1649.532) (-1644.997) [-1644.652] -- 0:00:35 Average standard deviation of split frequencies: 0.014582 460500 -- (-1643.102) (-1644.195) [-1644.430] (-1645.462) * [-1643.805] (-1648.469) (-1644.846) (-1649.371) -- 0:00:35 461000 -- [-1645.142] (-1643.183) (-1644.584) (-1649.454) * [-1644.026] (-1646.969) (-1644.314) (-1645.789) -- 0:00:35 461500 -- [-1643.988] (-1645.709) (-1645.501) (-1645.019) * (-1644.167) (-1647.282) [-1644.378] (-1644.371) -- 0:00:35 462000 -- (-1646.455) [-1643.515] (-1645.327) (-1644.935) * (-1644.071) (-1648.104) (-1643.978) [-1645.519] -- 0:00:34 462500 -- (-1646.223) (-1643.097) (-1646.133) [-1644.033] * [-1644.930] (-1646.359) (-1645.055) (-1645.165) -- 0:00:34 463000 -- (-1646.762) (-1643.624) (-1648.236) [-1643.638] * (-1645.229) (-1646.770) (-1645.024) [-1644.503] -- 0:00:34 463500 -- [-1645.137] (-1646.097) (-1646.113) (-1643.638) * (-1650.883) [-1646.578] (-1646.542) (-1643.429) -- 0:00:34 464000 -- (-1644.979) (-1646.071) (-1647.096) [-1644.762] * [-1643.878] (-1646.688) (-1646.227) (-1643.910) -- 0:00:34 464500 -- (-1646.297) [-1643.230] (-1643.580) (-1648.063) * [-1644.717] (-1647.179) (-1643.344) (-1646.845) -- 0:00:34 465000 -- (-1649.341) [-1643.532] (-1644.109) (-1649.558) * (-1645.255) (-1647.630) [-1643.582] (-1645.617) -- 0:00:34 Average standard deviation of split frequencies: 0.014352 465500 -- (-1644.712) (-1644.882) [-1643.237] (-1648.956) * (-1644.625) (-1644.899) [-1645.437] (-1647.030) -- 0:00:34 466000 -- (-1646.499) (-1644.594) [-1643.884] (-1644.506) * (-1649.464) [-1645.137] (-1646.324) (-1643.681) -- 0:00:34 466500 -- (-1644.542) [-1644.900] (-1643.110) (-1644.751) * (-1648.291) (-1646.975) (-1647.678) [-1644.129] -- 0:00:34 467000 -- (-1648.291) (-1645.034) [-1642.851] (-1643.217) * (-1644.655) (-1646.870) (-1644.255) [-1644.705] -- 0:00:34 467500 -- (-1646.052) (-1648.202) [-1644.129] (-1643.268) * [-1644.418] (-1648.131) (-1645.437) (-1646.109) -- 0:00:35 468000 -- (-1649.035) [-1647.788] (-1642.894) (-1644.992) * (-1645.190) [-1644.583] (-1645.446) (-1643.854) -- 0:00:35 468500 -- (-1648.192) (-1646.575) (-1643.986) [-1644.102] * (-1644.160) (-1643.663) (-1645.486) [-1645.237] -- 0:00:35 469000 -- (-1648.591) [-1644.694] (-1644.248) (-1645.775) * (-1643.634) (-1644.727) [-1645.204] (-1643.847) -- 0:00:35 469500 -- (-1649.226) (-1644.213) (-1644.320) [-1647.900] * [-1645.406] (-1647.201) (-1645.314) (-1643.942) -- 0:00:35 470000 -- (-1646.227) (-1646.665) (-1644.060) [-1645.835] * (-1646.624) (-1643.508) (-1644.558) [-1644.100] -- 0:00:34 Average standard deviation of split frequencies: 0.014272 470500 -- (-1645.899) (-1646.264) [-1649.066] (-1643.446) * (-1647.286) (-1653.078) [-1644.560] (-1645.576) -- 0:00:34 471000 -- (-1647.328) [-1646.699] (-1647.078) (-1644.178) * (-1643.760) (-1649.389) [-1645.480] (-1643.670) -- 0:00:34 471500 -- (-1643.143) (-1647.039) (-1646.066) [-1645.223] * (-1643.413) (-1643.313) (-1646.144) [-1644.442] -- 0:00:34 472000 -- (-1645.080) (-1644.993) (-1646.657) [-1647.274] * (-1644.967) (-1642.984) [-1645.141] (-1649.111) -- 0:00:34 472500 -- (-1644.871) [-1643.937] (-1644.289) (-1646.548) * (-1644.658) [-1644.725] (-1644.042) (-1648.060) -- 0:00:34 473000 -- (-1645.870) (-1647.557) [-1644.025] (-1644.204) * (-1646.115) [-1643.956] (-1644.608) (-1643.584) -- 0:00:34 473500 -- (-1645.103) (-1644.453) (-1643.745) [-1647.041] * (-1644.352) [-1644.228] (-1645.419) (-1650.384) -- 0:00:34 474000 -- (-1644.545) (-1644.734) [-1643.496] (-1645.945) * (-1645.280) (-1645.199) (-1644.617) [-1643.658] -- 0:00:34 474500 -- [-1643.811] (-1644.525) (-1643.464) (-1645.932) * (-1647.217) (-1643.249) (-1645.239) [-1645.795] -- 0:00:34 475000 -- [-1646.011] (-1645.148) (-1644.096) (-1649.474) * (-1647.243) [-1646.069] (-1647.478) (-1647.776) -- 0:00:34 Average standard deviation of split frequencies: 0.013927 475500 -- [-1647.010] (-1647.350) (-1646.022) (-1645.615) * [-1644.830] (-1645.683) (-1648.491) (-1645.538) -- 0:00:34 476000 -- (-1643.937) (-1644.177) [-1643.090] (-1646.021) * (-1644.733) (-1646.545) [-1645.866] (-1645.797) -- 0:00:34 476500 -- (-1643.510) [-1644.596] (-1644.230) (-1645.982) * (-1645.580) [-1646.911] (-1645.454) (-1644.382) -- 0:00:34 477000 -- (-1643.575) (-1647.919) (-1643.698) [-1645.386] * [-1644.342] (-1645.607) (-1646.741) (-1643.806) -- 0:00:33 477500 -- (-1644.143) (-1648.749) (-1643.793) [-1646.316] * (-1643.895) [-1644.378] (-1647.372) (-1643.620) -- 0:00:33 478000 -- [-1644.978] (-1646.969) (-1642.968) (-1647.583) * [-1644.882] (-1643.840) (-1647.434) (-1644.929) -- 0:00:33 478500 -- (-1644.373) (-1644.259) (-1643.283) [-1646.823] * (-1644.010) [-1643.917] (-1645.367) (-1646.739) -- 0:00:33 479000 -- (-1651.400) [-1645.425] (-1643.610) (-1652.496) * (-1645.367) (-1647.352) [-1645.416] (-1649.131) -- 0:00:33 479500 -- [-1646.171] (-1645.857) (-1643.510) (-1645.026) * (-1654.645) (-1645.235) [-1644.536] (-1646.793) -- 0:00:33 480000 -- (-1643.592) (-1644.111) [-1643.515] (-1651.221) * (-1643.107) [-1644.679] (-1643.929) (-1646.786) -- 0:00:33 Average standard deviation of split frequencies: 0.013485 480500 -- [-1644.744] (-1645.451) (-1644.348) (-1652.058) * (-1645.677) (-1645.347) [-1643.511] (-1646.992) -- 0:00:33 481000 -- (-1644.034) (-1643.193) [-1644.512] (-1646.798) * [-1649.912] (-1645.602) (-1644.344) (-1643.631) -- 0:00:33 481500 -- (-1647.118) (-1643.612) (-1649.255) [-1645.385] * (-1646.100) [-1643.550] (-1644.013) (-1646.214) -- 0:00:33 482000 -- [-1643.726] (-1644.160) (-1646.136) (-1643.256) * (-1644.800) [-1644.018] (-1647.375) (-1646.719) -- 0:00:33 482500 -- (-1643.931) (-1644.159) [-1648.503] (-1643.166) * (-1645.999) (-1644.293) (-1644.965) [-1646.088] -- 0:00:34 483000 -- [-1644.083] (-1644.726) (-1649.162) (-1643.041) * [-1647.531] (-1644.079) (-1643.736) (-1645.451) -- 0:00:34 483500 -- [-1644.247] (-1645.831) (-1645.876) (-1644.608) * [-1643.304] (-1644.887) (-1644.021) (-1643.743) -- 0:00:34 484000 -- (-1647.166) (-1643.500) [-1646.209] (-1648.889) * [-1643.184] (-1644.214) (-1643.887) (-1643.748) -- 0:00:34 484500 -- (-1649.401) (-1647.308) (-1645.074) [-1644.259] * [-1643.201] (-1645.037) (-1645.919) (-1643.704) -- 0:00:34 485000 -- (-1648.335) (-1644.876) (-1646.364) [-1644.126] * (-1643.585) (-1648.310) (-1645.860) [-1643.643] -- 0:00:33 Average standard deviation of split frequencies: 0.013276 485500 -- (-1646.084) (-1644.533) (-1646.216) [-1644.124] * (-1643.550) (-1647.028) [-1644.814] (-1643.699) -- 0:00:33 486000 -- (-1645.663) (-1646.441) (-1644.479) [-1645.219] * (-1644.168) [-1650.077] (-1644.057) (-1643.704) -- 0:00:33 486500 -- (-1645.063) [-1643.796] (-1646.242) (-1645.523) * (-1644.540) (-1645.735) [-1643.679] (-1645.460) -- 0:00:33 487000 -- (-1646.797) (-1644.649) [-1644.706] (-1643.756) * [-1644.756] (-1644.519) (-1646.748) (-1651.456) -- 0:00:33 487500 -- [-1645.175] (-1645.134) (-1644.049) (-1646.166) * (-1644.717) [-1645.104] (-1648.375) (-1643.180) -- 0:00:33 488000 -- (-1645.920) (-1647.141) [-1643.260] (-1643.878) * (-1644.016) (-1645.390) [-1644.474] (-1643.042) -- 0:00:33 488500 -- (-1645.974) (-1649.629) [-1646.356] (-1646.631) * (-1643.324) (-1645.649) [-1644.826] (-1643.140) -- 0:00:33 489000 -- (-1646.052) (-1648.455) (-1646.686) [-1643.855] * (-1645.477) (-1647.486) [-1646.072] (-1643.687) -- 0:00:33 489500 -- (-1647.242) [-1645.863] (-1646.811) (-1643.950) * (-1645.422) (-1646.952) [-1644.617] (-1647.359) -- 0:00:33 490000 -- (-1646.090) (-1644.684) [-1644.797] (-1644.484) * (-1643.644) (-1644.630) (-1644.471) [-1646.758] -- 0:00:33 Average standard deviation of split frequencies: 0.012550 490500 -- (-1643.854) (-1645.326) [-1643.157] (-1644.319) * [-1643.447] (-1647.653) (-1644.867) (-1646.013) -- 0:00:33 491000 -- (-1644.930) (-1648.628) [-1643.092] (-1644.864) * (-1643.563) (-1644.325) [-1643.736] (-1648.454) -- 0:00:33 491500 -- (-1647.868) (-1648.884) (-1644.366) [-1645.152] * (-1643.093) [-1645.314] (-1643.510) (-1648.786) -- 0:00:33 492000 -- [-1645.087] (-1645.937) (-1645.967) (-1644.872) * [-1645.607] (-1645.288) (-1643.452) (-1643.858) -- 0:00:33 492500 -- (-1650.727) (-1643.328) [-1646.364] (-1644.019) * [-1645.560] (-1645.379) (-1643.556) (-1643.642) -- 0:00:32 493000 -- (-1645.181) (-1646.042) [-1646.413] (-1643.291) * (-1645.858) (-1648.179) [-1643.202] (-1643.929) -- 0:00:32 493500 -- (-1645.900) (-1644.287) (-1644.102) [-1644.420] * [-1643.854] (-1645.002) (-1646.572) (-1644.291) -- 0:00:32 494000 -- (-1644.934) [-1644.894] (-1646.432) (-1645.022) * (-1647.341) (-1647.810) (-1644.735) [-1645.518] -- 0:00:32 494500 -- [-1646.243] (-1649.658) (-1643.906) (-1647.152) * (-1651.000) (-1646.101) (-1646.768) [-1643.128] -- 0:00:32 495000 -- (-1646.286) (-1646.521) [-1644.273] (-1645.499) * (-1644.295) [-1647.374] (-1648.396) (-1644.138) -- 0:00:32 Average standard deviation of split frequencies: 0.012058 495500 -- (-1646.683) (-1645.978) (-1648.566) [-1645.451] * (-1648.250) (-1644.427) (-1645.585) [-1643.728] -- 0:00:32 496000 -- [-1644.538] (-1646.313) (-1649.912) (-1646.711) * (-1648.186) (-1644.234) [-1644.320] (-1646.628) -- 0:00:32 496500 -- (-1645.518) [-1645.212] (-1643.947) (-1644.126) * (-1643.850) (-1646.916) (-1646.833) [-1644.136] -- 0:00:32 497000 -- [-1646.010] (-1644.779) (-1644.571) (-1643.779) * (-1645.162) (-1645.838) (-1649.233) [-1646.671] -- 0:00:32 497500 -- [-1645.267] (-1644.919) (-1645.333) (-1645.429) * [-1644.027] (-1645.183) (-1645.185) (-1645.750) -- 0:00:32 498000 -- (-1643.034) (-1645.384) (-1645.056) [-1643.381] * (-1644.082) (-1644.825) [-1645.190] (-1646.529) -- 0:00:33 498500 -- (-1645.409) [-1647.089] (-1645.781) (-1646.126) * [-1643.819] (-1643.636) (-1644.937) (-1644.747) -- 0:00:33 499000 -- (-1649.054) [-1646.005] (-1644.046) (-1643.325) * (-1647.196) (-1643.834) [-1644.269] (-1644.724) -- 0:00:33 499500 -- (-1645.053) (-1644.096) [-1647.516] (-1645.467) * (-1647.494) (-1643.772) [-1650.916] (-1644.301) -- 0:00:33 500000 -- [-1643.516] (-1644.206) (-1645.440) (-1645.362) * (-1649.046) (-1647.240) (-1644.753) [-1643.998] -- 0:00:33 Average standard deviation of split frequencies: 0.012593 500500 -- (-1643.460) [-1648.349] (-1648.811) (-1647.105) * (-1645.323) (-1644.601) (-1648.480) [-1644.858] -- 0:00:32 501000 -- (-1644.575) (-1647.422) [-1644.607] (-1643.419) * (-1643.267) (-1645.161) (-1643.722) [-1644.330] -- 0:00:32 501500 -- [-1644.451] (-1643.938) (-1644.687) (-1643.430) * (-1643.324) (-1643.468) (-1645.987) [-1643.123] -- 0:00:32 502000 -- (-1643.166) [-1644.988] (-1645.950) (-1643.770) * [-1645.352] (-1643.542) (-1647.339) (-1643.618) -- 0:00:32 502500 -- (-1643.166) (-1646.692) (-1645.230) [-1645.099] * (-1644.790) [-1643.522] (-1647.339) (-1643.199) -- 0:00:32 503000 -- (-1645.736) (-1644.132) [-1643.370] (-1646.232) * [-1644.522] (-1643.809) (-1645.563) (-1643.199) -- 0:00:32 503500 -- (-1645.190) [-1645.278] (-1646.225) (-1650.785) * (-1644.556) (-1643.882) (-1645.491) [-1643.168] -- 0:00:32 504000 -- (-1645.655) (-1644.891) [-1645.951] (-1649.100) * (-1644.238) (-1645.089) [-1645.405] (-1643.118) -- 0:00:32 504500 -- (-1646.066) (-1644.767) (-1644.107) [-1646.657] * [-1643.397] (-1644.661) (-1645.340) (-1644.928) -- 0:00:32 505000 -- [-1648.201] (-1645.054) (-1646.754) (-1643.313) * [-1644.516] (-1645.362) (-1646.008) (-1645.199) -- 0:00:32 Average standard deviation of split frequencies: 0.013276 505500 -- (-1648.679) [-1648.096] (-1644.187) (-1643.431) * [-1646.071] (-1645.521) (-1647.215) (-1644.897) -- 0:00:32 506000 -- (-1643.826) (-1644.783) [-1643.751] (-1646.317) * (-1646.169) [-1645.022] (-1644.533) (-1644.903) -- 0:00:32 506500 -- [-1644.600] (-1645.014) (-1644.120) (-1646.673) * (-1646.636) (-1646.984) (-1647.571) [-1644.623] -- 0:00:32 507000 -- (-1646.330) (-1643.102) [-1645.188] (-1645.962) * (-1645.611) (-1643.801) [-1645.679] (-1649.783) -- 0:00:32 507500 -- [-1644.125] (-1643.570) (-1643.873) (-1643.997) * [-1644.562] (-1643.121) (-1645.689) (-1645.929) -- 0:00:32 508000 -- [-1643.782] (-1643.477) (-1649.014) (-1642.821) * [-1644.545] (-1645.411) (-1649.729) (-1644.958) -- 0:00:31 508500 -- (-1644.806) [-1643.788] (-1645.425) (-1645.763) * (-1646.021) (-1647.009) [-1645.164] (-1646.448) -- 0:00:31 509000 -- (-1644.760) (-1643.866) [-1643.807] (-1644.951) * (-1645.577) (-1647.020) (-1644.819) [-1644.791] -- 0:00:31 509500 -- (-1644.657) (-1643.399) [-1644.287] (-1644.832) * (-1646.729) (-1643.638) (-1643.720) [-1645.018] -- 0:00:31 510000 -- (-1644.376) (-1645.634) (-1644.287) [-1646.471] * [-1644.992] (-1643.823) (-1645.231) (-1643.955) -- 0:00:31 Average standard deviation of split frequencies: 0.013154 510500 -- (-1647.997) (-1648.328) [-1643.912] (-1645.554) * (-1645.407) (-1643.906) (-1644.547) [-1644.166] -- 0:00:31 511000 -- [-1644.774] (-1645.830) (-1643.975) (-1646.178) * (-1645.988) (-1643.080) (-1645.445) [-1644.436] -- 0:00:31 511500 -- (-1644.793) (-1645.077) [-1645.881] (-1647.512) * (-1643.135) (-1645.092) (-1645.455) [-1644.575] -- 0:00:31 512000 -- (-1645.645) [-1645.201] (-1646.078) (-1650.550) * (-1645.618) (-1644.557) (-1644.446) [-1643.939] -- 0:00:31 512500 -- [-1645.973] (-1644.192) (-1644.214) (-1647.503) * (-1644.995) (-1643.839) (-1643.496) [-1643.713] -- 0:00:31 513000 -- [-1645.017] (-1645.149) (-1643.438) (-1649.337) * (-1645.812) [-1643.997] (-1644.904) (-1643.435) -- 0:00:31 513500 -- (-1645.167) (-1645.972) [-1643.409] (-1649.060) * (-1646.565) (-1643.527) (-1646.169) [-1644.887] -- 0:00:32 514000 -- (-1644.666) [-1644.081] (-1642.949) (-1645.168) * (-1646.335) (-1645.384) [-1643.865] (-1645.084) -- 0:00:32 514500 -- (-1643.792) (-1647.113) (-1643.312) [-1644.886] * (-1644.184) (-1643.684) (-1643.595) [-1645.594] -- 0:00:32 515000 -- [-1644.222] (-1647.504) (-1648.672) (-1647.588) * (-1644.128) [-1643.303] (-1644.180) (-1643.587) -- 0:00:32 Average standard deviation of split frequencies: 0.012619 515500 -- (-1643.113) (-1650.724) (-1649.025) [-1643.934] * (-1644.070) (-1644.855) [-1642.932] (-1645.216) -- 0:00:31 516000 -- [-1645.549] (-1645.991) (-1644.225) (-1646.736) * (-1647.743) [-1647.189] (-1645.678) (-1644.306) -- 0:00:31 516500 -- [-1645.544] (-1647.006) (-1645.036) (-1648.843) * [-1644.176] (-1645.909) (-1643.451) (-1645.139) -- 0:00:31 517000 -- (-1644.789) (-1648.254) (-1643.475) [-1649.246] * (-1644.293) [-1646.527] (-1645.228) (-1645.110) -- 0:00:31 517500 -- (-1644.997) [-1644.972] (-1646.588) (-1648.224) * (-1643.623) (-1643.298) (-1645.497) [-1643.491] -- 0:00:31 518000 -- (-1649.147) (-1644.864) (-1643.652) [-1644.703] * (-1644.063) (-1646.990) (-1644.042) [-1645.379] -- 0:00:31 518500 -- (-1645.696) (-1645.278) [-1645.059] (-1643.764) * (-1643.469) (-1644.750) (-1644.698) [-1644.015] -- 0:00:31 519000 -- (-1646.032) (-1646.214) [-1643.699] (-1644.688) * (-1644.537) [-1644.587] (-1644.753) (-1644.614) -- 0:00:31 519500 -- (-1644.803) (-1645.822) (-1644.595) [-1645.417] * (-1645.432) (-1645.141) [-1644.259] (-1644.229) -- 0:00:31 520000 -- (-1645.198) [-1646.323] (-1643.534) (-1644.665) * [-1645.157] (-1644.582) (-1643.435) (-1644.731) -- 0:00:31 Average standard deviation of split frequencies: 0.012449 520500 -- (-1652.291) (-1646.071) (-1643.768) [-1645.671] * (-1649.635) (-1644.133) [-1644.099] (-1648.459) -- 0:00:31 521000 -- (-1648.190) (-1651.426) (-1643.768) [-1647.496] * (-1647.582) [-1643.389] (-1652.496) (-1643.764) -- 0:00:31 521500 -- (-1644.240) (-1644.493) [-1643.452] (-1645.177) * (-1647.591) (-1646.719) (-1654.147) [-1644.631] -- 0:00:31 522000 -- [-1648.004] (-1643.762) (-1645.719) (-1646.144) * (-1644.594) [-1645.305] (-1648.199) (-1647.571) -- 0:00:31 522500 -- (-1647.950) (-1646.775) [-1644.892] (-1644.810) * (-1646.039) (-1644.762) [-1645.551] (-1644.404) -- 0:00:31 523000 -- [-1647.746] (-1645.190) (-1643.172) (-1649.375) * [-1644.223] (-1643.827) (-1645.002) (-1644.703) -- 0:00:31 523500 -- [-1649.128] (-1651.721) (-1644.610) (-1650.942) * [-1645.467] (-1645.073) (-1644.155) (-1643.019) -- 0:00:30 524000 -- [-1644.780] (-1650.141) (-1643.152) (-1648.572) * [-1644.235] (-1643.124) (-1644.159) (-1643.529) -- 0:00:30 524500 -- (-1643.190) (-1645.239) [-1643.898] (-1649.511) * (-1646.882) [-1642.755] (-1644.318) (-1643.478) -- 0:00:30 525000 -- [-1643.132] (-1647.134) (-1644.249) (-1644.879) * (-1647.694) (-1643.628) [-1644.108] (-1644.252) -- 0:00:30 Average standard deviation of split frequencies: 0.012659 525500 -- (-1643.588) [-1644.482] (-1645.734) (-1644.884) * (-1645.652) (-1643.443) (-1647.758) [-1644.467] -- 0:00:30 526000 -- (-1646.552) [-1645.659] (-1645.411) (-1645.960) * [-1645.999] (-1643.207) (-1643.759) (-1644.640) -- 0:00:30 526500 -- (-1644.938) (-1648.970) [-1646.720] (-1645.060) * (-1645.794) (-1644.822) [-1644.881] (-1645.289) -- 0:00:30 527000 -- [-1645.737] (-1646.261) (-1646.924) (-1645.952) * [-1647.115] (-1646.254) (-1645.331) (-1645.353) -- 0:00:30 527500 -- [-1644.100] (-1644.192) (-1645.055) (-1645.461) * (-1646.741) (-1647.433) [-1647.692] (-1646.131) -- 0:00:30 528000 -- (-1644.808) [-1644.491] (-1645.465) (-1647.494) * (-1647.446) (-1644.962) (-1646.740) [-1646.169] -- 0:00:30 528500 -- [-1643.493] (-1648.958) (-1645.064) (-1648.736) * (-1650.949) (-1644.656) [-1645.401] (-1644.590) -- 0:00:30 529000 -- (-1645.208) (-1644.031) (-1646.263) [-1645.529] * (-1648.483) [-1643.999] (-1645.374) (-1644.454) -- 0:00:31 529500 -- (-1643.627) (-1643.624) (-1645.096) [-1645.477] * (-1646.761) [-1646.213] (-1646.382) (-1649.060) -- 0:00:31 530000 -- (-1647.407) (-1644.283) (-1650.849) [-1643.957] * (-1644.389) (-1649.347) [-1647.336] (-1646.358) -- 0:00:31 Average standard deviation of split frequencies: 0.011992 530500 -- [-1644.624] (-1646.234) (-1643.875) (-1643.695) * (-1645.943) (-1646.219) (-1644.518) [-1645.390] -- 0:00:30 531000 -- [-1644.020] (-1645.542) (-1643.704) (-1643.656) * (-1647.591) (-1646.244) [-1645.037] (-1647.758) -- 0:00:30 531500 -- (-1644.006) [-1644.881] (-1644.920) (-1645.935) * [-1648.856] (-1643.739) (-1648.340) (-1646.584) -- 0:00:30 532000 -- [-1643.932] (-1643.486) (-1646.990) (-1644.155) * (-1650.415) (-1643.634) (-1648.359) [-1646.418] -- 0:00:30 532500 -- [-1643.763] (-1644.927) (-1644.167) (-1643.436) * (-1644.118) (-1644.207) (-1647.310) [-1643.829] -- 0:00:30 533000 -- (-1644.675) (-1646.616) [-1648.730] (-1643.462) * [-1644.925] (-1644.109) (-1645.111) (-1645.315) -- 0:00:30 533500 -- (-1645.295) [-1642.772] (-1646.846) (-1644.313) * (-1649.092) (-1643.778) [-1646.826] (-1644.112) -- 0:00:30 534000 -- [-1645.290] (-1653.328) (-1645.788) (-1646.293) * (-1648.888) [-1647.216] (-1648.041) (-1644.353) -- 0:00:30 534500 -- (-1646.662) (-1650.353) (-1644.436) [-1646.964] * (-1649.913) (-1650.500) (-1647.708) [-1644.395] -- 0:00:30 535000 -- (-1644.368) (-1646.903) [-1642.965] (-1643.483) * (-1644.462) (-1645.369) [-1644.487] (-1647.086) -- 0:00:30 Average standard deviation of split frequencies: 0.012258 535500 -- [-1644.061] (-1644.251) (-1644.011) (-1643.366) * (-1643.211) [-1645.077] (-1645.070) (-1645.477) -- 0:00:30 536000 -- (-1644.074) (-1644.272) [-1644.192] (-1643.458) * (-1646.434) (-1645.575) (-1644.742) [-1643.926] -- 0:00:30 536500 -- [-1645.012] (-1644.467) (-1645.859) (-1644.144) * (-1645.499) (-1645.303) [-1650.878] (-1643.811) -- 0:00:30 537000 -- [-1643.661] (-1645.258) (-1650.479) (-1646.827) * [-1645.153] (-1647.531) (-1648.384) (-1645.988) -- 0:00:30 537500 -- [-1644.078] (-1644.083) (-1645.730) (-1647.172) * (-1645.186) [-1645.819] (-1644.952) (-1643.507) -- 0:00:30 538000 -- (-1647.295) [-1643.605] (-1644.085) (-1645.799) * (-1643.655) (-1644.380) [-1647.224] (-1646.045) -- 0:00:30 538500 -- (-1644.076) (-1645.654) (-1647.235) [-1644.670] * (-1648.657) (-1645.324) [-1644.449] (-1644.822) -- 0:00:29 539000 -- (-1646.029) [-1644.845] (-1651.758) (-1645.472) * (-1646.011) (-1645.742) [-1645.068] (-1643.898) -- 0:00:29 539500 -- (-1647.505) (-1644.888) (-1648.148) [-1645.128] * (-1644.001) (-1648.765) (-1646.756) [-1645.635] -- 0:00:29 540000 -- (-1646.637) [-1644.105] (-1645.796) (-1643.540) * (-1645.883) [-1649.391] (-1645.361) (-1643.994) -- 0:00:29 Average standard deviation of split frequencies: 0.012098 540500 -- [-1647.624] (-1644.354) (-1643.902) (-1646.692) * (-1645.566) [-1643.964] (-1644.629) (-1644.644) -- 0:00:29 541000 -- (-1645.629) [-1651.954] (-1643.505) (-1643.642) * [-1643.522] (-1646.823) (-1643.625) (-1647.864) -- 0:00:29 541500 -- (-1646.515) (-1643.593) (-1645.733) [-1643.791] * (-1643.416) [-1643.911] (-1643.811) (-1644.915) -- 0:00:29 542000 -- (-1645.379) (-1643.749) (-1646.442) [-1643.865] * (-1643.096) (-1644.946) [-1644.750] (-1645.054) -- 0:00:29 542500 -- (-1647.811) [-1643.835] (-1646.696) (-1644.177) * (-1643.878) [-1643.152] (-1646.693) (-1646.010) -- 0:00:29 543000 -- (-1646.207) [-1646.810] (-1644.319) (-1650.835) * (-1644.156) [-1647.785] (-1645.188) (-1647.847) -- 0:00:29 543500 -- (-1646.135) [-1644.549] (-1643.713) (-1647.251) * [-1643.808] (-1643.022) (-1646.606) (-1647.407) -- 0:00:29 544000 -- (-1645.779) [-1644.620] (-1644.214) (-1643.450) * (-1645.840) [-1643.435] (-1644.363) (-1645.752) -- 0:00:29 544500 -- (-1647.153) [-1647.429] (-1647.047) (-1647.134) * (-1645.353) (-1644.198) [-1646.805] (-1645.726) -- 0:00:30 545000 -- (-1646.914) [-1649.680] (-1644.954) (-1646.580) * (-1643.285) [-1645.327] (-1644.742) (-1647.244) -- 0:00:30 Average standard deviation of split frequencies: 0.012519 545500 -- [-1643.628] (-1647.112) (-1645.759) (-1647.242) * (-1644.318) (-1644.186) (-1644.056) [-1645.973] -- 0:00:29 546000 -- (-1643.562) [-1647.848] (-1643.408) (-1644.870) * (-1645.830) (-1643.927) [-1644.099] (-1646.353) -- 0:00:29 546500 -- (-1643.667) (-1646.456) (-1643.572) [-1644.560] * (-1644.848) (-1644.289) [-1644.927] (-1646.614) -- 0:00:29 547000 -- (-1646.675) [-1645.757] (-1645.341) (-1643.574) * (-1643.580) (-1647.601) [-1644.160] (-1643.630) -- 0:00:29 547500 -- (-1647.304) (-1650.397) (-1648.359) [-1643.469] * (-1643.653) (-1648.982) [-1645.669] (-1644.264) -- 0:00:29 548000 -- (-1647.541) (-1650.382) (-1643.023) [-1643.554] * (-1643.775) [-1646.566] (-1645.477) (-1644.095) -- 0:00:29 548500 -- [-1646.646] (-1644.390) (-1645.349) (-1643.589) * (-1644.252) [-1643.935] (-1643.807) (-1647.338) -- 0:00:29 549000 -- (-1645.438) (-1644.021) [-1644.906] (-1643.448) * [-1646.474] (-1645.561) (-1643.729) (-1644.437) -- 0:00:29 549500 -- (-1646.932) (-1643.816) (-1645.233) [-1644.674] * (-1646.243) [-1644.616] (-1643.729) (-1643.607) -- 0:00:29 550000 -- (-1644.866) (-1644.405) (-1645.804) [-1645.402] * [-1646.712] (-1644.596) (-1643.770) (-1643.223) -- 0:00:29 Average standard deviation of split frequencies: 0.012573 550500 -- [-1645.446] (-1645.717) (-1645.675) (-1644.065) * (-1644.232) [-1645.333] (-1645.600) (-1643.760) -- 0:00:29 551000 -- (-1644.091) (-1643.924) (-1645.513) [-1643.608] * (-1646.322) [-1644.758] (-1645.347) (-1645.473) -- 0:00:29 551500 -- [-1644.321] (-1644.426) (-1645.063) (-1643.511) * (-1646.950) [-1645.152] (-1642.958) (-1644.663) -- 0:00:29 552000 -- (-1643.778) (-1645.323) (-1646.435) [-1644.232] * (-1646.172) (-1644.962) [-1643.687] (-1646.210) -- 0:00:29 552500 -- (-1644.179) (-1650.751) [-1645.253] (-1643.579) * [-1645.515] (-1645.383) (-1644.420) (-1650.823) -- 0:00:29 553000 -- (-1649.959) [-1645.012] (-1644.132) (-1643.894) * (-1645.741) (-1645.377) [-1643.442] (-1647.144) -- 0:00:29 553500 -- (-1645.958) [-1646.923] (-1645.627) (-1644.039) * [-1646.078] (-1645.479) (-1643.443) (-1646.984) -- 0:00:29 554000 -- (-1646.319) (-1647.074) (-1646.499) [-1643.482] * (-1644.768) (-1644.202) (-1646.587) [-1646.937] -- 0:00:28 554500 -- (-1646.711) (-1646.105) [-1644.438] (-1643.506) * (-1645.299) (-1644.202) [-1646.436] (-1651.348) -- 0:00:28 555000 -- (-1647.556) (-1646.088) [-1646.067] (-1645.819) * (-1645.423) [-1643.455] (-1645.678) (-1648.357) -- 0:00:28 Average standard deviation of split frequencies: 0.012400 555500 -- (-1643.732) (-1644.210) (-1644.652) [-1645.098] * [-1644.511] (-1643.190) (-1644.365) (-1649.108) -- 0:00:28 556000 -- (-1645.103) [-1644.718] (-1644.333) (-1646.144) * (-1646.400) (-1643.216) (-1644.544) [-1649.176] -- 0:00:28 556500 -- (-1644.985) [-1643.387] (-1645.482) (-1645.730) * (-1645.198) [-1643.097] (-1645.093) (-1649.104) -- 0:00:28 557000 -- (-1645.277) (-1643.292) (-1644.011) [-1644.990] * (-1651.999) (-1647.299) [-1643.883] (-1645.730) -- 0:00:28 557500 -- (-1648.260) (-1645.355) (-1647.309) [-1643.859] * (-1647.483) (-1645.660) [-1645.432] (-1645.174) -- 0:00:28 558000 -- (-1644.824) (-1644.423) [-1648.701] (-1646.442) * (-1643.409) (-1645.733) [-1643.885] (-1648.114) -- 0:00:28 558500 -- [-1646.078] (-1643.881) (-1646.287) (-1644.909) * (-1643.283) (-1645.568) [-1645.904] (-1644.138) -- 0:00:28 559000 -- (-1644.473) (-1645.061) (-1643.169) [-1644.030] * (-1646.457) (-1644.860) [-1643.893] (-1644.560) -- 0:00:28 559500 -- [-1645.303] (-1648.116) (-1643.858) (-1644.779) * (-1648.132) (-1645.496) (-1647.484) [-1643.884] -- 0:00:28 560000 -- (-1646.376) (-1646.130) (-1647.226) [-1649.327] * (-1649.594) [-1648.475] (-1645.257) (-1647.162) -- 0:00:29 Average standard deviation of split frequencies: 0.012454 560500 -- (-1649.994) (-1645.959) (-1648.483) [-1643.786] * (-1647.798) [-1644.717] (-1644.762) (-1645.717) -- 0:00:29 561000 -- (-1648.128) [-1646.470] (-1648.417) (-1643.894) * (-1645.829) (-1644.178) (-1643.911) [-1646.237] -- 0:00:28 561500 -- [-1646.504] (-1644.667) (-1643.975) (-1645.779) * [-1644.605] (-1643.718) (-1644.644) (-1643.617) -- 0:00:28 562000 -- [-1647.950] (-1644.068) (-1646.696) (-1654.239) * [-1649.435] (-1645.623) (-1644.443) (-1644.172) -- 0:00:28 562500 -- (-1644.658) (-1644.058) [-1644.830] (-1646.027) * (-1645.405) [-1644.150] (-1644.122) (-1645.776) -- 0:00:28 563000 -- (-1645.329) [-1644.476] (-1643.745) (-1643.818) * (-1645.158) (-1646.189) [-1644.718] (-1649.286) -- 0:00:28 563500 -- (-1644.701) (-1644.231) (-1644.578) [-1647.900] * (-1644.974) (-1644.178) (-1644.696) [-1644.433] -- 0:00:28 564000 -- (-1649.523) (-1645.205) [-1643.885] (-1645.688) * (-1644.406) (-1645.123) [-1644.683] (-1643.991) -- 0:00:28 564500 -- (-1644.822) (-1649.492) (-1647.483) [-1645.367] * (-1644.868) (-1644.710) (-1643.644) [-1643.181] -- 0:00:28 565000 -- [-1644.638] (-1645.460) (-1645.353) (-1643.844) * (-1646.494) [-1645.096] (-1643.401) (-1643.205) -- 0:00:28 Average standard deviation of split frequencies: 0.013118 565500 -- [-1644.821] (-1645.931) (-1645.441) (-1643.693) * [-1644.927] (-1644.616) (-1643.836) (-1643.183) -- 0:00:28 566000 -- [-1644.841] (-1647.410) (-1644.797) (-1643.412) * (-1645.271) (-1647.068) [-1645.729] (-1645.910) -- 0:00:28 566500 -- (-1648.707) (-1645.488) (-1646.164) [-1649.641] * (-1645.092) [-1647.883] (-1649.609) (-1644.354) -- 0:00:28 567000 -- (-1648.514) (-1645.474) [-1645.641] (-1649.609) * (-1644.427) (-1646.465) (-1651.973) [-1644.930] -- 0:00:28 567500 -- [-1643.579] (-1644.839) (-1644.135) (-1649.329) * (-1644.271) [-1646.197] (-1646.885) (-1650.921) -- 0:00:28 568000 -- (-1644.422) (-1646.330) (-1645.689) [-1646.661] * (-1643.901) [-1646.543] (-1645.020) (-1649.790) -- 0:00:28 568500 -- [-1643.453] (-1643.886) (-1645.932) (-1647.902) * [-1643.831] (-1654.736) (-1645.388) (-1649.866) -- 0:00:28 569000 -- (-1645.237) [-1644.726] (-1649.991) (-1647.114) * (-1645.978) (-1652.150) [-1648.911] (-1643.651) -- 0:00:28 569500 -- [-1647.035] (-1645.987) (-1646.285) (-1645.120) * (-1645.312) [-1645.911] (-1648.559) (-1647.490) -- 0:00:27 570000 -- (-1644.311) (-1647.599) [-1644.069] (-1646.812) * [-1645.610] (-1646.252) (-1644.910) (-1647.644) -- 0:00:27 Average standard deviation of split frequencies: 0.012701 570500 -- (-1643.591) [-1647.848] (-1646.285) (-1646.901) * [-1645.615] (-1643.811) (-1649.758) (-1644.023) -- 0:00:27 571000 -- (-1645.475) (-1643.871) [-1643.284] (-1644.763) * (-1649.842) (-1643.343) (-1643.672) [-1643.338] -- 0:00:27 571500 -- [-1644.826] (-1645.151) (-1643.875) (-1645.561) * (-1645.352) (-1644.715) (-1645.889) [-1645.234] -- 0:00:27 572000 -- [-1647.910] (-1649.999) (-1643.471) (-1647.274) * (-1646.945) (-1644.683) (-1645.327) [-1643.579] -- 0:00:27 572500 -- [-1644.675] (-1644.099) (-1644.176) (-1647.905) * [-1643.754] (-1647.054) (-1645.569) (-1646.884) -- 0:00:27 573000 -- (-1648.693) (-1644.228) (-1643.945) [-1645.384] * (-1645.140) (-1650.672) [-1647.249] (-1647.897) -- 0:00:27 573500 -- (-1644.099) (-1648.714) [-1647.063] (-1643.261) * (-1644.771) [-1644.973] (-1644.596) (-1644.358) -- 0:00:27 574000 -- (-1646.443) (-1646.228) (-1645.209) [-1645.536] * (-1646.698) [-1643.679] (-1645.375) (-1649.575) -- 0:00:27 574500 -- (-1648.713) [-1646.050] (-1644.308) (-1647.529) * (-1645.532) [-1643.872] (-1643.220) (-1645.767) -- 0:00:27 575000 -- (-1644.736) (-1644.960) [-1644.016] (-1644.602) * (-1644.845) (-1646.764) (-1646.204) [-1644.331] -- 0:00:27 Average standard deviation of split frequencies: 0.012481 575500 -- (-1648.168) [-1648.269] (-1644.607) (-1645.161) * (-1646.613) [-1645.186] (-1646.125) (-1643.842) -- 0:00:28 576000 -- (-1646.349) (-1646.526) [-1645.595] (-1645.359) * (-1643.616) [-1645.325] (-1643.745) (-1648.505) -- 0:00:27 576500 -- (-1645.069) [-1649.564] (-1649.387) (-1643.699) * (-1644.928) [-1643.398] (-1643.765) (-1644.177) -- 0:00:27 577000 -- [-1645.113] (-1646.036) (-1644.522) (-1649.339) * (-1645.441) (-1645.898) (-1643.464) [-1643.193] -- 0:00:27 577500 -- [-1644.019] (-1646.255) (-1643.926) (-1644.349) * (-1646.195) (-1644.874) (-1646.481) [-1643.464] -- 0:00:27 578000 -- [-1645.256] (-1643.600) (-1644.494) (-1644.586) * (-1644.460) (-1644.622) (-1647.888) [-1644.160] -- 0:00:27 578500 -- (-1646.131) [-1642.876] (-1644.376) (-1645.323) * (-1645.604) [-1645.465] (-1653.448) (-1644.472) -- 0:00:27 579000 -- [-1645.564] (-1644.602) (-1645.201) (-1646.068) * (-1645.564) (-1644.463) [-1645.538] (-1648.352) -- 0:00:27 579500 -- (-1645.158) [-1645.513] (-1644.739) (-1643.562) * (-1645.799) (-1646.111) (-1648.131) [-1646.685] -- 0:00:27 580000 -- (-1644.834) (-1644.304) [-1645.801] (-1644.803) * (-1643.780) (-1644.119) (-1644.202) [-1644.673] -- 0:00:27 Average standard deviation of split frequencies: 0.012431 580500 -- (-1647.036) (-1643.662) [-1644.632] (-1645.994) * (-1643.962) [-1645.609] (-1643.907) (-1644.711) -- 0:00:27 581000 -- (-1647.980) [-1644.725] (-1644.372) (-1643.108) * [-1649.456] (-1648.327) (-1643.906) (-1645.267) -- 0:00:27 581500 -- [-1646.047] (-1646.154) (-1644.066) (-1645.591) * (-1644.137) [-1647.127] (-1644.325) (-1645.821) -- 0:00:27 582000 -- (-1648.188) [-1645.216] (-1645.038) (-1643.893) * [-1644.074] (-1649.577) (-1644.650) (-1645.258) -- 0:00:27 582500 -- (-1646.682) (-1650.708) (-1642.917) [-1643.567] * (-1644.507) [-1644.300] (-1647.629) (-1643.631) -- 0:00:27 583000 -- (-1643.710) (-1647.955) [-1643.619] (-1648.980) * (-1649.144) (-1645.016) (-1645.240) [-1644.495] -- 0:00:27 583500 -- (-1644.143) [-1646.275] (-1648.620) (-1646.521) * (-1643.481) (-1649.061) [-1643.863] (-1645.475) -- 0:00:27 584000 -- (-1644.581) (-1645.625) [-1645.630] (-1646.384) * (-1643.429) (-1647.910) [-1644.461] (-1644.524) -- 0:00:27 584500 -- (-1645.486) (-1644.267) (-1647.579) [-1645.110] * (-1643.798) [-1646.307] (-1644.114) (-1644.859) -- 0:00:27 585000 -- (-1643.406) (-1645.631) [-1643.941] (-1648.744) * (-1643.371) (-1644.939) [-1644.158] (-1647.691) -- 0:00:26 Average standard deviation of split frequencies: 0.012519 585500 -- [-1644.225] (-1646.627) (-1646.258) (-1644.915) * (-1643.530) (-1644.786) (-1645.218) [-1645.374] -- 0:00:26 586000 -- (-1643.481) (-1645.799) [-1646.018] (-1644.581) * (-1644.823) (-1648.587) (-1644.598) [-1645.088] -- 0:00:26 586500 -- [-1646.903] (-1646.181) (-1646.980) (-1643.635) * (-1650.587) [-1644.379] (-1646.398) (-1644.783) -- 0:00:26 587000 -- (-1643.415) (-1646.031) (-1643.310) [-1646.704] * [-1645.082] (-1644.359) (-1646.687) (-1646.594) -- 0:00:26 587500 -- (-1643.910) [-1643.408] (-1645.153) (-1647.888) * (-1646.555) [-1645.319] (-1644.313) (-1643.166) -- 0:00:26 588000 -- (-1645.711) [-1643.851] (-1646.459) (-1644.675) * [-1646.008] (-1643.694) (-1645.369) (-1643.416) -- 0:00:26 588500 -- (-1645.299) [-1643.364] (-1645.887) (-1643.821) * (-1644.046) (-1645.109) (-1645.381) [-1643.563] -- 0:00:26 589000 -- (-1645.228) (-1644.964) (-1645.789) [-1643.460] * (-1644.855) (-1646.006) (-1645.970) [-1644.685] -- 0:00:26 589500 -- (-1644.156) (-1648.859) [-1644.489] (-1643.470) * [-1644.302] (-1644.428) (-1643.461) (-1643.881) -- 0:00:26 590000 -- (-1644.734) [-1643.832] (-1646.298) (-1643.817) * (-1647.493) (-1646.286) (-1643.404) [-1644.144] -- 0:00:26 Average standard deviation of split frequencies: 0.012620 590500 -- (-1646.189) (-1644.047) [-1645.258] (-1646.666) * (-1644.531) [-1647.246] (-1644.663) (-1644.931) -- 0:00:26 591000 -- [-1646.347] (-1647.123) (-1644.591) (-1645.954) * [-1644.488] (-1651.214) (-1644.965) (-1643.991) -- 0:00:26 591500 -- (-1648.693) [-1643.475] (-1643.454) (-1643.655) * [-1643.958] (-1646.140) (-1647.170) (-1644.225) -- 0:00:26 592000 -- (-1646.408) (-1645.492) (-1643.364) [-1643.929] * (-1648.218) (-1644.754) [-1645.837] (-1644.075) -- 0:00:26 592500 -- (-1648.951) (-1644.317) [-1643.909] (-1644.864) * [-1645.473] (-1645.075) (-1644.787) (-1643.397) -- 0:00:26 593000 -- (-1643.540) (-1644.317) (-1645.026) [-1647.149] * (-1646.799) (-1646.116) (-1647.574) [-1643.565] -- 0:00:26 593500 -- (-1645.181) (-1644.121) (-1645.369) [-1643.972] * (-1645.273) (-1645.499) [-1646.617] (-1647.357) -- 0:00:26 594000 -- (-1648.808) (-1645.247) (-1643.423) [-1644.884] * (-1645.575) [-1644.075] (-1646.050) (-1650.649) -- 0:00:26 594500 -- [-1644.300] (-1644.620) (-1644.363) (-1650.594) * (-1646.688) (-1644.637) (-1645.646) [-1644.749] -- 0:00:26 595000 -- (-1643.987) (-1646.305) (-1648.744) [-1645.379] * (-1646.526) (-1644.527) [-1643.749] (-1645.441) -- 0:00:26 Average standard deviation of split frequencies: 0.012457 595500 -- (-1644.119) (-1644.811) (-1644.229) [-1643.973] * (-1643.078) [-1644.002] (-1643.047) (-1644.083) -- 0:00:26 596000 -- (-1646.366) [-1644.854] (-1650.615) (-1643.726) * (-1643.262) (-1644.301) (-1645.725) [-1643.252] -- 0:00:26 596500 -- (-1643.123) (-1642.753) (-1646.030) [-1645.540] * (-1643.113) [-1643.306] (-1644.043) (-1643.255) -- 0:00:26 597000 -- [-1645.899] (-1647.379) (-1647.566) (-1645.206) * [-1645.866] (-1646.149) (-1645.004) (-1644.384) -- 0:00:26 597500 -- (-1645.912) [-1646.457] (-1644.812) (-1648.075) * [-1643.481] (-1644.015) (-1646.162) (-1644.251) -- 0:00:26 598000 -- (-1642.956) (-1645.112) (-1647.340) [-1644.895] * (-1643.481) (-1646.458) [-1644.247] (-1645.330) -- 0:00:26 598500 -- [-1644.140] (-1643.760) (-1645.336) (-1644.722) * (-1646.794) (-1646.789) (-1646.526) [-1643.374] -- 0:00:26 599000 -- (-1643.347) [-1644.331] (-1644.723) (-1651.444) * (-1647.784) [-1647.935] (-1647.697) (-1644.315) -- 0:00:26 599500 -- [-1644.334] (-1646.680) (-1646.131) (-1646.750) * (-1647.653) (-1646.931) (-1648.474) [-1644.602] -- 0:00:26 600000 -- (-1645.460) (-1643.319) [-1643.461] (-1644.937) * (-1644.863) [-1646.568] (-1645.114) (-1646.993) -- 0:00:25 Average standard deviation of split frequencies: 0.012704 600500 -- (-1644.739) [-1644.235] (-1646.502) (-1646.661) * (-1644.956) [-1644.040] (-1644.407) (-1646.233) -- 0:00:25 601000 -- (-1643.357) (-1643.703) (-1646.250) [-1646.139] * [-1645.861] (-1644.830) (-1644.377) (-1650.104) -- 0:00:25 601500 -- (-1644.401) [-1648.740] (-1644.328) (-1644.615) * [-1644.212] (-1645.100) (-1643.570) (-1643.987) -- 0:00:25 602000 -- [-1644.530] (-1647.477) (-1645.702) (-1651.192) * (-1645.630) (-1645.552) [-1644.865] (-1645.997) -- 0:00:25 602500 -- (-1644.937) (-1645.955) [-1644.853] (-1646.314) * (-1643.162) (-1645.552) (-1644.436) [-1645.003] -- 0:00:25 603000 -- (-1644.977) (-1649.277) [-1645.899] (-1644.190) * [-1643.167] (-1645.262) (-1645.640) (-1643.974) -- 0:00:25 603500 -- (-1646.254) (-1646.408) (-1648.670) [-1645.860] * (-1644.993) (-1646.942) [-1646.371] (-1645.202) -- 0:00:25 604000 -- (-1643.825) (-1645.759) [-1643.912] (-1644.670) * [-1644.207] (-1644.866) (-1644.179) (-1647.218) -- 0:00:25 604500 -- [-1645.607] (-1646.558) (-1643.437) (-1648.424) * (-1646.216) (-1643.165) (-1648.017) [-1649.318] -- 0:00:25 605000 -- (-1643.175) (-1643.920) [-1642.947] (-1645.614) * [-1645.829] (-1644.303) (-1643.283) (-1645.643) -- 0:00:25 Average standard deviation of split frequencies: 0.012155 605500 -- [-1643.194] (-1643.799) (-1643.768) (-1643.049) * (-1643.478) (-1645.320) (-1644.957) [-1648.146] -- 0:00:25 606000 -- (-1646.845) (-1643.116) (-1646.801) [-1644.822] * (-1646.180) (-1644.292) (-1644.346) [-1647.910] -- 0:00:26 606500 -- [-1644.175] (-1644.075) (-1644.069) (-1643.404) * (-1644.572) [-1644.064] (-1645.581) (-1647.760) -- 0:00:25 607000 -- [-1647.417] (-1644.290) (-1643.716) (-1644.826) * (-1644.921) [-1645.756] (-1645.746) (-1643.736) -- 0:00:25 607500 -- (-1651.466) (-1645.448) [-1643.266] (-1645.073) * (-1644.664) (-1646.065) [-1645.330] (-1651.583) -- 0:00:25 608000 -- (-1646.825) (-1645.832) (-1644.207) [-1644.872] * [-1645.615] (-1644.943) (-1644.057) (-1645.502) -- 0:00:25 608500 -- [-1648.085] (-1646.553) (-1644.227) (-1644.488) * [-1643.579] (-1646.093) (-1643.695) (-1644.228) -- 0:00:25 609000 -- (-1645.874) (-1648.749) (-1643.802) [-1643.388] * [-1643.122] (-1643.741) (-1644.797) (-1645.093) -- 0:00:25 609500 -- (-1649.928) (-1645.272) (-1643.526) [-1645.549] * (-1645.353) (-1646.348) [-1644.797] (-1648.619) -- 0:00:25 610000 -- (-1646.797) (-1646.695) [-1644.153] (-1644.358) * (-1648.282) (-1644.605) [-1644.657] (-1647.734) -- 0:00:25 Average standard deviation of split frequencies: 0.012303 610500 -- [-1645.101] (-1643.125) (-1650.681) (-1645.009) * (-1646.020) (-1644.712) (-1644.268) [-1650.233] -- 0:00:25 611000 -- (-1644.429) [-1643.876] (-1648.005) (-1643.141) * (-1646.461) (-1647.610) (-1645.517) [-1649.759] -- 0:00:25 611500 -- [-1643.458] (-1645.642) (-1645.026) (-1644.417) * (-1648.636) (-1653.008) [-1646.745] (-1645.283) -- 0:00:25 612000 -- (-1643.346) (-1646.904) (-1643.688) [-1643.687] * (-1645.659) (-1646.110) [-1644.273] (-1643.922) -- 0:00:25 612500 -- (-1644.782) [-1645.367] (-1645.750) (-1643.399) * [-1642.969] (-1643.461) (-1644.308) (-1644.972) -- 0:00:25 613000 -- (-1642.902) [-1643.729] (-1642.868) (-1642.990) * (-1646.950) [-1643.461] (-1644.655) (-1644.176) -- 0:00:25 613500 -- (-1646.429) [-1645.863] (-1646.511) (-1643.013) * [-1644.989] (-1643.803) (-1649.477) (-1644.034) -- 0:00:25 614000 -- (-1644.880) (-1645.365) [-1646.155] (-1643.684) * (-1645.623) (-1645.207) [-1643.420] (-1644.500) -- 0:00:25 614500 -- (-1644.812) [-1645.386] (-1646.423) (-1645.473) * (-1645.157) [-1643.365] (-1643.542) (-1651.067) -- 0:00:25 615000 -- (-1646.131) (-1645.343) (-1645.795) [-1642.854] * (-1643.251) (-1644.607) (-1643.689) [-1647.651] -- 0:00:25 Average standard deviation of split frequencies: 0.012244 615500 -- (-1645.229) (-1644.129) (-1643.753) [-1643.500] * (-1644.759) (-1643.887) [-1648.882] (-1645.018) -- 0:00:24 616000 -- [-1643.669] (-1643.192) (-1644.805) (-1644.502) * (-1644.392) (-1650.593) [-1645.198] (-1646.775) -- 0:00:24 616500 -- [-1643.244] (-1645.785) (-1643.634) (-1645.329) * (-1644.178) (-1648.519) (-1645.538) [-1645.570] -- 0:00:24 617000 -- (-1645.729) (-1644.995) (-1644.174) [-1648.622] * [-1643.674] (-1647.212) (-1646.712) (-1647.407) -- 0:00:24 617500 -- [-1646.605] (-1644.226) (-1645.375) (-1645.560) * (-1643.853) (-1648.935) [-1643.760] (-1647.201) -- 0:00:24 618000 -- (-1644.521) (-1645.333) (-1647.255) [-1644.682] * [-1643.728] (-1653.031) (-1643.375) (-1644.829) -- 0:00:24 618500 -- (-1649.771) [-1648.552] (-1647.828) (-1645.327) * [-1645.269] (-1651.995) (-1643.206) (-1652.583) -- 0:00:24 619000 -- (-1645.662) [-1647.096] (-1643.990) (-1644.472) * [-1643.588] (-1645.507) (-1644.623) (-1649.180) -- 0:00:24 619500 -- (-1645.346) (-1642.945) (-1643.332) [-1644.499] * (-1645.428) (-1645.216) (-1644.857) [-1647.743] -- 0:00:24 620000 -- (-1646.460) (-1645.165) [-1643.081] (-1643.802) * (-1647.189) [-1646.591] (-1645.625) (-1645.679) -- 0:00:24 Average standard deviation of split frequencies: 0.011950 620500 -- (-1650.967) (-1645.673) [-1644.978] (-1645.202) * (-1644.259) [-1647.457] (-1650.104) (-1644.398) -- 0:00:24 621000 -- (-1645.501) [-1645.287] (-1647.400) (-1645.844) * (-1643.749) (-1648.275) (-1647.737) [-1644.732] -- 0:00:24 621500 -- (-1644.388) (-1643.998) (-1646.205) [-1645.165] * [-1643.951] (-1647.340) (-1644.771) (-1644.171) -- 0:00:24 622000 -- (-1646.607) [-1646.110] (-1644.294) (-1644.124) * [-1644.687] (-1645.600) (-1644.950) (-1645.853) -- 0:00:24 622500 -- [-1647.474] (-1646.267) (-1644.535) (-1644.171) * (-1647.310) [-1645.761] (-1645.627) (-1647.162) -- 0:00:24 623000 -- (-1648.119) (-1645.572) (-1647.767) [-1644.954] * [-1643.263] (-1647.624) (-1645.357) (-1645.693) -- 0:00:24 623500 -- (-1645.185) [-1644.835] (-1645.465) (-1648.905) * (-1644.471) [-1646.128] (-1642.780) (-1647.206) -- 0:00:24 624000 -- [-1648.133] (-1645.711) (-1644.601) (-1648.072) * [-1645.538] (-1646.711) (-1643.881) (-1649.156) -- 0:00:24 624500 -- (-1645.242) (-1645.282) [-1646.428] (-1645.861) * [-1645.039] (-1647.015) (-1643.953) (-1644.863) -- 0:00:24 625000 -- (-1644.920) (-1646.028) [-1644.794] (-1644.749) * [-1644.783] (-1645.475) (-1643.529) (-1644.803) -- 0:00:24 Average standard deviation of split frequencies: 0.010778 625500 -- (-1643.972) [-1647.009] (-1644.597) (-1645.802) * (-1645.170) [-1645.770] (-1643.122) (-1647.276) -- 0:00:24 626000 -- (-1644.101) [-1645.850] (-1644.585) (-1648.843) * (-1650.719) (-1644.328) [-1645.961] (-1645.901) -- 0:00:24 626500 -- (-1646.494) (-1645.402) [-1643.809] (-1649.333) * (-1648.753) [-1644.328] (-1644.650) (-1647.049) -- 0:00:24 627000 -- [-1645.915] (-1647.449) (-1644.066) (-1647.194) * (-1645.519) (-1646.843) (-1644.582) [-1645.419] -- 0:00:24 627500 -- [-1644.732] (-1649.463) (-1646.522) (-1643.362) * [-1644.634] (-1647.168) (-1644.978) (-1646.212) -- 0:00:24 628000 -- (-1646.323) (-1650.135) [-1642.850] (-1644.738) * (-1645.921) (-1645.971) (-1643.980) [-1643.746] -- 0:00:24 628500 -- (-1654.101) [-1645.923] (-1645.030) (-1644.348) * (-1645.513) [-1644.465] (-1644.871) (-1645.996) -- 0:00:24 629000 -- (-1646.419) [-1645.680] (-1643.805) (-1648.612) * [-1643.934] (-1643.880) (-1644.899) (-1645.869) -- 0:00:24 629500 -- (-1645.882) (-1645.746) (-1647.936) [-1644.579] * (-1644.563) (-1643.183) [-1643.012] (-1644.783) -- 0:00:24 630000 -- (-1645.314) (-1647.803) (-1646.154) [-1643.847] * (-1647.211) (-1644.549) (-1644.131) [-1644.159] -- 0:00:24 Average standard deviation of split frequencies: 0.010838 630500 -- (-1647.393) (-1648.488) (-1643.884) [-1643.975] * (-1646.235) [-1645.832] (-1643.547) (-1646.328) -- 0:00:24 631000 -- [-1647.758] (-1651.476) (-1644.065) (-1648.584) * [-1647.021] (-1645.502) (-1645.232) (-1649.903) -- 0:00:23 631500 -- [-1643.880] (-1647.617) (-1645.397) (-1646.951) * (-1645.861) [-1646.189] (-1645.549) (-1649.703) -- 0:00:23 632000 -- (-1644.430) (-1644.701) [-1644.944] (-1644.170) * (-1645.227) (-1649.715) [-1645.689] (-1643.975) -- 0:00:23 632500 -- [-1643.976] (-1645.328) (-1644.028) (-1645.385) * (-1646.076) (-1644.558) [-1645.466] (-1646.537) -- 0:00:23 633000 -- [-1643.847] (-1648.763) (-1651.338) (-1647.209) * (-1644.525) [-1648.138] (-1645.362) (-1644.686) -- 0:00:23 633500 -- (-1645.056) (-1648.871) (-1649.350) [-1645.553] * (-1643.943) (-1645.329) (-1647.670) [-1644.106] -- 0:00:23 634000 -- (-1644.861) [-1643.471] (-1645.138) (-1645.198) * (-1643.135) (-1645.495) [-1647.041] (-1644.026) -- 0:00:23 634500 -- (-1646.384) (-1643.892) [-1645.870] (-1643.993) * [-1644.399] (-1645.944) (-1644.862) (-1644.595) -- 0:00:23 635000 -- [-1648.663] (-1647.975) (-1645.940) (-1645.076) * (-1645.456) (-1645.672) (-1644.451) [-1645.275] -- 0:00:23 Average standard deviation of split frequencies: 0.011760 635500 -- [-1646.697] (-1648.533) (-1644.491) (-1645.801) * (-1646.002) (-1645.903) (-1644.606) [-1646.863] -- 0:00:23 636000 -- (-1644.185) (-1643.636) (-1644.265) [-1644.183] * (-1646.243) [-1645.500] (-1645.547) (-1647.654) -- 0:00:23 636500 -- (-1645.840) [-1646.451] (-1643.721) (-1645.712) * (-1648.206) (-1644.357) (-1644.268) [-1647.243] -- 0:00:23 637000 -- (-1644.534) [-1645.300] (-1646.001) (-1645.879) * (-1644.748) (-1647.652) (-1643.698) [-1644.444] -- 0:00:23 637500 -- [-1644.520] (-1647.892) (-1645.479) (-1643.556) * [-1645.061] (-1648.185) (-1643.670) (-1646.985) -- 0:00:23 638000 -- (-1645.331) (-1643.733) [-1647.974] (-1646.416) * (-1644.676) (-1643.629) [-1644.864] (-1648.307) -- 0:00:23 638500 -- [-1643.370] (-1645.835) (-1649.293) (-1644.973) * (-1645.890) (-1645.683) (-1645.116) [-1645.481] -- 0:00:23 639000 -- (-1644.452) (-1643.912) (-1645.570) [-1643.215] * [-1644.262] (-1649.802) (-1644.357) (-1646.264) -- 0:00:23 639500 -- (-1644.883) [-1644.000] (-1645.809) (-1646.296) * (-1646.160) (-1644.485) [-1644.243] (-1645.213) -- 0:00:23 640000 -- (-1647.418) (-1644.578) (-1646.425) [-1647.572] * (-1647.856) (-1648.192) [-1643.809] (-1644.188) -- 0:00:23 Average standard deviation of split frequencies: 0.012460 640500 -- (-1644.880) (-1645.193) [-1644.750] (-1643.600) * (-1646.791) (-1647.594) [-1646.562] (-1644.326) -- 0:00:23 641000 -- (-1645.363) (-1643.196) (-1645.373) [-1644.144] * (-1647.382) (-1644.841) [-1643.530] (-1644.794) -- 0:00:23 641500 -- (-1644.817) [-1644.684] (-1643.135) (-1647.842) * (-1645.058) [-1644.486] (-1643.882) (-1645.281) -- 0:00:23 642000 -- (-1648.049) [-1643.325] (-1646.356) (-1646.219) * (-1645.918) (-1645.181) (-1643.416) [-1645.710] -- 0:00:23 642500 -- (-1643.975) [-1643.111] (-1645.864) (-1644.199) * [-1650.671] (-1644.480) (-1646.872) (-1646.912) -- 0:00:23 643000 -- (-1643.496) [-1645.332] (-1644.706) (-1644.905) * [-1646.184] (-1648.010) (-1646.590) (-1644.118) -- 0:00:23 643500 -- (-1645.176) (-1648.182) (-1654.031) [-1647.078] * [-1644.465] (-1644.030) (-1646.623) (-1643.553) -- 0:00:23 644000 -- (-1644.219) (-1646.952) [-1643.280] (-1645.274) * (-1643.612) [-1645.115] (-1646.528) (-1644.768) -- 0:00:23 644500 -- [-1645.057] (-1643.744) (-1643.301) (-1644.223) * [-1643.371] (-1646.635) (-1647.397) (-1644.693) -- 0:00:23 645000 -- (-1648.012) [-1644.019] (-1642.859) (-1644.728) * (-1644.162) [-1644.955] (-1646.296) (-1645.267) -- 0:00:23 Average standard deviation of split frequencies: 0.012503 645500 -- (-1644.213) [-1644.745] (-1646.471) (-1646.220) * (-1644.235) [-1645.180] (-1645.321) (-1645.522) -- 0:00:23 646000 -- [-1644.833] (-1644.484) (-1644.103) (-1643.678) * (-1643.254) (-1643.108) [-1645.937] (-1648.963) -- 0:00:23 646500 -- (-1644.623) (-1646.425) [-1645.003] (-1644.801) * [-1643.963] (-1643.474) (-1646.363) (-1644.709) -- 0:00:22 647000 -- [-1645.371] (-1648.729) (-1646.451) (-1647.471) * [-1645.508] (-1643.734) (-1644.571) (-1644.414) -- 0:00:22 647500 -- (-1646.031) (-1648.191) (-1646.245) [-1647.165] * [-1645.393] (-1644.169) (-1643.225) (-1644.488) -- 0:00:22 648000 -- [-1645.381] (-1646.629) (-1647.015) (-1642.708) * (-1645.864) (-1644.160) (-1643.225) [-1644.131] -- 0:00:22 648500 -- [-1645.384] (-1649.321) (-1647.770) (-1648.599) * (-1644.168) (-1644.589) (-1646.529) [-1643.568] -- 0:00:22 649000 -- (-1647.721) (-1645.022) [-1649.623] (-1646.951) * (-1644.637) (-1644.185) (-1650.158) [-1649.219] -- 0:00:22 649500 -- (-1652.003) [-1645.516] (-1646.480) (-1648.739) * (-1644.408) (-1644.510) [-1644.257] (-1644.374) -- 0:00:22 650000 -- (-1647.047) (-1648.265) (-1647.949) [-1645.624] * [-1643.956] (-1643.091) (-1644.124) (-1646.607) -- 0:00:22 Average standard deviation of split frequencies: 0.012090 650500 -- [-1645.492] (-1647.474) (-1648.579) (-1645.704) * [-1644.240] (-1642.839) (-1644.586) (-1646.557) -- 0:00:22 651000 -- [-1643.555] (-1659.414) (-1647.461) (-1645.566) * (-1644.644) [-1643.044] (-1643.466) (-1645.274) -- 0:00:22 651500 -- (-1644.112) (-1643.242) [-1645.788] (-1643.517) * [-1645.123] (-1643.953) (-1644.774) (-1646.733) -- 0:00:22 652000 -- [-1644.670] (-1643.823) (-1647.353) (-1643.136) * [-1644.166] (-1646.858) (-1646.493) (-1647.927) -- 0:00:22 652500 -- (-1646.839) [-1644.507] (-1644.882) (-1643.079) * [-1646.376] (-1646.955) (-1647.460) (-1645.817) -- 0:00:22 653000 -- (-1644.808) (-1643.129) (-1645.173) [-1646.376] * (-1648.736) [-1644.289] (-1645.985) (-1648.413) -- 0:00:22 653500 -- [-1648.490] (-1643.129) (-1644.402) (-1645.636) * (-1645.415) (-1645.378) [-1646.191] (-1646.472) -- 0:00:22 654000 -- (-1646.491) [-1643.685] (-1645.060) (-1644.600) * (-1648.935) (-1645.293) (-1645.195) [-1645.814] -- 0:00:22 654500 -- [-1644.161] (-1646.797) (-1644.560) (-1647.897) * (-1646.026) (-1646.806) [-1645.700] (-1647.177) -- 0:00:22 655000 -- [-1646.532] (-1646.935) (-1648.419) (-1647.586) * (-1645.208) (-1648.498) (-1645.611) [-1644.663] -- 0:00:22 Average standard deviation of split frequencies: 0.012025 655500 -- [-1643.814] (-1644.398) (-1644.246) (-1644.210) * (-1645.375) [-1648.429] (-1645.645) (-1645.643) -- 0:00:22 656000 -- (-1645.590) (-1644.386) (-1644.141) [-1646.225] * (-1643.997) (-1645.985) [-1644.341] (-1645.810) -- 0:00:22 656500 -- (-1645.767) (-1647.812) [-1643.986] (-1644.293) * (-1646.081) (-1648.395) (-1644.125) [-1645.260] -- 0:00:22 657000 -- (-1644.206) (-1645.801) [-1644.713] (-1645.131) * (-1648.002) (-1648.472) [-1645.761] (-1647.747) -- 0:00:22 657500 -- [-1644.506] (-1649.392) (-1644.453) (-1644.730) * [-1644.138] (-1646.493) (-1644.160) (-1647.569) -- 0:00:22 658000 -- (-1644.920) (-1646.483) [-1644.495] (-1646.888) * (-1648.024) [-1649.950] (-1644.258) (-1645.058) -- 0:00:22 658500 -- [-1643.348] (-1651.390) (-1649.536) (-1647.676) * (-1649.557) [-1647.707] (-1643.955) (-1643.064) -- 0:00:22 659000 -- [-1645.083] (-1647.471) (-1643.287) (-1646.695) * (-1651.112) (-1648.179) [-1646.913] (-1644.600) -- 0:00:22 659500 -- (-1644.786) (-1645.013) [-1644.057] (-1644.321) * [-1646.458] (-1643.334) (-1643.413) (-1643.695) -- 0:00:22 660000 -- (-1644.911) [-1645.169] (-1645.981) (-1644.544) * (-1647.720) (-1645.710) [-1643.362] (-1644.788) -- 0:00:22 Average standard deviation of split frequencies: 0.012082 660500 -- [-1645.736] (-1648.526) (-1644.190) (-1649.316) * (-1645.948) (-1644.750) [-1647.039] (-1645.042) -- 0:00:22 661000 -- [-1645.753] (-1645.064) (-1643.196) (-1643.751) * (-1645.310) (-1647.133) (-1645.755) [-1648.992] -- 0:00:22 661500 -- (-1648.872) (-1648.445) (-1644.909) [-1644.135] * [-1644.856] (-1649.590) (-1644.475) (-1644.116) -- 0:00:22 662000 -- (-1644.143) (-1643.153) (-1644.585) [-1645.744] * (-1647.306) (-1651.659) (-1644.527) [-1644.038] -- 0:00:21 662500 -- (-1645.874) (-1643.232) [-1646.949] (-1643.747) * (-1647.756) (-1647.714) [-1645.128] (-1644.116) -- 0:00:21 663000 -- (-1647.972) [-1644.282] (-1646.868) (-1643.893) * (-1644.307) [-1648.248] (-1643.682) (-1648.464) -- 0:00:21 663500 -- (-1645.599) (-1643.908) (-1648.155) [-1643.048] * (-1644.289) (-1649.180) (-1644.094) [-1644.567] -- 0:00:21 664000 -- (-1646.029) (-1648.807) (-1647.282) [-1644.410] * (-1644.300) (-1646.482) [-1643.655] (-1646.038) -- 0:00:21 664500 -- (-1644.366) (-1645.179) [-1644.050] (-1643.544) * (-1648.877) [-1645.079] (-1644.909) (-1644.515) -- 0:00:21 665000 -- (-1644.028) (-1646.720) [-1643.461] (-1644.045) * [-1645.920] (-1648.253) (-1646.485) (-1644.242) -- 0:00:21 Average standard deviation of split frequencies: 0.011608 665500 -- [-1645.794] (-1645.163) (-1646.521) (-1645.108) * [-1647.217] (-1648.275) (-1644.282) (-1644.052) -- 0:00:21 666000 -- [-1645.963] (-1644.940) (-1646.265) (-1643.247) * [-1646.859] (-1646.903) (-1643.948) (-1644.107) -- 0:00:21 666500 -- [-1648.468] (-1644.367) (-1647.509) (-1643.228) * (-1647.067) [-1645.647] (-1643.517) (-1644.188) -- 0:00:21 667000 -- (-1648.260) (-1643.777) [-1646.752] (-1644.986) * (-1648.187) (-1644.480) [-1646.659] (-1644.359) -- 0:00:21 667500 -- [-1643.470] (-1646.252) (-1645.439) (-1645.882) * (-1646.049) (-1648.850) (-1645.589) [-1644.687] -- 0:00:21 668000 -- [-1644.486] (-1643.116) (-1645.877) (-1643.988) * (-1649.416) (-1647.054) (-1646.321) [-1646.431] -- 0:00:21 668500 -- (-1643.634) [-1643.155] (-1646.668) (-1643.292) * [-1645.929] (-1643.524) (-1643.297) (-1645.915) -- 0:00:21 669000 -- (-1644.536) (-1643.985) [-1645.918] (-1647.750) * (-1645.020) (-1643.393) [-1645.528] (-1644.636) -- 0:00:21 669500 -- [-1645.663] (-1644.417) (-1643.169) (-1649.851) * (-1645.148) (-1643.253) (-1644.342) [-1645.362] -- 0:00:21 670000 -- (-1644.742) (-1648.137) [-1643.169] (-1645.483) * (-1645.109) (-1643.709) [-1646.302] (-1644.047) -- 0:00:21 Average standard deviation of split frequencies: 0.011668 670500 -- [-1647.517] (-1645.087) (-1644.173) (-1644.437) * (-1646.506) (-1647.605) (-1646.057) [-1647.666] -- 0:00:21 671000 -- (-1644.813) [-1645.746] (-1650.146) (-1646.376) * (-1645.482) (-1648.656) [-1644.523] (-1646.983) -- 0:00:21 671500 -- (-1645.502) (-1646.213) (-1645.724) [-1644.945] * (-1646.803) (-1649.955) [-1644.079] (-1649.257) -- 0:00:21 672000 -- [-1647.439] (-1646.724) (-1648.294) (-1645.593) * (-1646.198) (-1645.108) [-1643.277] (-1645.888) -- 0:00:21 672500 -- [-1647.756] (-1643.952) (-1647.847) (-1644.342) * (-1646.157) (-1647.112) (-1647.500) [-1644.206] -- 0:00:21 673000 -- (-1647.117) (-1644.048) [-1646.281] (-1647.331) * (-1647.847) (-1645.613) [-1645.560] (-1645.676) -- 0:00:21 673500 -- (-1644.661) [-1643.878] (-1648.221) (-1647.708) * (-1644.246) (-1644.032) (-1645.810) [-1645.193] -- 0:00:21 674000 -- (-1644.437) (-1643.677) (-1643.265) [-1645.131] * [-1644.950] (-1647.537) (-1645.828) (-1644.868) -- 0:00:21 674500 -- (-1646.302) [-1645.251] (-1643.827) (-1644.669) * (-1650.250) (-1646.474) (-1643.992) [-1643.472] -- 0:00:21 675000 -- (-1644.611) (-1646.233) [-1645.480] (-1644.016) * (-1646.192) (-1644.927) (-1643.455) [-1645.163] -- 0:00:21 Average standard deviation of split frequencies: 0.011297 675500 -- (-1645.840) (-1643.906) [-1645.094] (-1643.972) * [-1648.335] (-1645.464) (-1645.228) (-1644.690) -- 0:00:21 676000 -- [-1643.065] (-1648.941) (-1645.149) (-1645.354) * (-1645.694) [-1643.605] (-1644.737) (-1645.000) -- 0:00:21 676500 -- (-1645.489) (-1650.076) (-1649.102) [-1644.889] * (-1653.052) (-1643.456) (-1645.385) [-1644.090] -- 0:00:21 677000 -- (-1643.981) (-1645.495) [-1647.338] (-1647.979) * (-1646.551) (-1643.111) (-1644.372) [-1645.616] -- 0:00:20 677500 -- (-1643.683) [-1644.616] (-1646.516) (-1645.490) * (-1644.233) (-1644.123) (-1643.677) [-1646.937] -- 0:00:20 678000 -- (-1646.076) (-1643.691) (-1645.450) [-1647.791] * (-1646.112) [-1643.302] (-1646.992) (-1643.636) -- 0:00:20 678500 -- (-1644.503) [-1644.232] (-1643.235) (-1644.037) * (-1650.618) (-1644.487) [-1643.894] (-1643.709) -- 0:00:20 679000 -- (-1649.419) [-1645.304] (-1644.300) (-1643.424) * (-1645.279) (-1644.401) (-1643.557) [-1645.439] -- 0:00:20 679500 -- (-1646.799) (-1644.212) [-1644.633] (-1645.136) * [-1644.501] (-1645.885) (-1644.673) (-1645.671) -- 0:00:20 680000 -- (-1643.099) (-1647.322) (-1649.030) [-1643.354] * (-1647.530) [-1644.718] (-1645.491) (-1644.487) -- 0:00:20 Average standard deviation of split frequencies: 0.011035 680500 -- (-1643.706) [-1644.465] (-1645.834) (-1642.815) * [-1647.314] (-1649.112) (-1646.524) (-1644.090) -- 0:00:20 681000 -- (-1644.750) (-1644.121) [-1644.313] (-1643.883) * (-1650.221) (-1645.259) [-1643.484] (-1645.440) -- 0:00:20 681500 -- [-1644.566] (-1643.625) (-1646.959) (-1643.696) * (-1643.435) [-1645.361] (-1645.509) (-1644.294) -- 0:00:20 682000 -- (-1647.827) (-1643.661) (-1644.961) [-1647.538] * [-1643.464] (-1644.399) (-1646.214) (-1644.954) -- 0:00:20 682500 -- (-1647.126) (-1644.486) [-1644.954] (-1648.388) * (-1645.114) (-1644.418) (-1643.772) [-1646.557] -- 0:00:20 683000 -- (-1647.403) (-1646.115) [-1644.065] (-1646.213) * [-1645.320] (-1644.951) (-1643.511) (-1644.869) -- 0:00:20 683500 -- (-1648.012) (-1645.200) [-1645.235] (-1647.760) * [-1648.138] (-1646.571) (-1646.202) (-1645.215) -- 0:00:20 684000 -- (-1644.717) [-1644.278] (-1644.352) (-1649.086) * (-1644.913) [-1645.469] (-1647.497) (-1644.081) -- 0:00:20 684500 -- (-1645.251) [-1644.571] (-1643.309) (-1647.139) * (-1647.477) [-1644.298] (-1646.744) (-1644.842) -- 0:00:20 685000 -- (-1642.926) (-1645.298) (-1643.943) [-1644.149] * (-1643.795) (-1645.902) (-1644.719) [-1649.398] -- 0:00:20 Average standard deviation of split frequencies: 0.010674 685500 -- (-1644.091) (-1644.871) [-1643.623] (-1650.336) * [-1647.626] (-1644.737) (-1650.931) (-1648.919) -- 0:00:20 686000 -- (-1644.719) (-1646.344) [-1643.701] (-1644.059) * (-1646.810) (-1645.889) [-1643.844] (-1645.670) -- 0:00:20 686500 -- (-1651.028) (-1648.017) (-1644.051) [-1644.966] * (-1644.473) (-1648.542) (-1643.602) [-1644.235] -- 0:00:20 687000 -- (-1646.172) (-1646.447) (-1645.429) [-1644.723] * [-1644.723] (-1644.113) (-1644.448) (-1644.527) -- 0:00:20 687500 -- [-1646.421] (-1644.263) (-1645.362) (-1645.531) * (-1644.526) (-1647.719) (-1644.668) [-1644.746] -- 0:00:20 688000 -- (-1645.540) (-1643.590) [-1644.649] (-1647.530) * (-1646.980) [-1644.266] (-1644.913) (-1646.085) -- 0:00:20 688500 -- (-1644.510) [-1646.329] (-1644.750) (-1646.073) * [-1646.395] (-1644.053) (-1645.590) (-1643.316) -- 0:00:20 689000 -- [-1646.434] (-1647.436) (-1644.859) (-1644.278) * (-1646.292) (-1643.593) (-1651.189) [-1643.588] -- 0:00:20 689500 -- (-1644.825) [-1644.130] (-1644.614) (-1647.565) * (-1646.479) (-1644.136) [-1644.146] (-1643.565) -- 0:00:20 690000 -- [-1644.634] (-1644.015) (-1644.381) (-1643.109) * [-1647.413] (-1643.687) (-1646.435) (-1644.482) -- 0:00:20 Average standard deviation of split frequencies: 0.010056 690500 -- (-1642.850) [-1644.310] (-1644.909) (-1643.259) * (-1645.427) (-1644.639) (-1643.893) [-1647.046] -- 0:00:20 691000 -- (-1647.022) (-1643.727) [-1644.996] (-1644.188) * [-1646.483] (-1647.689) (-1644.597) (-1648.460) -- 0:00:20 691500 -- [-1647.315] (-1645.800) (-1645.216) (-1644.629) * (-1647.829) (-1645.564) (-1646.100) [-1643.813] -- 0:00:20 692000 -- (-1645.320) (-1647.060) [-1647.068] (-1644.464) * (-1644.225) (-1644.754) [-1646.225] (-1644.391) -- 0:00:20 692500 -- (-1645.604) (-1644.906) (-1645.581) [-1644.825] * [-1644.849] (-1646.142) (-1648.949) (-1643.418) -- 0:00:19 693000 -- (-1645.639) [-1646.967] (-1644.540) (-1647.530) * [-1643.865] (-1646.320) (-1643.858) (-1643.472) -- 0:00:19 693500 -- [-1643.874] (-1643.620) (-1643.407) (-1643.022) * (-1643.857) [-1649.024] (-1645.127) (-1645.483) -- 0:00:19 694000 -- (-1643.640) (-1643.024) [-1643.439] (-1643.234) * [-1644.035] (-1644.886) (-1645.815) (-1645.789) -- 0:00:19 694500 -- (-1643.106) (-1646.351) (-1646.007) [-1643.708] * (-1643.537) (-1645.782) (-1647.057) [-1645.514] -- 0:00:19 695000 -- [-1643.106] (-1646.017) (-1645.509) (-1646.307) * [-1643.767] (-1648.272) (-1645.419) (-1643.896) -- 0:00:19 Average standard deviation of split frequencies: 0.009618 695500 -- (-1643.111) [-1652.302] (-1648.321) (-1644.945) * (-1644.501) (-1645.201) [-1643.384] (-1648.996) -- 0:00:19 696000 -- [-1643.900] (-1646.758) (-1644.374) (-1642.975) * (-1644.076) [-1645.462] (-1643.898) (-1647.171) -- 0:00:19 696500 -- (-1643.114) (-1645.137) [-1643.848] (-1643.955) * [-1645.391] (-1645.404) (-1644.648) (-1646.305) -- 0:00:19 697000 -- (-1644.547) (-1647.008) (-1646.216) [-1644.582] * (-1643.181) (-1643.713) [-1646.161] (-1646.410) -- 0:00:19 697500 -- (-1645.348) (-1645.768) [-1651.624] (-1648.563) * (-1644.097) (-1644.478) [-1644.002] (-1644.867) -- 0:00:19 698000 -- (-1651.076) (-1644.859) (-1647.268) [-1645.848] * (-1644.308) [-1645.286] (-1644.141) (-1644.043) -- 0:00:19 698500 -- [-1646.817] (-1644.843) (-1644.394) (-1646.740) * (-1645.921) [-1645.127] (-1645.869) (-1644.531) -- 0:00:19 699000 -- (-1643.708) (-1644.478) (-1644.087) [-1645.267] * (-1647.346) (-1646.615) (-1646.574) [-1643.943] -- 0:00:19 699500 -- [-1645.252] (-1643.321) (-1646.573) (-1643.455) * (-1647.531) (-1647.049) [-1644.455] (-1643.693) -- 0:00:19 700000 -- [-1645.266] (-1644.026) (-1646.624) (-1644.369) * (-1644.500) [-1643.927] (-1649.893) (-1644.958) -- 0:00:19 Average standard deviation of split frequencies: 0.009105 700500 -- (-1643.858) (-1643.908) (-1643.537) [-1644.798] * (-1647.511) (-1649.765) [-1646.227] (-1646.753) -- 0:00:19 701000 -- (-1644.191) (-1645.398) (-1645.578) [-1645.350] * (-1646.131) (-1647.050) [-1647.490] (-1646.585) -- 0:00:19 701500 -- [-1643.818] (-1644.455) (-1646.025) (-1643.727) * (-1643.540) (-1646.265) [-1651.141] (-1646.029) -- 0:00:19 702000 -- (-1647.131) [-1644.455] (-1644.192) (-1644.542) * (-1644.963) (-1644.429) [-1645.454] (-1649.543) -- 0:00:19 702500 -- (-1647.953) (-1642.860) (-1643.445) [-1647.210] * (-1645.329) (-1645.816) (-1645.808) [-1647.326] -- 0:00:19 703000 -- (-1648.832) [-1646.326] (-1643.927) (-1644.288) * (-1643.756) (-1644.704) [-1646.897] (-1647.214) -- 0:00:19 703500 -- [-1644.633] (-1647.106) (-1644.042) (-1643.451) * [-1645.418] (-1643.698) (-1645.329) (-1645.757) -- 0:00:19 704000 -- (-1649.125) [-1643.478] (-1648.004) (-1650.703) * (-1645.738) [-1642.874] (-1643.649) (-1648.571) -- 0:00:19 704500 -- (-1646.278) (-1643.785) [-1644.602] (-1645.239) * (-1645.924) (-1646.695) [-1643.641] (-1648.513) -- 0:00:19 705000 -- [-1646.087] (-1644.111) (-1646.815) (-1645.094) * (-1643.887) [-1645.232] (-1643.417) (-1645.405) -- 0:00:19 Average standard deviation of split frequencies: 0.008680 705500 -- [-1645.564] (-1643.842) (-1648.606) (-1644.543) * (-1644.058) (-1644.090) [-1643.757] (-1648.522) -- 0:00:19 706000 -- (-1644.292) [-1643.489] (-1645.753) (-1645.291) * [-1648.788] (-1644.522) (-1643.367) (-1645.365) -- 0:00:19 706500 -- (-1643.689) (-1643.455) [-1644.393] (-1648.180) * (-1644.706) [-1644.932] (-1645.539) (-1645.327) -- 0:00:19 707000 -- (-1643.404) (-1643.883) [-1644.543] (-1648.821) * [-1646.004] (-1645.600) (-1646.531) (-1644.717) -- 0:00:19 707500 -- (-1643.390) [-1643.521] (-1644.695) (-1648.016) * [-1647.075] (-1647.035) (-1646.775) (-1645.928) -- 0:00:19 708000 -- (-1643.933) (-1646.146) [-1643.927] (-1647.849) * (-1650.561) (-1644.448) (-1647.812) [-1645.685] -- 0:00:18 708500 -- (-1644.997) [-1646.208] (-1643.926) (-1644.222) * [-1647.936] (-1644.432) (-1644.667) (-1644.470) -- 0:00:18 709000 -- [-1645.153] (-1646.947) (-1647.790) (-1644.249) * (-1648.607) (-1646.020) (-1644.583) [-1644.547] -- 0:00:18 709500 -- (-1645.461) [-1647.621] (-1643.657) (-1644.877) * [-1649.280] (-1644.351) (-1647.372) (-1646.670) -- 0:00:18 710000 -- (-1649.430) (-1643.348) [-1645.776] (-1648.304) * [-1646.949] (-1644.110) (-1646.764) (-1650.571) -- 0:00:18 Average standard deviation of split frequencies: 0.008491 710500 -- (-1643.961) [-1647.463] (-1644.364) (-1651.019) * (-1644.433) (-1650.464) [-1647.915] (-1645.981) -- 0:00:18 711000 -- [-1643.475] (-1649.153) (-1648.939) (-1647.567) * [-1646.500] (-1648.254) (-1643.525) (-1647.469) -- 0:00:18 711500 -- (-1643.774) (-1649.192) (-1644.727) [-1644.942] * (-1646.717) (-1644.813) [-1645.485] (-1647.527) -- 0:00:18 712000 -- (-1644.773) [-1647.039] (-1645.602) (-1644.856) * (-1643.976) (-1643.785) [-1647.409] (-1644.619) -- 0:00:18 712500 -- (-1645.170) [-1644.044] (-1649.536) (-1646.265) * (-1643.828) (-1643.652) [-1644.068] (-1645.470) -- 0:00:18 713000 -- (-1644.559) (-1645.692) [-1646.684] (-1643.634) * (-1647.778) [-1643.767] (-1644.507) (-1646.263) -- 0:00:18 713500 -- (-1643.182) [-1643.830] (-1648.471) (-1644.070) * [-1643.107] (-1643.680) (-1644.264) (-1645.177) -- 0:00:18 714000 -- (-1644.886) [-1643.699] (-1646.076) (-1644.050) * (-1642.991) [-1643.059] (-1645.356) (-1647.890) -- 0:00:18 714500 -- (-1645.118) (-1643.802) [-1645.854] (-1644.588) * (-1644.181) (-1643.029) (-1644.470) [-1644.744] -- 0:00:18 715000 -- [-1645.165] (-1644.759) (-1647.868) (-1645.719) * (-1644.966) (-1643.949) [-1644.173] (-1649.350) -- 0:00:18 Average standard deviation of split frequencies: 0.008208 715500 -- (-1643.933) [-1644.288] (-1643.832) (-1643.869) * (-1646.567) [-1644.044] (-1643.790) (-1647.671) -- 0:00:18 716000 -- [-1643.849] (-1645.355) (-1644.945) (-1644.803) * (-1644.410) [-1643.586] (-1643.356) (-1645.946) -- 0:00:18 716500 -- (-1645.574) (-1644.259) (-1645.730) [-1645.323] * (-1644.515) (-1643.180) [-1643.148] (-1645.929) -- 0:00:18 717000 -- (-1644.013) (-1645.210) [-1643.512] (-1645.332) * [-1644.515] (-1647.155) (-1643.152) (-1647.762) -- 0:00:18 717500 -- (-1643.459) (-1646.550) (-1643.373) [-1644.795] * (-1646.064) (-1645.426) (-1647.687) [-1644.818] -- 0:00:18 718000 -- (-1644.487) (-1645.298) [-1645.435] (-1643.900) * (-1646.448) (-1651.456) [-1647.994] (-1648.368) -- 0:00:18 718500 -- (-1643.932) (-1646.078) [-1644.507] (-1647.531) * (-1650.045) (-1647.727) [-1644.937] (-1647.514) -- 0:00:18 719000 -- (-1644.290) [-1645.809] (-1648.387) (-1646.474) * (-1644.485) [-1645.989] (-1645.825) (-1643.768) -- 0:00:18 719500 -- (-1649.454) (-1645.833) [-1644.555] (-1644.966) * [-1644.575] (-1647.356) (-1644.260) (-1643.083) -- 0:00:18 720000 -- [-1646.317] (-1643.895) (-1646.762) (-1647.376) * (-1645.618) [-1646.755] (-1644.895) (-1643.085) -- 0:00:18 Average standard deviation of split frequencies: 0.007544 720500 -- (-1644.153) [-1648.816] (-1654.335) (-1644.342) * (-1645.223) [-1643.560] (-1643.736) (-1644.574) -- 0:00:18 721000 -- (-1644.106) (-1645.244) [-1645.314] (-1645.002) * (-1645.684) (-1643.574) (-1644.489) [-1645.923] -- 0:00:18 721500 -- [-1643.681] (-1646.034) (-1644.920) (-1646.365) * [-1644.496] (-1644.892) (-1643.811) (-1644.594) -- 0:00:18 722000 -- (-1643.738) (-1647.736) (-1647.058) [-1645.526] * (-1643.899) (-1646.226) [-1643.394] (-1644.276) -- 0:00:18 722500 -- (-1644.693) (-1645.263) [-1643.894] (-1644.538) * (-1645.611) [-1644.117] (-1647.104) (-1646.429) -- 0:00:18 723000 -- (-1646.832) [-1644.244] (-1644.172) (-1645.299) * (-1643.505) [-1644.189] (-1645.512) (-1651.999) -- 0:00:18 723500 -- [-1650.411] (-1646.526) (-1645.429) (-1646.089) * [-1643.097] (-1643.853) (-1647.845) (-1648.964) -- 0:00:17 724000 -- (-1644.010) (-1644.761) (-1643.561) [-1647.948] * [-1643.438] (-1642.890) (-1643.968) (-1647.694) -- 0:00:17 724500 -- [-1643.403] (-1643.920) (-1643.689) (-1646.961) * [-1643.121] (-1644.079) (-1643.967) (-1651.575) -- 0:00:17 725000 -- (-1645.288) [-1644.199] (-1644.296) (-1645.820) * (-1644.036) (-1650.880) [-1646.156] (-1646.964) -- 0:00:17 Average standard deviation of split frequencies: 0.007749 725500 -- (-1647.138) [-1643.109] (-1644.784) (-1644.883) * [-1643.777] (-1646.932) (-1646.007) (-1646.144) -- 0:00:17 726000 -- (-1647.746) [-1643.288] (-1645.523) (-1645.434) * (-1646.722) [-1644.921] (-1645.201) (-1647.368) -- 0:00:17 726500 -- (-1648.362) (-1644.656) [-1644.584] (-1643.400) * (-1643.500) (-1644.976) (-1647.507) [-1645.284] -- 0:00:17 727000 -- (-1645.879) (-1646.862) [-1644.757] (-1644.763) * (-1643.500) (-1642.867) (-1646.983) [-1646.723] -- 0:00:17 727500 -- [-1643.951] (-1645.588) (-1645.269) (-1647.093) * (-1644.723) (-1643.226) [-1643.917] (-1646.920) -- 0:00:17 728000 -- (-1646.584) [-1650.066] (-1646.901) (-1643.782) * (-1645.211) [-1642.790] (-1644.861) (-1644.870) -- 0:00:17 728500 -- [-1646.430] (-1648.947) (-1648.841) (-1643.884) * [-1644.149] (-1647.156) (-1645.755) (-1645.753) -- 0:00:17 729000 -- (-1646.685) (-1645.791) [-1645.759] (-1646.462) * (-1643.451) (-1645.032) [-1642.749] (-1643.540) -- 0:00:17 729500 -- (-1646.556) (-1648.642) (-1644.435) [-1645.488] * (-1644.126) [-1644.755] (-1643.091) (-1643.377) -- 0:00:17 730000 -- (-1647.428) (-1645.658) (-1645.955) [-1645.224] * (-1645.726) (-1646.775) [-1644.136] (-1644.053) -- 0:00:17 Average standard deviation of split frequencies: 0.007742 730500 -- (-1646.305) [-1645.478] (-1645.192) (-1647.502) * (-1646.136) (-1645.681) [-1644.431] (-1644.327) -- 0:00:17 731000 -- [-1644.969] (-1646.337) (-1645.044) (-1644.242) * (-1644.401) (-1644.725) [-1645.299] (-1646.686) -- 0:00:17 731500 -- (-1645.776) (-1644.634) [-1644.098] (-1645.776) * [-1645.437] (-1644.144) (-1644.886) (-1648.746) -- 0:00:17 732000 -- [-1645.137] (-1644.429) (-1646.538) (-1648.853) * (-1644.981) (-1645.236) [-1644.192] (-1650.253) -- 0:00:17 732500 -- (-1643.048) (-1643.889) (-1649.339) [-1645.134] * (-1646.493) [-1643.215] (-1645.346) (-1648.206) -- 0:00:17 733000 -- (-1645.885) (-1646.897) [-1646.435] (-1650.538) * (-1646.593) (-1643.196) [-1647.712] (-1644.932) -- 0:00:17 733500 -- (-1645.162) (-1648.470) [-1650.040] (-1646.764) * [-1643.519] (-1642.982) (-1648.601) (-1643.690) -- 0:00:17 734000 -- (-1652.347) (-1650.547) (-1649.102) [-1646.020] * (-1644.096) (-1646.945) (-1647.119) [-1643.636] -- 0:00:17 734500 -- (-1644.685) [-1649.221] (-1646.689) (-1644.435) * (-1642.885) (-1644.502) [-1645.436] (-1643.263) -- 0:00:17 735000 -- [-1643.917] (-1645.966) (-1644.739) (-1644.608) * (-1643.374) [-1645.527] (-1648.185) (-1644.542) -- 0:00:17 Average standard deviation of split frequencies: 0.007686 735500 -- [-1642.946] (-1645.130) (-1643.474) (-1646.559) * (-1645.335) [-1645.988] (-1643.934) (-1643.063) -- 0:00:17 736000 -- [-1642.965] (-1644.588) (-1644.512) (-1646.533) * (-1645.812) (-1650.620) (-1649.843) [-1645.725] -- 0:00:17 736500 -- (-1644.021) [-1643.565] (-1644.779) (-1644.680) * (-1645.629) [-1645.956] (-1647.165) (-1645.415) -- 0:00:17 737000 -- (-1650.761) (-1643.464) (-1645.519) [-1643.442] * (-1645.568) (-1643.960) [-1644.816] (-1647.236) -- 0:00:17 737500 -- (-1646.312) (-1645.838) [-1645.442] (-1647.854) * (-1643.916) (-1643.183) [-1643.319] (-1649.021) -- 0:00:17 738000 -- (-1649.547) (-1644.273) (-1645.988) [-1652.753] * (-1643.754) [-1644.585] (-1645.660) (-1650.734) -- 0:00:17 738500 -- [-1649.842] (-1645.163) (-1645.448) (-1645.575) * (-1645.139) (-1645.647) [-1645.535] (-1645.121) -- 0:00:16 739000 -- [-1650.423] (-1647.256) (-1644.602) (-1647.635) * (-1644.597) (-1644.947) [-1647.728] (-1644.842) -- 0:00:16 739500 -- (-1645.177) [-1644.886] (-1645.681) (-1645.994) * [-1644.177] (-1646.022) (-1644.106) (-1644.501) -- 0:00:16 740000 -- [-1645.085] (-1646.712) (-1648.954) (-1645.574) * (-1645.065) (-1643.870) [-1643.456] (-1648.409) -- 0:00:16 Average standard deviation of split frequencies: 0.007807 740500 -- (-1647.791) [-1646.500] (-1645.644) (-1646.054) * (-1646.017) (-1644.644) (-1643.678) [-1653.404] -- 0:00:16 741000 -- [-1643.562] (-1644.786) (-1646.384) (-1645.559) * (-1648.064) (-1642.903) [-1644.741] (-1644.503) -- 0:00:16 741500 -- [-1644.066] (-1644.733) (-1644.498) (-1647.587) * (-1645.750) (-1644.230) (-1645.212) [-1645.354] -- 0:00:16 742000 -- [-1646.767] (-1644.125) (-1653.670) (-1643.864) * [-1644.174] (-1644.050) (-1646.068) (-1645.463) -- 0:00:16 742500 -- (-1644.303) (-1643.966) (-1649.019) [-1643.764] * (-1644.344) (-1644.692) (-1645.694) [-1643.963] -- 0:00:16 743000 -- (-1644.423) (-1647.986) [-1647.504] (-1649.002) * [-1644.612] (-1644.158) (-1648.060) (-1644.309) -- 0:00:16 743500 -- (-1643.398) (-1647.681) (-1645.145) [-1648.422] * (-1644.738) [-1647.432] (-1646.985) (-1645.080) -- 0:00:16 744000 -- (-1643.998) (-1645.494) (-1645.822) [-1647.685] * [-1644.999] (-1647.134) (-1646.974) (-1644.306) -- 0:00:16 744500 -- (-1642.802) (-1644.832) (-1646.287) [-1647.900] * (-1648.586) (-1643.779) [-1645.709] (-1644.825) -- 0:00:16 745000 -- (-1645.359) [-1643.990] (-1647.372) (-1644.535) * [-1643.558] (-1643.233) (-1648.408) (-1643.169) -- 0:00:16 Average standard deviation of split frequencies: 0.007499 745500 -- (-1648.068) (-1645.901) [-1646.379] (-1647.285) * (-1645.012) [-1643.828] (-1649.890) (-1643.506) -- 0:00:16 746000 -- (-1649.317) [-1648.125] (-1647.691) (-1645.926) * (-1644.228) (-1644.583) [-1645.046] (-1643.313) -- 0:00:16 746500 -- (-1647.131) [-1644.341] (-1644.970) (-1646.037) * (-1646.343) (-1644.742) [-1645.655] (-1647.221) -- 0:00:16 747000 -- (-1647.743) (-1643.264) [-1645.452] (-1643.748) * (-1650.304) (-1642.987) [-1643.869] (-1645.676) -- 0:00:16 747500 -- (-1647.117) [-1644.139] (-1644.691) (-1645.274) * (-1646.314) (-1643.546) (-1644.351) [-1644.997] -- 0:00:16 748000 -- [-1646.525] (-1645.930) (-1644.973) (-1644.502) * [-1643.184] (-1644.011) (-1644.041) (-1648.727) -- 0:00:16 748500 -- (-1643.049) (-1644.591) (-1644.190) [-1646.643] * [-1650.586] (-1648.323) (-1647.054) (-1645.917) -- 0:00:16 749000 -- (-1644.414) (-1648.365) [-1645.145] (-1647.381) * (-1644.757) (-1645.944) (-1645.928) [-1644.858] -- 0:00:16 749500 -- (-1644.163) [-1648.360] (-1643.614) (-1649.251) * (-1645.604) (-1644.557) [-1644.989] (-1644.857) -- 0:00:16 750000 -- (-1645.909) [-1644.606] (-1643.383) (-1646.591) * [-1647.253] (-1645.019) (-1644.298) (-1647.679) -- 0:00:16 Average standard deviation of split frequencies: 0.007201 750500 -- [-1644.071] (-1643.682) (-1642.849) (-1647.416) * (-1651.031) (-1644.068) (-1645.643) [-1645.213] -- 0:00:16 751000 -- [-1643.319] (-1645.615) (-1644.388) (-1646.900) * [-1642.978] (-1647.013) (-1644.595) (-1644.191) -- 0:00:16 751500 -- (-1644.745) (-1645.988) (-1645.112) [-1650.693] * [-1644.962] (-1645.964) (-1646.776) (-1647.749) -- 0:00:16 752000 -- (-1644.455) (-1643.660) (-1645.206) [-1644.270] * [-1643.905] (-1644.838) (-1644.377) (-1648.233) -- 0:00:16 752500 -- [-1646.428] (-1649.943) (-1646.238) (-1643.589) * [-1643.561] (-1643.630) (-1644.194) (-1645.389) -- 0:00:16 753000 -- (-1649.128) [-1643.967] (-1649.956) (-1643.815) * (-1643.966) (-1649.834) [-1645.962] (-1645.224) -- 0:00:16 753500 -- (-1645.949) (-1644.532) (-1645.483) [-1644.176] * (-1643.499) [-1646.125] (-1649.985) (-1645.330) -- 0:00:16 754000 -- [-1644.209] (-1651.848) (-1648.835) (-1644.694) * (-1644.265) [-1646.915] (-1646.196) (-1645.304) -- 0:00:15 754500 -- [-1644.803] (-1645.961) (-1644.286) (-1644.224) * (-1643.949) (-1648.712) (-1645.357) [-1644.772] -- 0:00:15 755000 -- [-1643.573] (-1646.347) (-1644.927) (-1644.606) * (-1646.572) (-1644.269) (-1646.624) [-1644.831] -- 0:00:15 Average standard deviation of split frequencies: 0.007441 755500 -- (-1643.311) (-1644.686) (-1643.125) [-1644.738] * [-1644.930] (-1644.076) (-1650.153) (-1644.586) -- 0:00:15 756000 -- [-1643.278] (-1645.162) (-1647.383) (-1647.592) * [-1644.268] (-1644.687) (-1646.022) (-1644.674) -- 0:00:15 756500 -- (-1644.600) (-1646.006) (-1647.140) [-1644.489] * [-1646.357] (-1646.720) (-1649.894) (-1646.227) -- 0:00:15 757000 -- (-1646.524) (-1650.326) (-1644.995) [-1643.331] * (-1644.461) (-1647.028) [-1648.660] (-1645.261) -- 0:00:15 757500 -- [-1644.382] (-1643.316) (-1646.260) (-1647.111) * (-1644.119) [-1646.322] (-1644.898) (-1644.819) -- 0:00:15 758000 -- (-1644.187) (-1643.676) [-1649.578] (-1646.497) * (-1644.971) (-1643.755) (-1647.094) [-1643.830] -- 0:00:15 758500 -- [-1644.647] (-1646.045) (-1644.508) (-1645.896) * (-1644.470) [-1643.258] (-1645.264) (-1643.107) -- 0:00:15 759000 -- (-1644.719) [-1645.549] (-1643.523) (-1645.749) * (-1644.232) [-1643.837] (-1648.981) (-1645.753) -- 0:00:15 759500 -- [-1645.044] (-1645.802) (-1642.862) (-1645.724) * (-1649.326) (-1643.347) (-1646.447) [-1646.955] -- 0:00:15 760000 -- (-1649.950) (-1646.295) [-1646.095] (-1643.234) * [-1643.703] (-1645.652) (-1644.298) (-1644.295) -- 0:00:15 Average standard deviation of split frequencies: 0.007561 760500 -- (-1649.637) (-1645.328) [-1645.298] (-1642.725) * (-1645.701) [-1645.404] (-1644.437) (-1646.405) -- 0:00:15 761000 -- (-1646.483) [-1642.827] (-1646.834) (-1644.320) * (-1645.964) (-1644.696) [-1644.992] (-1645.387) -- 0:00:15 761500 -- (-1646.818) (-1645.603) (-1645.312) [-1644.793] * (-1646.152) [-1644.471] (-1645.154) (-1643.910) -- 0:00:15 762000 -- (-1643.894) (-1646.827) (-1644.098) [-1649.557] * (-1648.560) (-1645.022) [-1645.300] (-1645.115) -- 0:00:15 762500 -- (-1643.686) [-1646.473] (-1649.009) (-1648.001) * (-1648.123) [-1644.491] (-1645.983) (-1644.822) -- 0:00:15 763000 -- (-1644.482) (-1645.001) (-1644.563) [-1646.616] * (-1650.517) [-1644.147] (-1645.330) (-1644.056) -- 0:00:15 763500 -- (-1643.588) [-1644.304] (-1643.850) (-1650.504) * [-1645.146] (-1643.508) (-1645.316) (-1646.927) -- 0:00:15 764000 -- (-1646.619) [-1645.631] (-1644.029) (-1645.228) * (-1647.145) (-1647.814) [-1644.534] (-1643.891) -- 0:00:15 764500 -- (-1645.564) (-1645.505) (-1646.567) [-1643.456] * (-1644.689) (-1646.172) [-1644.214] (-1644.009) -- 0:00:15 765000 -- (-1645.148) [-1646.161] (-1645.615) (-1651.233) * [-1648.567] (-1645.504) (-1645.490) (-1644.688) -- 0:00:15 Average standard deviation of split frequencies: 0.007713 765500 -- (-1643.959) [-1644.172] (-1643.515) (-1644.380) * [-1649.781] (-1647.269) (-1643.658) (-1644.664) -- 0:00:15 766000 -- (-1650.246) (-1646.442) (-1647.992) [-1644.073] * (-1645.306) [-1650.400] (-1645.228) (-1645.784) -- 0:00:15 766500 -- (-1649.370) (-1646.088) (-1651.286) [-1644.874] * (-1645.220) [-1645.713] (-1643.620) (-1648.264) -- 0:00:15 767000 -- (-1649.901) (-1645.969) (-1645.128) [-1644.938] * (-1644.619) (-1644.623) (-1644.581) [-1642.924] -- 0:00:15 767500 -- (-1650.325) (-1648.971) [-1646.808] (-1646.296) * (-1643.764) (-1646.283) (-1644.633) [-1644.544] -- 0:00:15 768000 -- (-1644.707) (-1644.290) [-1645.031] (-1645.964) * [-1644.382] (-1645.125) (-1643.765) (-1646.311) -- 0:00:15 768500 -- [-1643.262] (-1644.031) (-1652.802) (-1646.242) * (-1644.681) [-1643.113] (-1645.308) (-1648.565) -- 0:00:15 769000 -- (-1647.037) [-1643.511] (-1646.795) (-1645.088) * (-1647.570) [-1643.234] (-1644.303) (-1650.529) -- 0:00:15 769500 -- (-1643.949) [-1645.317] (-1646.980) (-1644.522) * (-1646.471) (-1647.285) [-1647.131] (-1648.610) -- 0:00:14 770000 -- [-1643.744] (-1644.309) (-1647.471) (-1645.651) * [-1645.234] (-1646.863) (-1644.910) (-1645.917) -- 0:00:14 Average standard deviation of split frequencies: 0.007218 770500 -- (-1645.759) (-1644.337) (-1646.463) [-1651.590] * (-1644.226) (-1644.172) (-1643.871) [-1644.145] -- 0:00:14 771000 -- (-1646.193) (-1647.830) (-1647.857) [-1644.313] * (-1643.942) (-1645.633) (-1649.388) [-1643.776] -- 0:00:14 771500 -- [-1645.042] (-1648.946) (-1648.405) (-1649.375) * [-1644.171] (-1648.227) (-1644.897) (-1644.448) -- 0:00:14 772000 -- [-1643.454] (-1644.769) (-1642.904) (-1649.163) * [-1644.414] (-1647.682) (-1645.421) (-1645.519) -- 0:00:14 772500 -- [-1644.579] (-1644.831) (-1643.382) (-1644.131) * [-1643.902] (-1645.348) (-1644.618) (-1645.463) -- 0:00:14 773000 -- (-1643.813) (-1644.617) [-1643.575] (-1646.458) * (-1645.745) (-1642.980) (-1645.211) [-1646.351] -- 0:00:14 773500 -- (-1645.309) (-1647.142) (-1646.047) [-1644.348] * (-1643.028) (-1644.042) (-1646.348) [-1643.705] -- 0:00:14 774000 -- [-1642.951] (-1644.628) (-1648.779) (-1644.604) * (-1645.543) [-1643.513] (-1646.142) (-1647.321) -- 0:00:14 774500 -- [-1642.940] (-1645.001) (-1647.689) (-1645.417) * (-1643.175) (-1643.814) (-1646.831) [-1647.741] -- 0:00:14 775000 -- [-1643.864] (-1646.285) (-1654.749) (-1647.306) * (-1648.479) [-1643.592] (-1645.507) (-1647.218) -- 0:00:14 Average standard deviation of split frequencies: 0.007452 775500 -- [-1643.353] (-1643.753) (-1650.849) (-1645.445) * (-1645.575) (-1644.838) (-1645.843) [-1646.760] -- 0:00:14 776000 -- (-1643.736) (-1646.471) (-1644.887) [-1644.491] * (-1647.763) (-1644.107) [-1645.535] (-1647.350) -- 0:00:14 776500 -- [-1648.306] (-1644.156) (-1645.807) (-1645.606) * (-1645.426) [-1644.161] (-1648.983) (-1647.590) -- 0:00:14 777000 -- (-1643.917) (-1642.915) (-1645.280) [-1644.870] * [-1645.532] (-1646.145) (-1645.501) (-1658.704) -- 0:00:14 777500 -- (-1644.029) [-1642.795] (-1644.076) (-1645.405) * (-1646.244) (-1643.649) (-1645.007) [-1648.657] -- 0:00:14 778000 -- [-1643.532] (-1643.977) (-1647.790) (-1643.771) * (-1643.843) (-1650.793) (-1644.735) [-1645.039] -- 0:00:14 778500 -- (-1643.876) (-1643.532) [-1643.556] (-1644.093) * (-1644.240) (-1647.365) [-1644.466] (-1645.635) -- 0:00:14 779000 -- [-1643.824] (-1644.155) (-1646.295) (-1645.527) * (-1643.688) (-1644.315) [-1647.583] (-1648.614) -- 0:00:14 779500 -- [-1645.518] (-1648.781) (-1644.666) (-1645.181) * (-1647.789) (-1646.587) (-1653.952) [-1647.330] -- 0:00:14 780000 -- [-1643.796] (-1648.308) (-1646.292) (-1645.019) * [-1649.628] (-1647.770) (-1649.891) (-1643.314) -- 0:00:14 Average standard deviation of split frequencies: 0.006642 780500 -- [-1646.804] (-1644.795) (-1645.501) (-1645.012) * (-1657.607) [-1644.466] (-1649.525) (-1648.099) -- 0:00:14 781000 -- (-1648.253) (-1645.395) (-1646.307) [-1643.186] * (-1649.269) (-1643.838) [-1644.766] (-1646.839) -- 0:00:14 781500 -- [-1648.446] (-1643.767) (-1648.300) (-1643.539) * (-1650.368) (-1645.231) [-1645.589] (-1644.704) -- 0:00:14 782000 -- (-1644.171) (-1643.141) [-1644.025] (-1643.774) * (-1645.233) [-1643.078] (-1645.412) (-1643.224) -- 0:00:14 782500 -- (-1645.843) (-1644.293) [-1646.560] (-1643.879) * (-1645.017) [-1649.656] (-1647.545) (-1643.539) -- 0:00:14 783000 -- [-1648.050] (-1644.571) (-1646.624) (-1644.254) * (-1645.038) (-1648.597) [-1644.791] (-1644.796) -- 0:00:14 783500 -- (-1644.172) [-1644.522] (-1645.786) (-1647.292) * (-1644.437) [-1646.081] (-1644.572) (-1645.582) -- 0:00:14 784000 -- (-1646.050) [-1645.280] (-1643.423) (-1644.570) * [-1644.287] (-1646.358) (-1652.831) (-1643.574) -- 0:00:14 784500 -- (-1644.978) (-1644.757) (-1649.701) [-1646.154] * (-1645.432) [-1646.902] (-1647.782) (-1646.642) -- 0:00:14 785000 -- (-1644.414) [-1643.320] (-1648.902) (-1644.509) * (-1648.449) [-1645.076] (-1643.976) (-1645.725) -- 0:00:13 Average standard deviation of split frequencies: 0.006197 785500 -- [-1645.600] (-1647.171) (-1647.323) (-1645.030) * (-1647.635) (-1644.992) [-1643.556] (-1645.066) -- 0:00:13 786000 -- [-1645.656] (-1648.944) (-1645.783) (-1647.818) * [-1648.464] (-1646.375) (-1645.572) (-1644.370) -- 0:00:13 786500 -- (-1649.102) (-1643.226) [-1645.146] (-1643.667) * [-1643.541] (-1646.093) (-1644.737) (-1644.836) -- 0:00:13 787000 -- (-1643.561) [-1643.709] (-1647.043) (-1644.744) * [-1643.666] (-1646.025) (-1644.738) (-1645.103) -- 0:00:13 787500 -- [-1648.279] (-1643.917) (-1646.372) (-1643.555) * (-1644.564) (-1647.651) (-1643.587) [-1645.474] -- 0:00:13 788000 -- (-1646.191) (-1646.230) [-1644.783] (-1646.734) * [-1647.197] (-1649.151) (-1646.181) (-1645.931) -- 0:00:13 788500 -- (-1646.650) [-1647.578] (-1646.944) (-1650.349) * (-1645.606) (-1646.855) [-1646.223] (-1642.945) -- 0:00:13 789000 -- (-1645.314) (-1647.560) (-1645.067) [-1646.530] * (-1645.089) (-1646.790) (-1648.416) [-1644.074] -- 0:00:13 789500 -- (-1646.300) (-1643.532) [-1647.619] (-1644.031) * (-1647.998) [-1644.953] (-1643.321) (-1646.444) -- 0:00:13 790000 -- (-1645.878) (-1643.684) (-1643.911) [-1643.136] * (-1643.803) [-1644.407] (-1645.823) (-1648.300) -- 0:00:13 Average standard deviation of split frequencies: 0.006439 790500 -- (-1649.477) (-1646.207) (-1643.378) [-1644.946] * (-1645.855) (-1647.738) (-1646.080) [-1643.955] -- 0:00:13 791000 -- (-1644.834) (-1645.273) (-1643.925) [-1645.309] * (-1645.373) [-1644.360] (-1643.830) (-1643.754) -- 0:00:13 791500 -- [-1646.063] (-1644.434) (-1643.976) (-1645.238) * (-1643.341) [-1644.721] (-1645.301) (-1648.860) -- 0:00:13 792000 -- [-1647.217] (-1645.427) (-1645.380) (-1643.393) * (-1644.043) [-1643.461] (-1645.793) (-1644.480) -- 0:00:13 792500 -- (-1647.704) (-1646.637) (-1648.598) [-1642.915] * [-1643.156] (-1648.050) (-1645.932) (-1645.170) -- 0:00:13 793000 -- (-1647.465) (-1646.710) (-1643.965) [-1643.004] * (-1647.579) (-1646.100) [-1646.152] (-1645.940) -- 0:00:13 793500 -- (-1645.297) [-1644.069] (-1645.189) (-1645.408) * (-1643.254) (-1648.337) (-1648.863) [-1647.117] -- 0:00:13 794000 -- (-1645.874) (-1645.204) (-1643.996) [-1646.822] * (-1646.847) (-1649.391) (-1645.576) [-1646.676] -- 0:00:13 794500 -- (-1643.016) (-1643.281) [-1643.913] (-1648.243) * (-1645.140) [-1645.295] (-1645.833) (-1649.573) -- 0:00:13 795000 -- [-1643.128] (-1643.401) (-1645.931) (-1643.812) * (-1646.504) (-1647.392) (-1650.360) [-1647.430] -- 0:00:13 Average standard deviation of split frequencies: 0.006396 795500 -- [-1645.235] (-1647.086) (-1645.203) (-1647.517) * (-1645.626) (-1649.594) [-1645.177] (-1646.932) -- 0:00:13 796000 -- (-1644.106) (-1645.820) [-1646.687] (-1643.853) * (-1647.396) [-1647.038] (-1644.837) (-1645.143) -- 0:00:13 796500 -- (-1643.359) [-1645.938] (-1648.442) (-1645.293) * (-1643.429) (-1644.069) (-1645.480) [-1645.455] -- 0:00:13 797000 -- (-1646.628) (-1645.373) (-1648.476) [-1646.108] * (-1643.195) (-1647.671) [-1646.887] (-1645.899) -- 0:00:13 797500 -- (-1647.725) [-1646.014] (-1646.404) (-1644.852) * [-1644.389] (-1647.506) (-1643.352) (-1646.634) -- 0:00:13 798000 -- [-1645.303] (-1644.973) (-1647.819) (-1648.677) * (-1644.124) (-1648.097) [-1647.999] (-1649.111) -- 0:00:13 798500 -- [-1643.450] (-1645.792) (-1645.261) (-1648.964) * (-1643.777) [-1645.722] (-1648.298) (-1647.431) -- 0:00:13 799000 -- (-1649.557) (-1644.783) [-1643.338] (-1649.304) * (-1645.198) (-1644.238) [-1645.660] (-1646.213) -- 0:00:13 799500 -- (-1643.636) [-1644.555] (-1647.875) (-1644.548) * (-1646.733) (-1644.166) (-1644.818) [-1645.761] -- 0:00:13 800000 -- (-1650.839) [-1643.769] (-1643.961) (-1643.826) * (-1644.443) [-1643.092] (-1647.980) (-1644.803) -- 0:00:12 Average standard deviation of split frequencies: 0.006712 800500 -- [-1645.304] (-1645.849) (-1644.274) (-1645.236) * (-1644.943) [-1644.799] (-1650.674) (-1646.454) -- 0:00:12 801000 -- (-1644.374) [-1645.096] (-1647.684) (-1643.931) * [-1644.108] (-1650.064) (-1649.882) (-1651.165) -- 0:00:12 801500 -- [-1642.907] (-1645.534) (-1645.995) (-1643.329) * [-1646.469] (-1644.667) (-1645.653) (-1647.632) -- 0:00:12 802000 -- (-1643.596) [-1644.558] (-1646.335) (-1644.640) * (-1649.102) (-1645.214) [-1644.805] (-1645.669) -- 0:00:12 802500 -- (-1645.480) (-1644.525) [-1643.070] (-1647.435) * (-1643.501) (-1647.881) (-1644.269) [-1644.597] -- 0:00:12 803000 -- (-1644.841) (-1645.493) [-1646.828] (-1647.304) * (-1646.473) (-1647.825) [-1646.922] (-1643.763) -- 0:00:12 803500 -- [-1644.879] (-1648.388) (-1644.796) (-1654.312) * (-1644.039) [-1648.432] (-1644.606) (-1642.930) -- 0:00:12 804000 -- (-1647.790) (-1647.581) [-1645.352] (-1645.853) * [-1644.871] (-1649.392) (-1645.315) (-1643.460) -- 0:00:12 804500 -- [-1649.112] (-1645.680) (-1643.332) (-1647.917) * (-1645.096) (-1647.253) [-1649.438] (-1643.876) -- 0:00:12 805000 -- (-1650.787) [-1644.874] (-1643.947) (-1648.827) * (-1644.719) [-1648.599] (-1647.699) (-1653.107) -- 0:00:12 Average standard deviation of split frequencies: 0.006629 805500 -- [-1644.307] (-1645.331) (-1642.990) (-1647.940) * [-1644.021] (-1644.635) (-1644.074) (-1648.774) -- 0:00:12 806000 -- (-1643.738) (-1645.893) [-1644.007] (-1644.756) * (-1644.499) [-1643.990] (-1643.755) (-1644.521) -- 0:00:12 806500 -- (-1645.456) (-1644.531) [-1644.351] (-1642.809) * (-1646.371) [-1643.597] (-1645.142) (-1644.264) -- 0:00:12 807000 -- (-1644.434) (-1644.005) [-1645.896] (-1643.754) * (-1646.448) (-1643.718) [-1644.519] (-1643.749) -- 0:00:12 807500 -- (-1646.095) [-1644.190] (-1649.137) (-1646.767) * (-1646.724) [-1645.076] (-1644.251) (-1644.977) -- 0:00:12 808000 -- (-1644.369) (-1646.242) [-1644.254] (-1645.970) * (-1645.678) (-1649.089) (-1644.755) [-1645.935] -- 0:00:12 808500 -- (-1643.921) [-1647.124] (-1647.499) (-1644.671) * [-1644.205] (-1648.163) (-1645.913) (-1645.847) -- 0:00:12 809000 -- (-1644.078) (-1646.534) (-1646.222) [-1645.000] * (-1644.066) [-1645.917] (-1644.840) (-1648.498) -- 0:00:12 809500 -- [-1644.879] (-1646.286) (-1643.631) (-1644.753) * (-1643.948) (-1646.353) [-1643.653] (-1647.101) -- 0:00:12 810000 -- (-1644.044) (-1645.066) (-1648.999) [-1645.540] * (-1645.364) (-1648.143) (-1652.316) [-1649.556] -- 0:00:12 Average standard deviation of split frequencies: 0.006241 810500 -- (-1644.733) (-1645.370) (-1644.683) [-1647.487] * (-1645.007) (-1643.670) (-1649.791) [-1647.205] -- 0:00:12 811000 -- (-1644.628) (-1644.735) [-1643.672] (-1647.278) * (-1646.033) (-1643.174) (-1647.779) [-1647.393] -- 0:00:12 811500 -- (-1643.598) [-1644.591] (-1643.053) (-1645.138) * (-1644.313) (-1645.232) (-1645.115) [-1646.060] -- 0:00:12 812000 -- [-1644.013] (-1649.290) (-1643.086) (-1644.335) * (-1648.318) (-1644.784) (-1646.569) [-1644.896] -- 0:00:12 812500 -- (-1646.836) [-1646.620] (-1645.984) (-1643.404) * (-1646.439) (-1644.606) [-1645.072] (-1646.523) -- 0:00:12 813000 -- [-1643.160] (-1649.183) (-1646.576) (-1644.298) * (-1645.891) (-1645.416) (-1643.258) [-1646.122] -- 0:00:12 813500 -- [-1644.685] (-1645.444) (-1646.936) (-1644.760) * (-1644.693) (-1643.766) (-1644.186) [-1650.173] -- 0:00:12 814000 -- [-1647.212] (-1645.162) (-1645.703) (-1644.954) * (-1643.492) [-1642.991] (-1643.594) (-1643.231) -- 0:00:12 814500 -- (-1645.595) (-1645.478) (-1644.894) [-1646.669] * (-1643.772) (-1643.972) (-1644.003) [-1645.490] -- 0:00:12 815000 -- (-1643.427) (-1645.964) [-1644.864] (-1646.148) * (-1647.417) [-1644.638] (-1645.988) (-1643.822) -- 0:00:12 Average standard deviation of split frequencies: 0.006162 815500 -- (-1645.247) [-1646.053] (-1644.359) (-1644.039) * (-1646.379) [-1645.968] (-1647.779) (-1643.649) -- 0:00:11 816000 -- (-1643.720) [-1647.297] (-1643.030) (-1646.351) * [-1650.352] (-1643.098) (-1645.273) (-1643.998) -- 0:00:11 816500 -- [-1644.619] (-1652.301) (-1643.386) (-1645.920) * [-1646.364] (-1645.367) (-1644.982) (-1647.461) -- 0:00:11 817000 -- (-1647.018) (-1659.846) (-1644.463) [-1644.253] * (-1643.957) (-1645.131) (-1646.175) [-1644.850] -- 0:00:11 817500 -- (-1647.793) [-1644.926] (-1643.678) (-1645.635) * [-1644.080] (-1643.495) (-1645.570) (-1645.196) -- 0:00:11 818000 -- (-1644.218) [-1645.542] (-1645.707) (-1647.276) * [-1644.026] (-1646.525) (-1643.956) (-1646.234) -- 0:00:11 818500 -- (-1645.107) [-1644.076] (-1645.895) (-1647.253) * (-1644.828) (-1644.775) (-1645.950) [-1645.775] -- 0:00:11 819000 -- (-1646.292) (-1645.734) [-1646.181] (-1651.956) * (-1645.084) (-1647.106) [-1642.968] (-1649.094) -- 0:00:11 819500 -- [-1644.901] (-1643.650) (-1644.624) (-1644.545) * [-1645.204] (-1647.627) (-1642.754) (-1646.498) -- 0:00:11 820000 -- (-1644.042) (-1644.201) (-1645.565) [-1645.266] * (-1646.741) (-1645.685) (-1645.437) [-1644.734] -- 0:00:11 Average standard deviation of split frequencies: 0.006395 820500 -- (-1645.279) (-1643.478) (-1642.897) [-1642.738] * (-1645.403) [-1643.996] (-1643.483) (-1646.666) -- 0:00:11 821000 -- (-1646.449) (-1645.101) (-1643.647) [-1644.698] * (-1643.862) [-1644.492] (-1643.603) (-1647.018) -- 0:00:11 821500 -- (-1647.078) (-1646.941) (-1644.160) [-1646.802] * (-1644.109) (-1643.829) [-1647.407] (-1643.287) -- 0:00:11 822000 -- (-1644.247) (-1643.738) [-1645.134] (-1644.691) * (-1644.207) [-1643.821] (-1649.448) (-1653.302) -- 0:00:11 822500 -- (-1644.411) (-1645.547) [-1645.820] (-1649.207) * (-1644.672) [-1643.507] (-1645.673) (-1646.643) -- 0:00:11 823000 -- [-1644.751] (-1643.148) (-1645.478) (-1652.257) * (-1645.397) [-1643.495] (-1645.448) (-1646.965) -- 0:00:11 823500 -- (-1646.255) [-1644.766] (-1644.528) (-1646.470) * (-1644.202) [-1645.389] (-1645.144) (-1648.364) -- 0:00:11 824000 -- (-1644.381) [-1643.896] (-1645.354) (-1647.183) * (-1650.190) [-1645.003] (-1647.557) (-1645.350) -- 0:00:11 824500 -- (-1646.759) (-1643.901) [-1646.339] (-1647.006) * (-1644.936) (-1645.045) (-1643.598) [-1644.160] -- 0:00:11 825000 -- (-1645.228) (-1645.088) [-1644.938] (-1645.366) * [-1646.327] (-1644.264) (-1645.144) (-1645.043) -- 0:00:11 Average standard deviation of split frequencies: 0.006392 825500 -- (-1647.362) (-1646.731) (-1643.626) [-1645.482] * (-1645.771) [-1644.966] (-1645.308) (-1644.084) -- 0:00:11 826000 -- [-1646.837] (-1644.814) (-1649.387) (-1644.792) * (-1644.279) [-1645.968] (-1644.614) (-1648.133) -- 0:00:11 826500 -- (-1645.447) (-1643.780) (-1648.510) [-1644.779] * [-1644.428] (-1644.822) (-1647.988) (-1643.874) -- 0:00:11 827000 -- (-1647.427) (-1644.979) [-1645.728] (-1646.961) * (-1644.288) (-1647.227) (-1645.760) [-1643.067] -- 0:00:11 827500 -- (-1644.550) (-1642.997) (-1644.062) [-1648.125] * (-1644.845) [-1646.157] (-1647.160) (-1644.770) -- 0:00:11 828000 -- [-1644.520] (-1646.179) (-1644.057) (-1647.823) * (-1644.495) (-1648.088) [-1644.290] (-1645.932) -- 0:00:11 828500 -- (-1645.452) [-1648.025] (-1645.679) (-1643.842) * (-1647.610) [-1643.520] (-1646.659) (-1644.432) -- 0:00:11 829000 -- (-1644.255) (-1644.675) [-1645.490] (-1645.023) * (-1644.420) (-1644.216) (-1648.308) [-1643.908] -- 0:00:11 829500 -- (-1643.989) [-1644.306] (-1647.002) (-1647.814) * (-1647.505) (-1646.901) [-1649.668] (-1647.845) -- 0:00:11 830000 -- (-1645.142) (-1645.215) (-1648.623) [-1647.443] * (-1646.252) (-1651.989) [-1647.594] (-1646.091) -- 0:00:11 Average standard deviation of split frequencies: 0.006432 830500 -- (-1647.833) [-1645.414] (-1645.905) (-1648.711) * (-1645.694) [-1645.445] (-1647.156) (-1643.110) -- 0:00:11 831000 -- (-1646.590) (-1651.157) (-1643.186) [-1644.867] * [-1650.775] (-1644.894) (-1648.691) (-1644.675) -- 0:00:10 831500 -- [-1644.282] (-1646.214) (-1643.034) (-1643.478) * [-1645.843] (-1644.675) (-1643.702) (-1648.209) -- 0:00:10 832000 -- (-1644.618) (-1645.544) (-1643.410) [-1644.098] * (-1646.515) [-1643.642] (-1653.857) (-1646.137) -- 0:00:10 832500 -- (-1644.060) [-1644.957] (-1643.394) (-1643.640) * [-1646.965] (-1646.003) (-1644.546) (-1650.737) -- 0:00:10 833000 -- (-1647.140) (-1644.216) (-1646.433) [-1645.306] * (-1645.254) [-1645.679] (-1652.129) (-1644.113) -- 0:00:10 833500 -- (-1646.360) [-1643.680] (-1646.262) (-1645.888) * (-1644.424) [-1643.952] (-1647.945) (-1643.448) -- 0:00:10 834000 -- (-1648.862) (-1643.793) [-1644.133] (-1643.248) * (-1644.295) [-1644.846] (-1646.171) (-1647.471) -- 0:00:10 834500 -- (-1646.178) (-1644.321) (-1645.775) [-1645.059] * (-1645.782) [-1645.848] (-1647.726) (-1645.758) -- 0:00:10 835000 -- (-1643.848) (-1644.330) (-1647.050) [-1644.685] * (-1646.826) (-1645.956) (-1643.637) [-1644.276] -- 0:00:10 Average standard deviation of split frequencies: 0.005977 835500 -- (-1644.969) [-1650.274] (-1647.188) (-1646.926) * [-1647.342] (-1649.191) (-1645.131) (-1643.654) -- 0:00:10 836000 -- [-1645.818] (-1651.554) (-1647.820) (-1647.146) * [-1644.536] (-1643.715) (-1644.656) (-1645.755) -- 0:00:10 836500 -- [-1645.721] (-1648.529) (-1644.750) (-1645.547) * (-1643.728) (-1645.592) (-1647.482) [-1645.359] -- 0:00:10 837000 -- (-1644.202) (-1646.783) [-1645.681] (-1642.996) * (-1643.447) (-1644.593) (-1646.343) [-1643.486] -- 0:00:10 837500 -- [-1645.694] (-1646.299) (-1644.047) (-1643.050) * (-1647.628) [-1643.351] (-1646.300) (-1645.838) -- 0:00:10 838000 -- (-1646.317) (-1644.814) (-1645.119) [-1643.504] * (-1648.527) [-1643.413] (-1649.126) (-1645.040) -- 0:00:10 838500 -- [-1643.159] (-1647.329) (-1645.442) (-1645.815) * (-1646.701) [-1642.803] (-1644.146) (-1645.201) -- 0:00:10 839000 -- [-1644.233] (-1643.637) (-1649.523) (-1645.823) * (-1645.619) (-1642.819) [-1643.359] (-1644.662) -- 0:00:10 839500 -- [-1643.556] (-1643.991) (-1646.468) (-1646.324) * (-1644.152) (-1643.677) (-1644.644) [-1644.998] -- 0:00:10 840000 -- (-1643.524) (-1646.528) [-1647.505] (-1643.692) * (-1644.449) [-1644.161] (-1649.499) (-1646.631) -- 0:00:10 Average standard deviation of split frequencies: 0.005907 840500 -- (-1643.551) [-1646.422] (-1645.166) (-1643.266) * (-1647.050) (-1643.174) [-1648.047] (-1645.185) -- 0:00:10 841000 -- [-1643.657] (-1645.268) (-1646.624) (-1647.416) * (-1643.408) (-1646.882) [-1643.185] (-1643.501) -- 0:00:10 841500 -- (-1645.707) (-1646.521) (-1643.992) [-1646.661] * (-1643.441) [-1646.603] (-1642.813) (-1644.171) -- 0:00:10 842000 -- (-1643.403) (-1647.486) [-1644.540] (-1644.639) * (-1643.679) [-1646.828] (-1644.818) (-1644.848) -- 0:00:10 842500 -- (-1644.897) (-1646.934) (-1645.497) [-1643.621] * [-1645.818] (-1643.001) (-1645.262) (-1646.086) -- 0:00:10 843000 -- (-1643.757) [-1643.361] (-1644.885) (-1643.862) * (-1644.461) (-1642.907) (-1643.598) [-1648.492] -- 0:00:10 843500 -- [-1646.059] (-1645.561) (-1643.428) (-1644.677) * [-1643.909] (-1644.435) (-1644.442) (-1646.929) -- 0:00:10 844000 -- (-1643.739) [-1645.316] (-1645.590) (-1644.515) * (-1644.766) (-1647.569) [-1644.352] (-1644.798) -- 0:00:10 844500 -- (-1646.429) (-1648.871) [-1646.356] (-1643.611) * (-1645.294) (-1646.241) (-1648.767) [-1645.080] -- 0:00:10 845000 -- (-1645.132) (-1651.778) [-1645.984] (-1645.869) * (-1646.187) (-1643.988) [-1643.467] (-1644.467) -- 0:00:10 Average standard deviation of split frequencies: 0.005572 845500 -- (-1644.867) (-1647.674) (-1645.487) [-1648.394] * (-1647.196) [-1643.988] (-1644.129) (-1644.972) -- 0:00:10 846000 -- (-1645.043) (-1644.855) (-1644.424) [-1646.911] * (-1644.465) (-1644.427) (-1645.770) [-1644.934] -- 0:00:10 846500 -- [-1644.267] (-1644.038) (-1650.569) (-1646.083) * (-1642.821) (-1645.116) (-1646.550) [-1643.859] -- 0:00:09 847000 -- (-1645.999) [-1644.115] (-1644.380) (-1644.776) * (-1643.761) (-1646.553) [-1646.304] (-1646.709) -- 0:00:09 847500 -- [-1647.305] (-1644.149) (-1645.738) (-1644.329) * [-1643.267] (-1645.632) (-1646.905) (-1646.267) -- 0:00:09 848000 -- (-1644.343) (-1647.654) (-1644.385) [-1646.358] * (-1643.421) (-1644.212) [-1644.646] (-1643.454) -- 0:00:09 848500 -- (-1643.030) (-1646.198) [-1647.334] (-1648.441) * [-1643.416] (-1644.074) (-1645.697) (-1647.009) -- 0:00:09 849000 -- (-1644.603) (-1650.997) [-1646.017] (-1643.971) * (-1646.097) (-1646.844) [-1643.268] (-1643.282) -- 0:00:09 849500 -- (-1644.408) (-1649.472) (-1647.685) [-1643.851] * (-1646.408) (-1650.435) (-1642.908) [-1645.336] -- 0:00:09 850000 -- (-1643.946) (-1644.445) (-1645.615) [-1647.873] * (-1645.655) (-1649.442) [-1642.944] (-1643.849) -- 0:00:09 Average standard deviation of split frequencies: 0.005542 850500 -- [-1644.538] (-1643.762) (-1645.666) (-1648.904) * (-1646.089) (-1647.903) [-1645.086] (-1644.877) -- 0:00:09 851000 -- [-1644.330] (-1643.438) (-1644.221) (-1648.081) * [-1643.905] (-1646.042) (-1646.944) (-1645.018) -- 0:00:09 851500 -- (-1648.027) (-1647.342) (-1646.237) [-1645.744] * (-1644.942) (-1643.875) [-1645.092] (-1646.233) -- 0:00:09 852000 -- (-1645.791) (-1647.583) (-1646.390) [-1643.756] * (-1649.151) (-1645.543) [-1644.993] (-1644.545) -- 0:00:09 852500 -- (-1644.682) (-1647.549) [-1644.615] (-1644.290) * (-1646.586) (-1645.771) [-1646.631] (-1645.368) -- 0:00:09 853000 -- [-1644.834] (-1647.017) (-1644.669) (-1644.505) * (-1645.658) (-1644.836) (-1646.810) [-1644.320] -- 0:00:09 853500 -- (-1645.749) (-1645.749) [-1644.244] (-1644.401) * (-1644.632) (-1643.771) [-1646.630] (-1644.240) -- 0:00:09 854000 -- (-1644.154) (-1650.335) [-1643.868] (-1650.374) * (-1644.839) (-1643.786) [-1643.970] (-1650.296) -- 0:00:09 854500 -- [-1645.629] (-1646.829) (-1644.006) (-1645.604) * (-1643.673) [-1643.157] (-1643.895) (-1645.679) -- 0:00:09 855000 -- (-1647.367) [-1645.728] (-1643.090) (-1646.479) * (-1645.640) (-1650.768) (-1645.463) [-1647.946] -- 0:00:09 Average standard deviation of split frequencies: 0.005837 855500 -- (-1645.019) [-1647.037] (-1643.795) (-1644.225) * [-1648.643] (-1645.998) (-1644.552) (-1647.727) -- 0:00:09 856000 -- (-1649.114) (-1647.427) (-1645.384) [-1644.310] * (-1645.489) (-1644.944) (-1644.547) [-1645.191] -- 0:00:09 856500 -- (-1647.341) (-1643.940) (-1645.173) [-1644.537] * [-1646.656] (-1643.922) (-1643.396) (-1644.813) -- 0:00:09 857000 -- [-1644.392] (-1643.642) (-1645.636) (-1644.601) * (-1647.162) (-1645.216) (-1643.978) [-1646.703] -- 0:00:09 857500 -- (-1646.421) [-1644.732] (-1644.225) (-1643.609) * (-1645.655) (-1645.848) [-1643.679] (-1645.388) -- 0:00:09 858000 -- [-1643.616] (-1643.714) (-1647.575) (-1644.969) * (-1643.442) (-1644.658) [-1644.133] (-1643.833) -- 0:00:09 858500 -- (-1644.437) (-1643.715) (-1643.827) [-1645.045] * (-1644.652) [-1644.816] (-1644.360) (-1645.951) -- 0:00:09 859000 -- [-1643.792] (-1645.193) (-1650.369) (-1645.284) * [-1644.843] (-1645.818) (-1643.347) (-1644.140) -- 0:00:09 859500 -- (-1643.674) (-1645.417) [-1648.061] (-1644.148) * (-1643.517) (-1644.467) (-1644.559) [-1644.284] -- 0:00:09 860000 -- (-1643.796) [-1645.443] (-1648.018) (-1643.660) * (-1644.447) (-1645.077) (-1648.554) [-1645.684] -- 0:00:09 Average standard deviation of split frequencies: 0.005441 860500 -- (-1648.540) (-1645.821) [-1645.262] (-1646.173) * (-1645.836) (-1644.297) (-1648.175) [-1645.820] -- 0:00:09 861000 -- (-1646.121) (-1647.873) (-1642.877) [-1645.902] * (-1644.181) (-1643.093) [-1643.585] (-1651.840) -- 0:00:09 861500 -- (-1649.523) [-1646.183] (-1643.990) (-1643.825) * [-1644.077] (-1648.957) (-1645.751) (-1648.900) -- 0:00:09 862000 -- (-1647.139) (-1644.567) [-1644.076] (-1645.334) * (-1643.523) [-1647.622] (-1648.410) (-1647.496) -- 0:00:08 862500 -- (-1650.221) (-1643.701) [-1647.549] (-1644.606) * (-1643.523) [-1643.893] (-1644.410) (-1648.361) -- 0:00:08 863000 -- [-1645.318] (-1645.008) (-1645.246) (-1644.273) * (-1649.459) (-1643.978) (-1643.847) [-1647.010] -- 0:00:08 863500 -- (-1645.708) (-1646.295) (-1645.905) [-1646.229] * (-1645.869) (-1645.554) [-1644.911] (-1646.886) -- 0:00:08 864000 -- (-1643.965) [-1643.333] (-1645.031) (-1643.585) * (-1644.704) [-1645.283] (-1643.749) (-1644.197) -- 0:00:08 864500 -- (-1644.190) (-1643.629) [-1644.953] (-1644.761) * (-1646.002) (-1647.630) (-1644.458) [-1643.185] -- 0:00:08 865000 -- (-1643.293) [-1644.138] (-1646.374) (-1646.246) * (-1644.207) (-1643.173) (-1645.356) [-1648.024] -- 0:00:08 Average standard deviation of split frequencies: 0.005589 865500 -- [-1644.246] (-1644.935) (-1646.560) (-1645.246) * [-1644.648] (-1643.176) (-1646.532) (-1644.781) -- 0:00:08 866000 -- [-1644.120] (-1648.139) (-1644.563) (-1645.293) * (-1645.434) (-1643.889) [-1648.217] (-1643.269) -- 0:00:08 866500 -- (-1643.433) (-1645.182) (-1644.221) [-1649.825] * (-1645.599) (-1644.274) (-1644.886) [-1644.392] -- 0:00:08 867000 -- (-1643.393) [-1646.245] (-1644.981) (-1647.711) * (-1649.372) [-1645.924] (-1643.798) (-1644.647) -- 0:00:08 867500 -- [-1647.463] (-1647.086) (-1644.200) (-1652.140) * (-1645.469) (-1645.956) (-1645.603) [-1644.719] -- 0:00:08 868000 -- (-1644.647) [-1645.199] (-1643.254) (-1648.649) * (-1649.308) (-1647.690) (-1644.641) [-1646.144] -- 0:00:08 868500 -- [-1644.359] (-1649.242) (-1643.311) (-1646.881) * (-1647.876) (-1643.828) [-1644.954] (-1645.571) -- 0:00:08 869000 -- [-1646.040] (-1645.374) (-1643.653) (-1645.042) * [-1646.857] (-1643.477) (-1644.614) (-1646.896) -- 0:00:08 869500 -- (-1643.703) [-1645.002] (-1645.913) (-1645.032) * (-1644.133) [-1644.999] (-1643.427) (-1646.330) -- 0:00:08 870000 -- [-1644.496] (-1645.946) (-1648.149) (-1645.028) * (-1647.699) [-1646.726] (-1644.973) (-1646.032) -- 0:00:08 Average standard deviation of split frequencies: 0.005559 870500 -- (-1643.854) (-1646.529) [-1645.248] (-1646.302) * (-1647.676) (-1645.758) (-1645.093) [-1646.362] -- 0:00:08 871000 -- (-1645.771) (-1643.894) [-1643.791] (-1644.217) * [-1651.283] (-1643.084) (-1646.405) (-1645.861) -- 0:00:08 871500 -- [-1643.262] (-1644.549) (-1645.338) (-1648.875) * [-1645.498] (-1646.260) (-1644.564) (-1644.546) -- 0:00:08 872000 -- (-1643.583) (-1646.933) [-1644.789] (-1647.811) * [-1645.605] (-1647.118) (-1643.161) (-1645.428) -- 0:00:08 872500 -- [-1643.561] (-1643.167) (-1645.083) (-1644.322) * [-1649.794] (-1645.235) (-1643.831) (-1642.811) -- 0:00:08 873000 -- (-1646.052) (-1647.004) [-1643.435] (-1643.668) * (-1643.472) [-1646.439] (-1646.944) (-1643.628) -- 0:00:08 873500 -- (-1645.608) (-1646.590) [-1645.376] (-1646.858) * (-1649.623) [-1648.303] (-1644.661) (-1646.764) -- 0:00:08 874000 -- (-1644.650) [-1645.769] (-1645.904) (-1647.359) * [-1647.086] (-1645.620) (-1644.404) (-1648.439) -- 0:00:08 874500 -- [-1643.797] (-1644.407) (-1645.511) (-1644.508) * (-1649.635) [-1643.886] (-1644.814) (-1644.252) -- 0:00:08 875000 -- (-1644.512) (-1644.660) [-1649.614] (-1644.614) * [-1648.692] (-1645.001) (-1644.633) (-1644.982) -- 0:00:08 Average standard deviation of split frequencies: 0.005489 875500 -- [-1645.178] (-1643.968) (-1646.606) (-1646.375) * [-1647.997] (-1645.472) (-1645.931) (-1644.836) -- 0:00:08 876000 -- [-1644.930] (-1648.521) (-1650.619) (-1648.413) * (-1643.910) [-1644.241] (-1643.422) (-1645.844) -- 0:00:08 876500 -- [-1643.096] (-1644.728) (-1645.144) (-1646.213) * (-1646.350) [-1646.015] (-1643.823) (-1645.690) -- 0:00:08 877000 -- (-1643.078) (-1648.025) (-1643.422) [-1650.093] * (-1650.467) (-1646.311) (-1643.981) [-1649.315] -- 0:00:07 877500 -- (-1643.939) (-1653.053) [-1643.991] (-1649.816) * (-1648.561) (-1644.777) [-1646.077] (-1644.356) -- 0:00:07 878000 -- [-1644.921] (-1645.447) (-1647.508) (-1650.308) * [-1643.307] (-1646.197) (-1644.916) (-1645.469) -- 0:00:07 878500 -- (-1644.010) [-1650.378] (-1644.292) (-1643.623) * (-1644.497) (-1644.960) [-1644.525] (-1643.611) -- 0:00:07 879000 -- (-1644.316) (-1644.784) [-1644.101] (-1643.718) * (-1646.175) (-1647.883) (-1645.588) [-1646.449] -- 0:00:07 879500 -- (-1646.364) (-1646.606) [-1647.745] (-1644.420) * [-1644.791] (-1647.264) (-1646.725) (-1644.849) -- 0:00:07 880000 -- (-1646.538) (-1643.039) (-1647.340) [-1644.608] * (-1646.050) [-1644.915] (-1647.457) (-1643.491) -- 0:00:07 Average standard deviation of split frequencies: 0.005496 880500 -- (-1645.506) (-1647.917) (-1646.165) [-1643.223] * (-1649.588) (-1644.133) [-1645.051] (-1645.438) -- 0:00:07 881000 -- [-1646.301] (-1647.030) (-1645.836) (-1643.657) * [-1645.361] (-1645.399) (-1642.750) (-1644.457) -- 0:00:07 881500 -- (-1643.786) (-1643.915) [-1643.583] (-1643.106) * (-1646.965) (-1643.474) [-1643.442] (-1644.792) -- 0:00:07 882000 -- (-1644.073) [-1643.862] (-1644.865) (-1647.159) * (-1644.658) (-1646.404) [-1643.998] (-1645.807) -- 0:00:07 882500 -- [-1645.352] (-1644.864) (-1644.362) (-1648.633) * [-1645.631] (-1647.313) (-1644.416) (-1644.387) -- 0:00:07 883000 -- (-1644.902) (-1644.194) [-1644.484] (-1644.529) * [-1644.494] (-1648.025) (-1644.207) (-1643.746) -- 0:00:07 883500 -- (-1645.021) (-1644.372) [-1646.234] (-1643.439) * (-1645.302) (-1647.296) [-1643.213] (-1644.283) -- 0:00:07 884000 -- (-1648.079) (-1647.012) [-1647.313] (-1643.512) * (-1647.330) [-1647.628] (-1650.100) (-1644.903) -- 0:00:07 884500 -- (-1649.717) (-1646.663) (-1646.678) [-1643.697] * (-1647.558) (-1645.947) [-1643.534] (-1643.815) -- 0:00:07 885000 -- (-1643.655) (-1644.658) (-1645.631) [-1645.445] * (-1646.336) (-1643.710) [-1644.499] (-1643.562) -- 0:00:07 Average standard deviation of split frequencies: 0.005604 885500 -- [-1644.915] (-1645.806) (-1644.903) (-1643.887) * (-1645.764) [-1643.468] (-1645.483) (-1644.269) -- 0:00:07 886000 -- (-1646.712) [-1643.713] (-1644.120) (-1643.619) * [-1644.135] (-1643.845) (-1644.997) (-1643.205) -- 0:00:07 886500 -- (-1645.357) [-1644.742] (-1645.861) (-1643.834) * (-1645.712) (-1644.296) [-1644.981] (-1645.255) -- 0:00:07 887000 -- (-1644.000) (-1645.126) [-1644.356] (-1644.220) * [-1645.210] (-1643.397) (-1643.966) (-1644.288) -- 0:00:07 887500 -- [-1647.510] (-1645.498) (-1643.332) (-1644.373) * (-1646.011) (-1645.124) [-1643.938] (-1647.985) -- 0:00:07 888000 -- (-1652.242) [-1647.047] (-1645.078) (-1646.666) * (-1647.185) [-1645.618] (-1643.901) (-1647.172) -- 0:00:07 888500 -- (-1645.143) (-1646.801) [-1643.911] (-1646.945) * (-1647.336) (-1644.950) [-1643.969] (-1645.153) -- 0:00:07 889000 -- (-1648.334) [-1643.527] (-1647.302) (-1645.091) * (-1645.948) [-1646.534] (-1644.392) (-1643.882) -- 0:00:07 889500 -- (-1646.116) (-1646.503) (-1644.305) [-1645.600] * [-1645.462] (-1647.206) (-1645.087) (-1646.471) -- 0:00:07 890000 -- (-1644.537) [-1644.200] (-1644.936) (-1650.329) * (-1644.034) (-1643.447) [-1645.680] (-1645.023) -- 0:00:07 Average standard deviation of split frequencies: 0.005504 890500 -- (-1645.623) (-1644.492) (-1650.779) [-1643.368] * (-1646.429) (-1645.462) (-1644.798) [-1644.706] -- 0:00:07 891000 -- (-1644.868) (-1644.333) (-1646.192) [-1643.594] * (-1648.003) (-1643.849) (-1647.244) [-1644.300] -- 0:00:07 891500 -- (-1646.318) [-1643.345] (-1643.827) (-1644.576) * (-1646.723) [-1643.462] (-1647.627) (-1646.152) -- 0:00:07 892000 -- (-1643.236) (-1645.535) (-1644.789) [-1647.087] * (-1643.875) [-1643.455] (-1645.464) (-1646.251) -- 0:00:07 892500 -- (-1647.893) (-1645.428) [-1645.528] (-1645.518) * (-1644.642) (-1645.131) (-1648.848) [-1645.521] -- 0:00:06 893000 -- (-1647.267) [-1644.874] (-1645.644) (-1645.984) * (-1648.219) [-1644.025] (-1646.601) (-1648.175) -- 0:00:06 893500 -- [-1643.612] (-1647.779) (-1646.740) (-1647.385) * (-1646.127) (-1644.806) [-1646.750] (-1644.004) -- 0:00:06 894000 -- (-1646.089) (-1651.508) (-1645.451) [-1645.377] * (-1645.409) (-1645.001) (-1643.990) [-1644.220] -- 0:00:06 894500 -- [-1643.632] (-1646.297) (-1644.291) (-1643.245) * (-1650.114) (-1645.689) [-1643.406] (-1645.610) -- 0:00:06 895000 -- (-1644.660) (-1645.145) (-1644.830) [-1644.137] * (-1646.259) [-1645.849] (-1644.910) (-1643.239) -- 0:00:06 Average standard deviation of split frequencies: 0.006033 895500 -- [-1646.735] (-1645.515) (-1647.639) (-1647.229) * [-1644.331] (-1643.703) (-1644.861) (-1645.193) -- 0:00:06 896000 -- (-1648.255) (-1648.276) (-1645.004) [-1643.713] * (-1645.553) (-1642.760) [-1644.990] (-1644.788) -- 0:00:06 896500 -- (-1646.352) (-1645.888) (-1647.896) [-1644.171] * (-1645.982) (-1642.988) (-1644.521) [-1644.588] -- 0:00:06 897000 -- (-1650.145) [-1643.795] (-1651.803) (-1645.711) * (-1646.839) (-1644.997) [-1643.916] (-1645.121) -- 0:00:06 897500 -- [-1645.020] (-1648.021) (-1649.910) (-1647.550) * (-1644.777) [-1644.171] (-1644.033) (-1645.094) -- 0:00:06 898000 -- (-1647.702) (-1648.130) (-1647.800) [-1643.723] * (-1646.152) (-1643.783) [-1647.667] (-1645.401) -- 0:00:06 898500 -- (-1647.405) (-1645.433) (-1646.721) [-1644.970] * [-1644.812] (-1646.194) (-1649.838) (-1646.175) -- 0:00:06 899000 -- (-1644.470) (-1645.698) (-1643.791) [-1643.371] * (-1646.478) (-1643.877) [-1649.065] (-1644.491) -- 0:00:06 899500 -- [-1645.103] (-1646.490) (-1645.416) (-1646.060) * (-1645.191) (-1646.825) [-1645.781] (-1645.857) -- 0:00:06 900000 -- (-1643.214) (-1648.703) (-1650.134) [-1645.748] * [-1649.260] (-1649.484) (-1648.179) (-1647.285) -- 0:00:06 Average standard deviation of split frequencies: 0.006141 900500 -- (-1646.298) (-1649.207) [-1647.198] (-1648.362) * [-1645.202] (-1649.504) (-1645.240) (-1644.735) -- 0:00:06 901000 -- (-1647.200) (-1643.744) [-1643.094] (-1644.425) * (-1648.871) (-1645.032) [-1643.882] (-1645.140) -- 0:00:06 901500 -- [-1645.602] (-1643.721) (-1646.912) (-1647.489) * (-1646.239) [-1644.417] (-1645.633) (-1645.577) -- 0:00:06 902000 -- [-1644.701] (-1644.215) (-1647.593) (-1646.586) * (-1646.676) (-1644.317) [-1645.662] (-1645.579) -- 0:00:06 902500 -- [-1642.914] (-1647.403) (-1644.259) (-1645.234) * (-1643.598) [-1643.462] (-1645.636) (-1644.414) -- 0:00:06 903000 -- (-1643.431) [-1643.731] (-1643.374) (-1647.340) * (-1645.072) (-1645.916) (-1651.711) [-1646.151] -- 0:00:06 903500 -- (-1646.677) (-1643.755) (-1643.292) [-1648.243] * (-1646.420) (-1650.723) (-1647.915) [-1645.531] -- 0:00:06 904000 -- [-1643.643] (-1644.755) (-1647.252) (-1646.241) * (-1647.322) (-1650.507) (-1645.805) [-1643.496] -- 0:00:06 904500 -- (-1648.861) (-1644.099) (-1645.746) [-1644.808] * (-1648.291) (-1645.361) [-1647.587] (-1644.826) -- 0:00:06 905000 -- (-1646.862) [-1644.425] (-1644.374) (-1644.687) * (-1646.024) (-1649.712) (-1649.875) [-1645.861] -- 0:00:06 Average standard deviation of split frequencies: 0.006348 905500 -- (-1648.800) [-1644.209] (-1646.367) (-1650.210) * (-1643.818) [-1643.660] (-1649.703) (-1645.845) -- 0:00:06 906000 -- (-1644.964) (-1643.030) (-1645.572) [-1649.070] * [-1648.465] (-1643.382) (-1646.581) (-1647.145) -- 0:00:06 906500 -- (-1645.521) (-1646.197) [-1646.668] (-1644.709) * (-1647.424) (-1644.700) (-1644.637) [-1644.409] -- 0:00:06 907000 -- [-1646.789] (-1648.617) (-1644.618) (-1643.667) * (-1652.173) [-1643.264] (-1646.450) (-1643.254) -- 0:00:06 907500 -- (-1648.251) (-1645.868) (-1645.636) [-1648.085] * (-1645.714) (-1646.390) [-1645.220] (-1644.124) -- 0:00:06 908000 -- (-1645.520) (-1646.840) [-1643.237] (-1644.811) * [-1646.725] (-1645.133) (-1643.627) (-1645.054) -- 0:00:05 908500 -- (-1646.718) [-1645.341] (-1644.856) (-1644.018) * (-1644.293) (-1645.025) (-1644.131) [-1644.574] -- 0:00:05 909000 -- (-1644.359) (-1644.782) (-1648.124) [-1644.998] * (-1644.934) (-1644.899) [-1644.712] (-1645.817) -- 0:00:05 909500 -- (-1648.438) [-1644.205] (-1643.967) (-1644.520) * [-1644.320] (-1642.912) (-1645.124) (-1644.629) -- 0:00:05 910000 -- [-1645.258] (-1642.996) (-1643.231) (-1643.676) * [-1645.399] (-1643.284) (-1644.169) (-1644.274) -- 0:00:05 Average standard deviation of split frequencies: 0.006281 910500 -- (-1644.853) [-1644.366] (-1645.440) (-1644.100) * (-1646.496) (-1644.296) (-1643.832) [-1647.709] -- 0:00:05 911000 -- [-1644.807] (-1645.242) (-1646.824) (-1644.544) * (-1644.612) [-1644.991] (-1644.923) (-1644.664) -- 0:00:05 911500 -- (-1644.818) (-1645.165) (-1644.481) [-1648.917] * (-1646.493) (-1645.315) (-1646.067) [-1643.751] -- 0:00:05 912000 -- (-1645.019) [-1648.801] (-1648.222) (-1645.713) * (-1646.311) (-1644.057) [-1644.229] (-1643.664) -- 0:00:05 912500 -- (-1647.577) (-1645.753) [-1646.793] (-1643.927) * (-1644.896) (-1643.312) [-1644.789] (-1649.182) -- 0:00:05 913000 -- (-1648.526) (-1644.369) (-1644.726) [-1644.139] * [-1644.724] (-1644.306) (-1646.913) (-1647.336) -- 0:00:05 913500 -- [-1643.786] (-1646.130) (-1645.528) (-1645.440) * [-1643.800] (-1643.966) (-1647.792) (-1647.391) -- 0:00:05 914000 -- [-1644.065] (-1645.231) (-1646.807) (-1644.125) * [-1643.118] (-1643.829) (-1645.362) (-1647.444) -- 0:00:05 914500 -- (-1645.185) (-1645.765) (-1645.701) [-1644.212] * [-1643.516] (-1644.269) (-1647.575) (-1648.354) -- 0:00:05 915000 -- (-1643.557) [-1645.908] (-1644.714) (-1648.130) * (-1644.594) (-1644.375) (-1646.297) [-1645.189] -- 0:00:05 Average standard deviation of split frequencies: 0.006279 915500 -- (-1643.291) (-1646.031) [-1645.291] (-1643.769) * (-1643.980) (-1643.083) (-1643.533) [-1645.792] -- 0:00:05 916000 -- (-1643.292) (-1646.474) (-1645.060) [-1644.089] * (-1646.645) (-1645.238) [-1647.008] (-1647.029) -- 0:00:05 916500 -- (-1644.489) (-1646.775) [-1644.205] (-1643.486) * (-1645.817) (-1644.956) [-1643.861] (-1644.027) -- 0:00:05 917000 -- (-1647.007) (-1646.444) (-1644.388) [-1643.348] * (-1647.269) (-1644.635) [-1643.910] (-1643.724) -- 0:00:05 917500 -- (-1647.728) (-1646.814) [-1644.162] (-1644.064) * (-1649.182) [-1647.009] (-1644.539) (-1643.431) -- 0:00:05 918000 -- [-1644.290] (-1645.045) (-1645.250) (-1643.811) * (-1649.804) (-1648.260) (-1647.479) [-1644.349] -- 0:00:05 918500 -- [-1644.233] (-1644.180) (-1644.557) (-1643.982) * [-1644.993] (-1648.785) (-1644.266) (-1643.923) -- 0:00:05 919000 -- (-1650.054) [-1645.855] (-1643.501) (-1644.374) * (-1645.124) [-1646.531] (-1643.700) (-1645.364) -- 0:00:05 919500 -- (-1647.394) (-1649.327) (-1643.836) [-1647.810] * (-1645.346) [-1646.036] (-1646.509) (-1644.551) -- 0:00:05 920000 -- (-1645.233) [-1644.610] (-1646.832) (-1648.241) * (-1648.291) (-1645.107) (-1643.790) [-1643.234] -- 0:00:05 Average standard deviation of split frequencies: 0.006554 920500 -- [-1645.210] (-1645.093) (-1650.026) (-1644.832) * (-1643.248) (-1643.863) (-1645.375) [-1643.270] -- 0:00:05 921000 -- (-1645.348) (-1645.034) (-1646.872) [-1645.800] * [-1644.786] (-1649.103) (-1645.590) (-1649.564) -- 0:00:05 921500 -- (-1644.731) [-1645.883] (-1646.197) (-1645.270) * (-1645.413) (-1646.649) [-1647.142] (-1648.602) -- 0:00:05 922000 -- (-1643.833) (-1645.676) [-1648.315] (-1643.612) * (-1645.126) (-1647.659) [-1644.748] (-1650.064) -- 0:00:05 922500 -- (-1644.382) (-1644.967) [-1651.737] (-1644.886) * [-1645.691] (-1646.400) (-1647.861) (-1644.010) -- 0:00:05 923000 -- (-1643.115) [-1644.915] (-1648.524) (-1648.170) * (-1644.855) [-1644.319] (-1643.505) (-1643.796) -- 0:00:05 923500 -- (-1643.841) (-1644.831) [-1643.304] (-1646.364) * (-1644.969) [-1642.967] (-1644.412) (-1643.315) -- 0:00:04 924000 -- (-1645.290) (-1644.812) (-1645.833) [-1646.369] * [-1644.161] (-1642.841) (-1648.871) (-1643.945) -- 0:00:04 924500 -- (-1646.684) (-1644.949) (-1643.970) [-1642.839] * (-1647.980) [-1642.908] (-1644.705) (-1645.209) -- 0:00:04 925000 -- (-1650.733) [-1644.607] (-1643.691) (-1648.506) * [-1645.706] (-1645.851) (-1645.122) (-1647.244) -- 0:00:04 Average standard deviation of split frequencies: 0.006788 925500 -- (-1645.974) [-1643.861] (-1652.581) (-1645.223) * (-1650.433) [-1648.217] (-1647.903) (-1644.620) -- 0:00:04 926000 -- [-1644.571] (-1646.471) (-1644.264) (-1649.625) * (-1646.460) (-1643.901) [-1646.671] (-1645.866) -- 0:00:04 926500 -- [-1644.800] (-1647.908) (-1646.233) (-1650.864) * (-1644.820) [-1644.403] (-1644.753) (-1645.623) -- 0:00:04 927000 -- (-1645.531) (-1646.147) [-1644.087] (-1648.357) * (-1643.135) (-1645.227) (-1650.384) [-1644.346] -- 0:00:04 927500 -- [-1644.003] (-1643.914) (-1644.616) (-1646.143) * (-1643.263) (-1643.669) [-1646.165] (-1644.579) -- 0:00:04 928000 -- (-1643.503) [-1645.677] (-1644.724) (-1646.114) * [-1643.551] (-1647.728) (-1647.706) (-1644.989) -- 0:00:04 928500 -- [-1643.645] (-1647.033) (-1643.775) (-1652.104) * [-1643.672] (-1646.568) (-1645.555) (-1643.845) -- 0:00:04 929000 -- (-1644.383) (-1644.046) (-1646.281) [-1643.974] * [-1644.392] (-1644.156) (-1646.977) (-1645.767) -- 0:00:04 929500 -- (-1645.694) (-1647.490) [-1643.617] (-1645.531) * (-1645.703) (-1643.941) [-1644.414] (-1644.767) -- 0:00:04 930000 -- [-1643.206] (-1646.638) (-1643.682) (-1649.630) * (-1645.550) (-1646.195) [-1643.533] (-1645.761) -- 0:00:04 Average standard deviation of split frequencies: 0.006686 930500 -- (-1644.915) (-1645.982) [-1644.017] (-1643.557) * (-1646.445) (-1651.700) (-1643.867) [-1644.545] -- 0:00:04 931000 -- (-1645.211) [-1643.783] (-1645.692) (-1643.472) * (-1645.492) (-1649.974) [-1647.291] (-1644.194) -- 0:00:04 931500 -- (-1643.898) [-1644.901] (-1645.058) (-1644.028) * [-1644.236] (-1645.364) (-1646.644) (-1645.531) -- 0:00:04 932000 -- (-1645.411) [-1643.811] (-1644.358) (-1648.697) * [-1644.874] (-1643.893) (-1643.628) (-1648.473) -- 0:00:04 932500 -- (-1644.986) (-1645.142) (-1643.562) [-1645.257] * (-1645.119) (-1644.835) (-1646.691) [-1646.802] -- 0:00:04 933000 -- [-1644.222] (-1644.768) (-1647.492) (-1646.173) * [-1644.807] (-1646.629) (-1645.949) (-1644.393) -- 0:00:04 933500 -- (-1645.285) [-1645.688] (-1644.717) (-1643.688) * (-1643.500) (-1644.368) [-1646.510] (-1647.218) -- 0:00:04 934000 -- [-1642.961] (-1647.772) (-1648.218) (-1643.866) * (-1649.363) (-1643.383) (-1648.796) [-1643.253] -- 0:00:04 934500 -- (-1643.265) (-1644.263) (-1648.713) [-1643.469] * (-1643.666) (-1647.678) [-1649.932] (-1644.625) -- 0:00:04 935000 -- [-1644.665] (-1645.342) (-1644.048) (-1644.381) * [-1643.931] (-1644.796) (-1648.852) (-1644.040) -- 0:00:04 Average standard deviation of split frequencies: 0.006447 935500 -- (-1650.107) (-1647.167) (-1643.498) [-1644.860] * (-1643.088) [-1644.104] (-1645.711) (-1644.357) -- 0:00:04 936000 -- (-1647.383) [-1644.712] (-1649.283) (-1644.154) * (-1646.762) (-1646.317) (-1647.617) [-1646.190] -- 0:00:04 936500 -- (-1647.567) (-1645.160) (-1644.598) [-1646.021] * (-1646.078) (-1644.642) [-1645.787] (-1646.288) -- 0:00:04 937000 -- (-1645.846) [-1643.899] (-1647.474) (-1646.415) * (-1644.777) (-1643.075) (-1645.190) [-1646.509] -- 0:00:04 937500 -- (-1646.100) [-1648.134] (-1646.538) (-1643.414) * (-1643.269) (-1645.712) [-1644.232] (-1645.092) -- 0:00:04 938000 -- [-1645.934] (-1645.752) (-1646.273) (-1645.243) * [-1643.090] (-1644.982) (-1643.502) (-1643.966) -- 0:00:04 938500 -- (-1644.875) [-1645.703] (-1647.533) (-1643.957) * (-1645.513) (-1644.618) [-1644.271] (-1646.951) -- 0:00:03 939000 -- (-1643.663) (-1644.016) (-1645.362) [-1644.484] * (-1644.774) [-1643.797] (-1645.122) (-1646.671) -- 0:00:03 939500 -- (-1644.288) (-1645.123) (-1647.147) [-1643.629] * (-1646.607) (-1644.467) [-1647.095] (-1643.991) -- 0:00:03 940000 -- (-1647.891) (-1645.861) (-1644.075) [-1646.687] * (-1645.283) [-1646.745] (-1644.483) (-1645.331) -- 0:00:03 Average standard deviation of split frequencies: 0.006916 940500 -- [-1647.973] (-1648.536) (-1644.663) (-1644.865) * [-1645.843] (-1644.969) (-1644.809) (-1646.003) -- 0:00:03 941000 -- (-1645.215) (-1644.312) (-1645.280) [-1648.635] * (-1646.446) [-1643.478] (-1644.133) (-1647.244) -- 0:00:03 941500 -- (-1644.331) (-1646.837) (-1646.789) [-1648.310] * [-1644.843] (-1645.254) (-1645.496) (-1645.485) -- 0:00:03 942000 -- (-1646.533) [-1646.956] (-1645.344) (-1646.872) * (-1646.390) (-1643.789) [-1645.811] (-1647.978) -- 0:00:03 942500 -- (-1643.748) (-1645.560) (-1647.013) [-1644.845] * (-1644.242) [-1643.149] (-1646.215) (-1643.933) -- 0:00:03 943000 -- (-1644.722) (-1648.164) [-1645.534] (-1646.281) * (-1643.633) (-1645.729) [-1644.745] (-1646.119) -- 0:00:03 943500 -- (-1643.642) (-1647.666) (-1646.616) [-1645.574] * [-1643.214] (-1647.173) (-1644.470) (-1647.645) -- 0:00:03 944000 -- (-1645.153) (-1644.897) (-1644.931) [-1643.084] * (-1643.253) [-1646.001] (-1646.304) (-1645.175) -- 0:00:03 944500 -- (-1649.744) (-1643.912) [-1644.846] (-1643.057) * [-1643.298] (-1646.122) (-1644.291) (-1643.300) -- 0:00:03 945000 -- (-1647.433) (-1646.092) [-1645.913] (-1645.100) * (-1645.003) [-1646.004] (-1643.927) (-1643.123) -- 0:00:03 Average standard deviation of split frequencies: 0.006777 945500 -- (-1643.672) [-1645.086] (-1644.094) (-1645.046) * [-1644.578] (-1644.409) (-1643.046) (-1643.812) -- 0:00:03 946000 -- [-1643.486] (-1644.166) (-1644.343) (-1645.008) * (-1648.363) (-1644.308) [-1643.322] (-1645.185) -- 0:00:03 946500 -- (-1646.762) [-1643.598] (-1643.586) (-1646.209) * [-1644.057] (-1647.199) (-1645.508) (-1643.870) -- 0:00:03 947000 -- (-1652.021) (-1644.655) [-1643.515] (-1645.528) * [-1645.370] (-1647.432) (-1650.976) (-1643.417) -- 0:00:03 947500 -- [-1643.381] (-1644.681) (-1645.428) (-1649.694) * [-1644.658] (-1644.877) (-1643.764) (-1645.139) -- 0:00:03 948000 -- [-1645.055] (-1648.440) (-1643.836) (-1643.803) * (-1644.603) (-1644.112) [-1645.374] (-1649.936) -- 0:00:03 948500 -- (-1650.333) (-1647.290) [-1643.974] (-1644.607) * [-1646.828] (-1646.189) (-1643.314) (-1649.841) -- 0:00:03 949000 -- (-1648.816) (-1644.341) (-1644.297) [-1645.442] * (-1652.109) [-1648.022] (-1643.477) (-1645.341) -- 0:00:03 949500 -- [-1645.378] (-1646.284) (-1648.646) (-1644.190) * (-1645.186) (-1644.389) [-1644.542] (-1643.567) -- 0:00:03 950000 -- (-1645.573) [-1647.590] (-1645.273) (-1646.959) * (-1645.093) [-1644.910] (-1643.952) (-1645.857) -- 0:00:03 Average standard deviation of split frequencies: 0.006545 950500 -- (-1647.303) (-1645.307) [-1645.052] (-1644.623) * (-1646.585) (-1644.793) [-1644.065] (-1643.653) -- 0:00:03 951000 -- [-1643.641] (-1647.268) (-1645.447) (-1645.267) * (-1647.927) (-1646.929) (-1645.630) [-1644.915] -- 0:00:03 951500 -- (-1643.898) (-1646.177) [-1644.639] (-1645.341) * (-1644.296) (-1644.186) (-1644.905) [-1644.489] -- 0:00:03 952000 -- (-1648.477) (-1646.517) (-1645.544) [-1645.873] * (-1647.463) (-1644.017) [-1644.424] (-1646.703) -- 0:00:03 952500 -- (-1644.812) (-1645.328) (-1644.401) [-1646.081] * (-1645.870) (-1646.475) (-1642.999) [-1645.278] -- 0:00:03 953000 -- (-1644.930) [-1645.940] (-1644.087) (-1644.439) * (-1643.292) (-1644.322) [-1645.081] (-1643.979) -- 0:00:03 953500 -- (-1645.981) (-1644.580) (-1644.768) [-1646.621] * (-1643.306) [-1643.322] (-1643.334) (-1645.999) -- 0:00:03 954000 -- [-1643.872] (-1644.429) (-1643.955) (-1646.944) * [-1644.580] (-1643.500) (-1643.080) (-1646.941) -- 0:00:02 954500 -- [-1643.578] (-1646.290) (-1647.671) (-1645.531) * (-1643.614) (-1645.033) [-1644.966] (-1645.226) -- 0:00:02 955000 -- (-1643.006) (-1648.681) (-1648.089) [-1644.059] * [-1643.493] (-1646.608) (-1644.451) (-1643.688) -- 0:00:02 Average standard deviation of split frequencies: 0.006706 955500 -- (-1645.818) [-1643.691] (-1644.770) (-1646.899) * [-1644.347] (-1646.408) (-1644.247) (-1643.719) -- 0:00:02 956000 -- [-1644.668] (-1644.439) (-1645.065) (-1650.202) * (-1644.061) (-1647.785) (-1644.536) [-1644.431] -- 0:00:02 956500 -- [-1642.792] (-1644.353) (-1645.613) (-1645.940) * [-1647.188] (-1643.539) (-1645.300) (-1645.952) -- 0:00:02 957000 -- [-1648.039] (-1644.244) (-1647.448) (-1645.194) * (-1649.627) (-1643.459) [-1644.047] (-1651.992) -- 0:00:02 957500 -- (-1644.833) (-1644.290) [-1646.114] (-1644.413) * (-1646.416) [-1644.784] (-1643.868) (-1650.749) -- 0:00:02 958000 -- (-1645.567) (-1646.431) (-1647.389) [-1644.131] * (-1644.688) (-1644.382) (-1644.967) [-1645.816] -- 0:00:02 958500 -- (-1646.016) (-1644.561) (-1645.184) [-1645.123] * (-1648.588) [-1643.542] (-1646.010) (-1646.528) -- 0:00:02 959000 -- (-1644.856) (-1644.502) [-1645.947] (-1643.290) * (-1645.142) (-1643.987) [-1644.731] (-1647.802) -- 0:00:02 959500 -- [-1644.062] (-1645.047) (-1649.031) (-1644.347) * (-1644.497) (-1644.650) (-1643.395) [-1647.491] -- 0:00:02 960000 -- (-1646.171) (-1645.428) [-1643.905] (-1644.837) * (-1646.772) [-1643.166] (-1643.024) (-1648.563) -- 0:00:02 Average standard deviation of split frequencies: 0.006543 960500 -- (-1646.594) [-1644.155] (-1647.343) (-1644.871) * (-1644.312) (-1645.023) (-1642.964) [-1647.771] -- 0:00:02 961000 -- [-1644.272] (-1644.371) (-1649.941) (-1643.481) * (-1643.244) (-1645.608) (-1643.320) [-1646.546] -- 0:00:02 961500 -- (-1644.031) (-1645.499) (-1647.702) [-1646.624] * (-1643.046) [-1645.776] (-1644.166) (-1644.252) -- 0:00:02 962000 -- (-1647.606) [-1644.886] (-1649.903) (-1645.578) * (-1649.589) (-1648.344) [-1645.054] (-1645.761) -- 0:00:02 962500 -- (-1647.196) [-1644.002] (-1643.895) (-1646.005) * (-1651.283) (-1646.371) [-1643.279] (-1645.966) -- 0:00:02 963000 -- (-1643.424) [-1643.771] (-1644.671) (-1644.566) * (-1652.163) (-1644.511) (-1645.104) [-1648.676] -- 0:00:02 963500 -- (-1644.451) [-1644.281] (-1648.004) (-1647.053) * [-1643.685] (-1644.359) (-1648.232) (-1647.634) -- 0:00:02 964000 -- (-1644.463) (-1647.130) (-1647.687) [-1642.933] * (-1645.238) (-1645.709) (-1645.529) [-1646.378] -- 0:00:02 964500 -- (-1644.211) (-1644.344) (-1644.211) [-1647.468] * (-1645.908) (-1644.741) (-1643.659) [-1652.006] -- 0:00:02 965000 -- [-1647.272] (-1646.480) (-1646.050) (-1643.390) * [-1645.438] (-1644.102) (-1644.324) (-1647.872) -- 0:00:02 Average standard deviation of split frequencies: 0.006474 965500 -- [-1647.460] (-1646.552) (-1646.518) (-1644.492) * [-1645.078] (-1647.637) (-1646.335) (-1644.916) -- 0:00:02 966000 -- [-1647.470] (-1643.438) (-1645.465) (-1652.752) * (-1644.444) (-1648.271) [-1647.108] (-1644.584) -- 0:00:02 966500 -- [-1645.970] (-1644.626) (-1650.645) (-1653.203) * (-1644.025) [-1643.489] (-1648.563) (-1645.180) -- 0:00:02 967000 -- (-1645.506) (-1649.947) (-1647.150) [-1647.039] * (-1646.368) (-1648.076) [-1648.904] (-1646.265) -- 0:00:02 967500 -- (-1643.008) [-1644.229] (-1649.863) (-1647.537) * (-1648.166) (-1649.161) (-1645.720) [-1644.566] -- 0:00:02 968000 -- (-1645.840) (-1644.426) (-1652.183) [-1645.275] * (-1645.362) (-1645.265) (-1647.169) [-1644.377] -- 0:00:02 968500 -- (-1649.248) [-1646.446] (-1645.771) (-1645.635) * (-1645.780) [-1643.620] (-1646.460) (-1644.641) -- 0:00:02 969000 -- (-1644.018) (-1647.573) (-1644.747) [-1644.155] * (-1648.732) (-1643.420) (-1645.230) [-1646.383] -- 0:00:02 969500 -- (-1645.877) (-1644.560) [-1645.274] (-1645.062) * (-1642.905) (-1643.259) [-1644.164] (-1644.740) -- 0:00:01 970000 -- (-1644.793) (-1643.966) (-1646.007) [-1643.623] * (-1643.486) (-1643.923) [-1644.402] (-1644.306) -- 0:00:01 Average standard deviation of split frequencies: 0.006605 970500 -- [-1644.759] (-1648.227) (-1643.599) (-1647.784) * [-1645.392] (-1645.614) (-1653.779) (-1645.230) -- 0:00:01 971000 -- [-1643.731] (-1646.441) (-1648.508) (-1645.959) * [-1643.432] (-1646.064) (-1644.019) (-1645.768) -- 0:00:01 971500 -- (-1644.196) (-1647.394) [-1645.063] (-1644.526) * (-1643.906) (-1643.303) [-1644.080] (-1646.942) -- 0:00:01 972000 -- (-1645.802) [-1647.642] (-1643.837) (-1648.947) * (-1645.467) (-1643.204) [-1643.616] (-1647.597) -- 0:00:01 972500 -- [-1645.051] (-1645.373) (-1647.383) (-1647.898) * (-1647.549) (-1643.862) (-1644.709) [-1644.434] -- 0:00:01 973000 -- (-1648.787) (-1653.478) (-1648.429) [-1644.652] * (-1644.368) (-1643.582) [-1644.023] (-1644.420) -- 0:00:01 973500 -- (-1647.290) (-1650.971) (-1648.674) [-1643.597] * (-1644.665) (-1645.299) (-1644.029) [-1649.400] -- 0:00:01 974000 -- [-1646.270] (-1650.743) (-1644.907) (-1646.303) * (-1647.602) (-1643.834) (-1647.101) [-1645.659] -- 0:00:01 974500 -- [-1644.813] (-1645.655) (-1646.354) (-1648.928) * (-1645.190) (-1644.067) [-1646.939] (-1645.160) -- 0:00:01 975000 -- (-1643.819) (-1644.583) (-1645.066) [-1642.927] * (-1644.119) [-1649.524] (-1644.427) (-1647.103) -- 0:00:01 Average standard deviation of split frequencies: 0.006504 975500 -- (-1644.424) [-1646.079] (-1644.355) (-1643.851) * (-1644.004) (-1648.328) [-1645.062] (-1645.968) -- 0:00:01 976000 -- (-1644.354) [-1644.767] (-1644.365) (-1644.271) * (-1643.114) [-1645.700] (-1644.129) (-1646.306) -- 0:00:01 976500 -- [-1644.098] (-1649.220) (-1643.560) (-1651.238) * (-1645.708) (-1647.638) (-1644.211) [-1648.360] -- 0:00:01 977000 -- (-1644.096) [-1645.826] (-1646.317) (-1644.463) * [-1644.175] (-1644.775) (-1643.866) (-1644.674) -- 0:00:01 977500 -- (-1644.589) (-1646.315) [-1647.144] (-1650.139) * [-1644.089] (-1645.889) (-1648.117) (-1649.706) -- 0:00:01 978000 -- (-1644.209) (-1644.974) [-1647.310] (-1644.715) * (-1645.881) (-1648.350) [-1648.378] (-1647.788) -- 0:00:01 978500 -- (-1647.328) (-1648.004) [-1645.912] (-1643.728) * (-1646.099) [-1648.064] (-1645.007) (-1645.052) -- 0:00:01 979000 -- [-1647.840] (-1647.395) (-1644.741) (-1644.510) * (-1645.475) (-1648.119) [-1643.874] (-1644.685) -- 0:00:01 979500 -- (-1647.268) (-1648.159) [-1644.161] (-1646.246) * (-1649.832) (-1646.506) [-1645.414] (-1642.692) -- 0:00:01 980000 -- [-1644.696] (-1644.559) (-1645.717) (-1643.538) * [-1646.288] (-1645.047) (-1649.343) (-1643.478) -- 0:00:01 Average standard deviation of split frequencies: 0.006730 980500 -- (-1643.156) (-1645.907) (-1647.152) [-1644.098] * (-1646.507) [-1647.644] (-1645.959) (-1644.013) -- 0:00:01 981000 -- (-1644.159) (-1647.349) (-1645.533) [-1646.296] * (-1650.360) (-1647.724) [-1646.597] (-1643.323) -- 0:00:01 981500 -- (-1645.180) (-1647.639) (-1645.697) [-1646.007] * [-1646.271] (-1651.555) (-1646.447) (-1644.705) -- 0:00:01 982000 -- (-1643.827) (-1647.786) (-1646.661) [-1645.549] * [-1643.646] (-1648.574) (-1647.877) (-1644.022) -- 0:00:01 982500 -- [-1643.375] (-1648.549) (-1644.727) (-1644.462) * (-1644.645) (-1649.361) (-1645.228) [-1644.603] -- 0:00:01 983000 -- (-1643.524) (-1650.678) (-1643.888) [-1646.575] * [-1646.464] (-1644.956) (-1645.718) (-1647.075) -- 0:00:01 983500 -- (-1645.754) (-1642.974) [-1645.520] (-1645.641) * (-1643.992) (-1645.713) [-1645.239] (-1644.102) -- 0:00:01 984000 -- (-1646.319) (-1644.612) (-1647.223) [-1645.095] * (-1646.157) [-1642.950] (-1643.914) (-1646.514) -- 0:00:01 984500 -- [-1645.772] (-1643.728) (-1647.915) (-1651.684) * (-1647.347) (-1642.944) [-1645.715] (-1644.529) -- 0:00:01 985000 -- (-1648.494) (-1644.709) [-1644.459] (-1648.003) * (-1645.775) [-1645.118] (-1643.866) (-1644.590) -- 0:00:00 Average standard deviation of split frequencies: 0.006566 985500 -- (-1652.048) (-1645.206) (-1644.710) [-1644.097] * (-1644.848) [-1646.890] (-1644.160) (-1643.846) -- 0:00:00 986000 -- (-1645.634) (-1643.428) [-1643.233] (-1645.179) * (-1643.325) (-1645.032) (-1644.864) [-1644.970] -- 0:00:00 986500 -- (-1643.450) (-1644.459) [-1645.866] (-1643.437) * (-1647.061) (-1644.579) (-1644.687) [-1644.338] -- 0:00:00 987000 -- (-1644.658) (-1648.010) [-1643.830] (-1645.782) * (-1643.970) (-1643.687) (-1645.722) [-1644.336] -- 0:00:00 987500 -- (-1644.639) (-1647.277) (-1642.989) [-1644.918] * (-1643.020) [-1644.328] (-1645.297) (-1647.519) -- 0:00:00 988000 -- (-1652.968) (-1644.914) (-1642.943) [-1643.516] * (-1644.985) [-1643.941] (-1643.909) (-1644.427) -- 0:00:00 988500 -- (-1649.027) [-1648.042] (-1648.780) (-1645.977) * (-1642.822) (-1645.048) (-1644.840) [-1645.408] -- 0:00:00 989000 -- [-1649.271] (-1647.764) (-1651.082) (-1644.116) * (-1645.569) (-1646.559) (-1645.105) [-1646.300] -- 0:00:00 989500 -- (-1648.978) [-1644.796] (-1645.471) (-1644.740) * (-1643.662) (-1647.661) [-1643.912] (-1644.250) -- 0:00:00 990000 -- [-1648.455] (-1643.027) (-1644.409) (-1643.877) * (-1643.192) [-1643.078] (-1645.428) (-1644.157) -- 0:00:00 Average standard deviation of split frequencies: 0.006567 990500 -- (-1647.250) (-1643.026) (-1648.648) [-1643.307] * (-1643.986) (-1646.662) (-1643.418) [-1645.464] -- 0:00:00 991000 -- (-1645.107) [-1643.472] (-1645.919) (-1646.576) * (-1645.618) [-1645.144] (-1643.155) (-1644.495) -- 0:00:00 991500 -- (-1644.941) (-1648.244) [-1643.553] (-1645.405) * [-1645.848] (-1647.962) (-1645.834) (-1643.833) -- 0:00:00 992000 -- (-1643.545) (-1648.352) (-1644.823) [-1645.140] * (-1644.327) (-1645.434) [-1645.935] (-1642.726) -- 0:00:00 992500 -- (-1643.235) (-1643.746) (-1645.928) [-1644.208] * (-1645.348) (-1645.511) (-1647.366) [-1646.825] -- 0:00:00 993000 -- [-1644.212] (-1644.843) (-1649.540) (-1644.552) * (-1645.950) (-1644.623) (-1650.285) [-1645.146] -- 0:00:00 993500 -- (-1647.895) (-1646.211) (-1649.397) [-1644.549] * [-1643.181] (-1646.123) (-1648.393) (-1644.409) -- 0:00:00 994000 -- (-1646.004) [-1645.238] (-1645.773) (-1644.825) * (-1644.771) [-1644.604] (-1645.619) (-1647.775) -- 0:00:00 994500 -- (-1649.066) [-1644.493] (-1645.761) (-1644.508) * (-1644.666) (-1644.740) [-1645.479] (-1645.821) -- 0:00:00 995000 -- (-1646.155) (-1647.030) [-1646.519] (-1645.520) * (-1646.256) (-1648.726) [-1643.484] (-1643.322) -- 0:00:00 Average standard deviation of split frequencies: 0.006437 995500 -- (-1646.226) [-1645.192] (-1644.669) (-1643.635) * (-1645.699) (-1644.663) (-1653.696) [-1643.638] -- 0:00:00 996000 -- (-1645.402) (-1644.586) [-1642.952] (-1644.688) * [-1646.468] (-1645.182) (-1646.226) (-1644.398) -- 0:00:00 996500 -- [-1647.102] (-1645.776) (-1643.227) (-1644.686) * (-1644.699) [-1646.141] (-1644.901) (-1644.406) -- 0:00:00 997000 -- (-1646.213) (-1646.701) (-1643.167) [-1643.888] * [-1644.353] (-1647.716) (-1646.457) (-1643.682) -- 0:00:00 997500 -- (-1649.843) (-1647.642) [-1645.252] (-1644.862) * (-1646.062) (-1645.910) [-1644.553] (-1643.677) -- 0:00:00 998000 -- [-1647.694] (-1645.990) (-1645.138) (-1646.440) * (-1647.077) [-1648.881] (-1645.929) (-1644.334) -- 0:00:00 998500 -- (-1652.101) (-1643.425) [-1644.494] (-1644.939) * (-1646.439) (-1644.047) [-1644.367] (-1643.276) -- 0:00:00 999000 -- (-1651.865) (-1644.099) [-1648.467] (-1643.638) * (-1644.977) (-1648.872) [-1643.766] (-1651.950) -- 0:00:00 999500 -- (-1646.177) (-1644.521) [-1648.482] (-1643.063) * [-1644.556] (-1646.367) (-1643.622) (-1645.163) -- 0:00:00 1000000 -- (-1645.787) (-1646.274) [-1647.206] (-1643.132) * (-1643.655) [-1644.692] (-1643.899) (-1643.346) -- 0:00:00 Average standard deviation of split frequencies: 0.006250 Analysis completed in 1 mins 5 seconds Analysis used 63.85 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1642.69 Likelihood of best state for "cold" chain of run 2 was -1642.69 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.4 % ( 71 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.0 % ( 24 %) Dirichlet(Pi{all}) 27.1 % ( 22 %) Slider(Pi{all}) 78.8 % ( 54 %) Multiplier(Alpha{1,2}) 78.0 % ( 49 %) Multiplier(Alpha{3}) 15.3 % ( 28 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 69.8 % ( 58 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.3 % ( 29 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.6 % ( 19 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.7 % ( 63 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 24.9 % ( 26 %) Dirichlet(Pi{all}) 26.9 % ( 21 %) Slider(Pi{all}) 78.4 % ( 50 %) Multiplier(Alpha{1,2}) 77.8 % ( 62 %) Multiplier(Alpha{3}) 17.4 % ( 15 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 76 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 88 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 22 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.6 % ( 26 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166791 0.82 0.66 3 | 167138 166168 0.83 4 | 166689 166886 166328 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166190 0.82 0.67 3 | 166794 166748 0.84 4 | 166595 166914 166759 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1644.32 | 2 2 1 | | 2 22 1 | |1 1 2 1 2 2 1 2 | | 12 11 1 1 2 1 2 | | 2 1 2 2 1 2 2 2 1 1 1 2 * 2| |2 2222 * 1 *11 2 1* 21 1 *2 2 11 | | 1 * 11 2 2 1 1 2 1 1 2 2 212 11 | | 1 2 1 1* 1 1 22 1 1 1 | | 1 1 2 1 2 2 * 1 2 1| | 1 2 1 2 2 2 | | 2 2 | | 1 | | 2 | | 2 2 | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1646.55 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1644.41 -1647.46 2 -1644.43 -1647.57 -------------------------------------- TOTAL -1644.42 -1647.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.881699 0.088110 0.338650 1.462084 0.845616 1468.06 1484.53 1.000 r(A<->C){all} 0.164422 0.018283 0.000074 0.439006 0.127064 239.23 240.06 1.001 r(A<->G){all} 0.166553 0.019843 0.000095 0.451560 0.129907 106.64 196.83 1.000 r(A<->T){all} 0.158334 0.019298 0.000010 0.448663 0.120719 241.09 273.84 1.000 r(C<->G){all} 0.162254 0.019710 0.000040 0.441978 0.124404 120.33 178.77 1.002 r(C<->T){all} 0.180578 0.022755 0.000084 0.483378 0.140270 153.75 198.33 1.003 r(G<->T){all} 0.167858 0.020402 0.000050 0.444202 0.129724 148.39 223.10 1.001 pi(A){all} 0.236261 0.000146 0.212782 0.259742 0.236218 988.85 1132.19 1.000 pi(C){all} 0.291451 0.000172 0.265510 0.316320 0.291242 1313.55 1344.10 1.001 pi(G){all} 0.290987 0.000168 0.267402 0.317412 0.290737 1207.59 1227.45 1.000 pi(T){all} 0.181301 0.000127 0.161142 0.205160 0.181016 1335.72 1418.36 1.000 alpha{1,2} 0.419650 0.216206 0.000180 1.356065 0.262052 889.43 1039.19 1.000 alpha{3} 0.457285 0.242008 0.000173 1.409732 0.298038 1224.26 1351.50 1.000 pinvar{all} 0.998709 0.000002 0.995897 0.999999 0.999186 948.94 1079.26 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ...**. 8 -- .****. 9 -- .*.*** 10 -- .**.** 11 -- .**... 12 -- ..**.. 13 -- ....** 14 -- .*..*. 15 -- .***.* 16 -- ..*..* 17 -- .*...* 18 -- ..**** 19 -- .*.*.. 20 -- ...*.* 21 -- ..*.*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 470 0.156562 0.005653 0.152565 0.160560 2 8 456 0.151899 0.011306 0.143904 0.159893 2 9 440 0.146569 0.003769 0.143904 0.149234 2 10 439 0.146236 0.010835 0.138574 0.153897 2 11 438 0.145903 0.001884 0.144570 0.147235 2 12 427 0.142239 0.006124 0.137908 0.146569 2 13 426 0.141905 0.001884 0.140573 0.143238 2 14 424 0.141239 0.002827 0.139241 0.143238 2 15 424 0.141239 0.017901 0.128581 0.153897 2 16 422 0.140573 0.012248 0.131912 0.149234 2 17 421 0.140240 0.002355 0.138574 0.141905 2 18 420 0.139907 0.007537 0.134577 0.145237 2 19 418 0.139241 0.001884 0.137908 0.140573 2 20 403 0.134244 0.004240 0.131246 0.137242 2 21 397 0.132245 0.003298 0.129913 0.134577 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097943 0.009116 0.000048 0.288642 0.071366 1.000 2 length{all}[2] 0.100628 0.010624 0.000014 0.303516 0.068970 1.000 2 length{all}[3] 0.095771 0.009140 0.000008 0.284270 0.066092 1.000 2 length{all}[4] 0.098946 0.010022 0.000023 0.297548 0.068353 1.000 2 length{all}[5] 0.096044 0.009273 0.000069 0.284666 0.066560 1.000 2 length{all}[6] 0.095733 0.009485 0.000022 0.300407 0.066196 1.000 2 length{all}[7] 0.101858 0.010294 0.000684 0.295680 0.074326 1.001 2 length{all}[8] 0.095400 0.009797 0.000049 0.307653 0.064082 1.000 2 length{all}[9] 0.101899 0.009837 0.000146 0.279310 0.068476 1.000 2 length{all}[10] 0.099125 0.010539 0.000213 0.304863 0.065427 0.998 2 length{all}[11] 0.101049 0.011830 0.000203 0.301769 0.068125 0.999 2 length{all}[12] 0.107525 0.011546 0.000511 0.304632 0.074464 1.010 2 length{all}[13] 0.104587 0.012287 0.000072 0.339817 0.063458 0.998 2 length{all}[14] 0.095073 0.009141 0.000120 0.291724 0.061417 0.999 2 length{all}[15] 0.106543 0.010307 0.000086 0.303211 0.081995 0.998 2 length{all}[16] 0.096401 0.009748 0.000029 0.278254 0.067816 1.001 2 length{all}[17] 0.093065 0.007645 0.000234 0.263679 0.067109 0.998 2 length{all}[18] 0.098287 0.008630 0.000208 0.284437 0.070588 0.998 2 length{all}[19] 0.106553 0.012551 0.000239 0.315059 0.072330 1.000 2 length{all}[20] 0.093284 0.007934 0.000396 0.261063 0.069488 0.998 2 length{all}[21] 0.095174 0.008702 0.000314 0.272531 0.070890 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006250 Maximum standard deviation of split frequencies = 0.017901 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.010 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |---------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------- C3 (3) + |--------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1200 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 59 patterns at 400 / 400 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 59 patterns at 400 / 400 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 57584 bytes for conP 5192 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.099921 0.041331 0.082245 0.033549 0.106368 0.051634 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1731.609126 Iterating by ming2 Initial: fx= 1731.609126 x= 0.09992 0.04133 0.08225 0.03355 0.10637 0.05163 0.30000 1.30000 1 h-m-p 0.0000 0.0001 955.4386 ++ 1653.383809 m 0.0001 13 | 1/8 2 h-m-p 0.0005 0.0027 101.9466 ++ 1653.192293 m 0.0027 24 | 2/8 3 h-m-p 0.0000 0.0001 703.5954 ++ 1640.417142 m 0.0001 35 | 3/8 4 h-m-p 0.0000 0.0000 3649631.8196 ++ 1636.810358 m 0.0000 46 | 4/8 5 h-m-p 0.0062 3.1133 208.2440 ------------.. | 4/8 6 h-m-p 0.0000 0.0001 673.5310 ++ 1592.257638 m 0.0001 78 | 5/8 7 h-m-p 0.0010 0.0192 54.5857 -----------.. | 5/8 8 h-m-p 0.0000 0.0001 553.5634 ++ 1572.473205 m 0.0001 109 | 6/8 9 h-m-p 0.0007 0.0283 37.0309 -----------.. | 6/8 10 h-m-p 0.0000 0.0000 393.3078 ++ 1568.844034 m 0.0000 140 | 7/8 11 h-m-p 1.6000 8.0000 0.0000 ---------Y 1568.844034 0 0.0000 160 | 7/8 12 h-m-p 0.0160 8.0000 0.0000 --Y 1568.844034 0 0.0003 174 Out.. lnL = -1568.844034 175 lfun, 175 eigenQcodon, 1050 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.096106 0.037468 0.073376 0.026166 0.010153 0.094076 0.000100 0.640356 0.395006 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.227813 np = 9 lnL0 = -1696.672356 Iterating by ming2 Initial: fx= 1696.672356 x= 0.09611 0.03747 0.07338 0.02617 0.01015 0.09408 0.00011 0.64036 0.39501 1 h-m-p 0.0000 0.0000 904.4513 ++ 1695.338302 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0001 629.0726 ++ 1673.276438 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0001 222.2662 ++ 1649.131262 m 0.0001 38 | 3/9 4 h-m-p 0.0002 0.0011 169.8799 ++ 1614.491821 m 0.0011 50 | 4/9 5 h-m-p 0.0000 0.0000 4688.3879 ++ 1574.935612 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0001 385.3366 ++ 1573.064008 m 0.0001 74 | 6/9 7 h-m-p 0.0001 0.0003 21.0662 ++ 1572.521418 m 0.0003 86 | 7/9 8 h-m-p 0.0006 0.0936 8.6079 -----------.. | 7/9 9 h-m-p 0.0000 0.0000 382.3747 ++ 1568.843787 m 0.0000 119 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 ++ 1568.843787 m 8.0000 131 | 8/9 11 h-m-p 0.0160 8.0000 0.0001 +++++ 1568.843786 m 8.0000 147 | 8/9 12 h-m-p 0.0069 3.4479 0.2301 ---------C 1568.843786 0 0.0000 169 | 8/9 13 h-m-p 0.0160 8.0000 0.0002 +++++ 1568.843784 m 8.0000 185 | 8/9 14 h-m-p 0.0083 3.4915 0.2278 -----------C 1568.843784 0 0.0000 209 | 8/9 15 h-m-p 0.0160 8.0000 0.0001 +++++ 1568.843784 m 8.0000 225 | 8/9 16 h-m-p 0.0070 3.5003 0.2273 -----------Y 1568.843784 0 0.0000 249 | 8/9 17 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9 18 h-m-p 0.0160 8.0000 0.0008 +++++ 1568.843778 m 8.0000 289 | 8/9 19 h-m-p 0.0297 3.5076 0.2288 ------------Y 1568.843778 0 0.0000 314 | 8/9 20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9 21 h-m-p 0.0160 8.0000 0.0009 +++++ 1568.843772 m 8.0000 354 | 8/9 22 h-m-p 0.0311 3.5955 0.2251 --------------.. | 8/9 23 h-m-p 0.0160 8.0000 0.0009 +++++ 1568.843765 m 8.0000 395 | 8/9 24 h-m-p 0.0326 3.6799 0.2219 ----------C 1568.843765 0 0.0000 418 | 8/9 25 h-m-p 0.0160 8.0000 0.0008 -------------.. | 8/9 26 h-m-p 0.0160 8.0000 0.0009 +++++ 1568.843758 m 8.0000 458 | 8/9 27 h-m-p 0.0342 3.7767 0.2182 ----------Y 1568.843758 0 0.0000 481 | 8/9 28 h-m-p 0.0160 8.0000 0.0000 -------Y 1568.843758 0 0.0000 501 | 8/9 29 h-m-p 0.0160 8.0000 0.0000 +++++ 1568.843758 m 8.0000 517 | 8/9 30 h-m-p 0.0082 4.0933 0.2014 ----------Y 1568.843758 0 0.0000 540 | 8/9 31 h-m-p 0.0160 8.0000 0.0000 +++++ 1568.843758 m 8.0000 556 | 8/9 32 h-m-p 0.0076 3.8156 0.2161 ----------C 1568.843758 0 0.0000 579 | 8/9 33 h-m-p 0.0160 8.0000 0.0000 +++++ 1568.843758 m 8.0000 595 | 8/9 34 h-m-p 0.0073 3.6384 0.2266 ----------C 1568.843758 0 0.0000 618 | 8/9 35 h-m-p 0.0160 8.0000 0.0002 ------------C 1568.843758 0 0.0000 643 | 8/9 36 h-m-p 0.0160 8.0000 0.0000 -------Y 1568.843758 0 0.0000 663 Out.. lnL = -1568.843758 664 lfun, 1992 eigenQcodon, 7968 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.058439 0.033268 0.025790 0.030593 0.022161 0.032943 0.000100 1.620790 0.187011 0.288106 1.211861 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 13.463181 np = 11 lnL0 = -1645.619772 Iterating by ming2 Initial: fx= 1645.619772 x= 0.05844 0.03327 0.02579 0.03059 0.02216 0.03294 0.00011 1.62079 0.18701 0.28811 1.21186 1 h-m-p 0.0000 0.0000 897.6379 ++ 1643.347360 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 349.2788 +++ 1594.704729 m 0.0005 31 | 2/11 3 h-m-p 0.0000 0.0000 2780.5667 ++ 1588.334691 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0002 402.4405 ++ 1580.270912 m 0.0002 59 | 4/11 5 h-m-p 0.0000 0.0000 9279.2456 ++ 1577.649163 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 14352.3394 ++ 1577.392634 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0000 2582.2832 ++ 1573.712390 m 0.0000 101 | 7/11 8 h-m-p 0.0160 8.0000 7.4261 -------------.. | 7/11 9 h-m-p 0.0000 0.0000 380.1772 ++ 1568.843870 m 0.0000 140 | 8/11 10 h-m-p 0.0839 8.0000 0.0000 ++++ 1568.843870 m 8.0000 156 | 8/11 11 h-m-p 0.0160 8.0000 0.0811 ---------Y 1568.843870 0 0.0000 182 | 8/11 12 h-m-p 0.0160 8.0000 0.0079 +++++ 1568.843868 m 8.0000 202 | 8/11 13 h-m-p 0.0375 8.0000 1.6805 --------------.. | 8/11 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1568.843868 m 8.0000 248 | 8/11 15 h-m-p 0.0056 1.8834 0.2172 +++++ 1568.843801 m 1.8834 268 | 9/11 16 h-m-p 0.1249 8.0000 2.8787 -------------Y 1568.843801 0 0.0000 298 | 9/11 17 h-m-p 0.0160 8.0000 0.0024 +++++ 1568.843798 m 8.0000 315 | 9/11 18 h-m-p 0.0160 8.0000 5.3929 -------------.. | 9/11 19 h-m-p 0.0160 8.0000 0.0002 +++++ 1568.843798 m 8.0000 359 | 9/11 20 h-m-p 0.0160 8.0000 0.1809 ----------Y 1568.843798 0 0.0000 385 | 9/11 21 h-m-p 0.0160 8.0000 0.0068 +++++ 1568.843790 m 8.0000 404 | 9/11 22 h-m-p 0.0160 8.0000 6.4629 -------------.. | 9/11 23 h-m-p 0.0160 8.0000 0.0002 +++++ 1568.843789 m 8.0000 448 | 9/11 24 h-m-p 0.0160 8.0000 0.4913 +++++ 1568.843481 m 8.0000 467 | 9/11 25 h-m-p 1.6000 8.0000 0.3357 ++ 1568.843469 m 8.0000 483 | 9/11 26 h-m-p 1.6000 8.0000 0.2412 ++ 1568.843469 m 8.0000 499 | 9/11 27 h-m-p 1.6000 8.0000 0.4082 ++ 1568.843468 m 8.0000 515 | 9/11 28 h-m-p 1.6000 8.0000 0.1739 ++ 1568.843468 m 8.0000 531 | 9/11 29 h-m-p 1.6000 8.0000 0.4321 ++ 1568.843468 m 8.0000 547 | 9/11 30 h-m-p 1.6000 8.0000 0.4977 ++ 1568.843468 m 8.0000 563 | 9/11 31 h-m-p 1.6000 8.0000 0.0000 N 1568.843468 0 1.6000 579 | 9/11 32 h-m-p 0.0160 8.0000 0.0000 Y 1568.843468 0 0.0160 595 Out.. lnL = -1568.843468 596 lfun, 2384 eigenQcodon, 10728 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1568.937466 S = -1568.845390 -0.035941 Calculating f(w|X), posterior probabilities of site classes. did 10 / 59 patterns 0:05 did 20 / 59 patterns 0:05 did 30 / 59 patterns 0:05 did 40 / 59 patterns 0:05 did 50 / 59 patterns 0:05 did 59 / 59 patterns 0:05 Time used: 0:05 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.067839 0.109078 0.045128 0.086217 0.054190 0.071635 0.000100 0.610140 1.925201 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 21.615884 np = 9 lnL0 = -1725.093722 Iterating by ming2 Initial: fx= 1725.093722 x= 0.06784 0.10908 0.04513 0.08622 0.05419 0.07163 0.00011 0.61014 1.92520 1 h-m-p 0.0000 0.0000 828.1877 ++ 1724.725356 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0052 118.5778 +++++ 1661.195394 m 0.0052 29 | 2/9 3 h-m-p 0.0001 0.0003 375.0348 ++ 1629.477894 m 0.0003 41 | 3/9 4 h-m-p 0.0003 0.0016 69.6199 ++ 1594.235029 m 0.0016 53 | 4/9 5 h-m-p 0.0001 0.0006 39.0575 ++ 1594.110547 m 0.0006 65 | 5/9 6 h-m-p 0.0000 0.0000 283.1715 ++ 1590.115624 m 0.0000 77 | 6/9 7 h-m-p 0.0001 0.0004 128.0400 ++ 1584.209625 m 0.0004 89 | 7/9 8 h-m-p 0.0246 8.0000 1.7079 -------------.. | 7/9 9 h-m-p 0.0000 0.0001 352.3898 ++ 1568.843468 m 0.0001 124 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 C 1568.843468 0 1.6000 136 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 N 1568.843468 0 0.0020 149 Out.. lnL = -1568.843468 150 lfun, 1650 eigenQcodon, 9000 P(t) Time used: 0:07 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.081603 0.090061 0.036648 0.063296 0.026378 0.018805 0.000100 0.900000 0.749453 1.159710 1.046216 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 14.915701 np = 11 lnL0 = -1685.954698 Iterating by ming2 Initial: fx= 1685.954698 x= 0.08160 0.09006 0.03665 0.06330 0.02638 0.01881 0.00011 0.90000 0.74945 1.15971 1.04622 1 h-m-p 0.0000 0.0000 863.4749 ++ 1685.029158 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0021 155.1760 ++++ 1638.513325 m 0.0021 32 | 2/11 3 h-m-p 0.0000 0.0001 316.1253 ++ 1628.223561 m 0.0001 46 | 3/11 4 h-m-p 0.0001 0.0005 257.9486 ++ 1615.804866 m 0.0005 60 | 4/11 5 h-m-p 0.0000 0.0001 854.3213 ++ 1592.374383 m 0.0001 74 | 5/11 6 h-m-p 0.0000 0.0001 2493.3286 ++ 1575.212967 m 0.0001 88 | 6/11 7 h-m-p 0.0000 0.0000 2991.4024 ++ 1570.264627 m 0.0000 102 | 7/11 8 h-m-p 0.0001 0.0004 54.8359 ++ 1569.239978 m 0.0004 116 | 8/11 9 h-m-p 0.0002 0.0009 4.0205 ++ 1568.843468 m 0.0009 130 | 9/11 10 h-m-p 1.6000 8.0000 0.0017 ++ 1568.843468 m 8.0000 144 | 9/11 11 h-m-p 1.6000 8.0000 0.0006 ---C 1568.843468 0 0.0063 163 | 9/11 12 h-m-p 0.1535 8.0000 0.0000 -----------Y 1568.843468 0 0.0000 190 Out.. lnL = -1568.843468 191 lfun, 2292 eigenQcodon, 12606 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1568.964597 S = -1568.845390 -0.053812 Calculating f(w|X), posterior probabilities of site classes. did 10 / 59 patterns 0:10 did 20 / 59 patterns 0:11 did 30 / 59 patterns 0:11 did 40 / 59 patterns 0:11 did 50 / 59 patterns 0:11 did 59 / 59 patterns 0:11 Time used: 0:11 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=400 NC_011896_1_WP_010907859_1_690_MLBR_RS03270 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL NC_002677_1_NP_301535_1_407_fadE23 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS NC_002677_1_NP_301535_1_407_fadE23 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL NC_002677_1_NP_301535_1_407_fadE23 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV NC_002677_1_NP_301535_1_407_fadE23 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF NC_002677_1_NP_301535_1_407_fadE23 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL NC_002677_1_NP_301535_1_407_fadE23 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE NC_002677_1_NP_301535_1_407_fadE23 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE ************************************************** NC_011896_1_WP_010907859_1_690_MLBR_RS03270 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK NC_002677_1_NP_301535_1_407_fadE23 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK **************************************************
>NC_011896_1_WP_010907859_1_690_MLBR_RS03270 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >NC_002677_1_NP_301535_1_407_fadE23 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG >NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 ATGGCAATCAACCTGGAGCTATCGCGCAAGCTGCAAGCGGTAATCGTTAA GACCCATCAGGGCGCCGCGGAATTGATGAGGCCGATCGCCCGCAAGTACG ACTTGAAGGAACATACCTACCCAGTCGAGCTAGACACCCTGTTCAATCTG TTTGCGGGAGCAGCCGAATCGTTCGCCTTTGCCGGCGCCGACGCGCTCGG CGATGAGGACAACAAAGACGAAAATCACAACGGCGCCAACATGGCCGCGC TGCTACAAACCCTGGAGGCCTGCTGGGGCGACGTCGCGATGTTACTGTCC ATACCGTATCAGGGTCTGGGCAACGCAGCCATCTCCGCAGTAGCCACCAA CAAGCAGCTGGAACGCTTAGGCAAGGTGTGGGCGGCTATGGCCATCACCG AGCCGGGGTTTGGGTCGGACTCGGCAGCGGTGTCGACGACCGCCACCCTC GACGGTGACGAGTATGTGATTAACGGTGAAAAGATCTTTGTTACCGCCGG GTCGCGCGCCACCCACATCGTGGTGTGGGCAACCCTAGACAAGTCGCTAG GCCACGCGGCGATAAAGTCATTCATCGTGCCACGCGAACATCCCGGTGTC ACAGTCGAACGCCTCGAGTACAAGCTAGGCATAAGGGGATCGGATACCGC TGCGATTCGATTTGATAACGTCCGAATTCCTAAAGACAACCTGCTAGGTA ACCCAGAAATCGAGGTTGGCAAGGGTTTTTCCGGAGTGATGGAGACTTTC GACAACACCCGGCCAATCGTTGCTGCCATGGCCGTCGGGGTTGGCCGCGC CGCGCTGGAGGAAATCCGCAAAATCCTCACCGATGCCGGTATAGAAATTT GCTACGACAAGCCCTCGCACTCCCAGAACGCCGCCGCGGCAGAGTTCCTG CGGATGGAAGCCGACTGGGAAGCGAGTTACCTGCTGTCGCTGCGTGCGGC GTGGCAAGCCGACAACAACATCCCCAACTCCAAAGAAGCATCGATGAGCA AGGCCAAAGCCGGCAGAATGGCCAGCGACGTTACCCTCAAGGCTGTCGAA TTAGCAGGCACCGCAGGCTATTCCGAGAAGGCCCTGTTGGAAAAGTGGGC CCGCGACTCCAAGATCTTAGACATCTTCGAGGGCACTCAGCAGATTCAGC AGCTGGTTGTTGCACGCCGATTGCTGGGCTTGTCCTCTTCCGAACTCAAG
>NC_011896_1_WP_010907859_1_690_MLBR_RS03270 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >NC_002677_1_NP_301535_1_407_fadE23 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK >NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 MAINLELSRKLQAVIVKTHQGAAELMRPIARKYDLKEHTYPVELDTLFNL FAGAAESFAFAGADALGDEDNKDENHNGANMAALLQTLEACWGDVAMLLS IPYQGLGNAAISAVATNKQLERLGKVWAAMAITEPGFGSDSAAVSTTATL DGDEYVINGEKIFVTAGSRATHIVVWATLDKSLGHAAIKSFIVPREHPGV TVERLEYKLGIRGSDTAAIRFDNVRIPKDNLLGNPEIEVGKGFSGVMETF DNTRPIVAAMAVGVGRAALEEIRKILTDAGIEICYDKPSHSQNAAAAEFL RMEADWEASYLLSLRAAWQADNNIPNSKEASMSKAKAGRMASDVTLKAVE LAGTAGYSEKALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSSELK
#NEXUS [ID: 9537121348] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907859_1_690_MLBR_RS03270 NC_002677_1_NP_301535_1_407_fadE23 NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 ; end; begin trees; translate 1 NC_011896_1_WP_010907859_1_690_MLBR_RS03270, 2 NC_002677_1_NP_301535_1_407_fadE23, 3 NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360, 4 NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305, 5 NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595, 6 NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07136614,2:0.06896968,3:0.06609241,4:0.06835285,5:0.06655987,6:0.06619582); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07136614,2:0.06896968,3:0.06609241,4:0.06835285,5:0.06655987,6:0.06619582); end;
Estimated marginal likelihoods for runs sampled in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1644.41 -1647.46 2 -1644.43 -1647.57 -------------------------------------- TOTAL -1644.42 -1647.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fadE23/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.881699 0.088110 0.338650 1.462084 0.845616 1468.06 1484.53 1.000 r(A<->C){all} 0.164422 0.018283 0.000074 0.439006 0.127064 239.23 240.06 1.001 r(A<->G){all} 0.166553 0.019843 0.000095 0.451560 0.129907 106.64 196.83 1.000 r(A<->T){all} 0.158334 0.019298 0.000010 0.448663 0.120719 241.09 273.84 1.000 r(C<->G){all} 0.162254 0.019710 0.000040 0.441978 0.124404 120.33 178.77 1.002 r(C<->T){all} 0.180578 0.022755 0.000084 0.483378 0.140270 153.75 198.33 1.003 r(G<->T){all} 0.167858 0.020402 0.000050 0.444202 0.129724 148.39 223.10 1.001 pi(A){all} 0.236261 0.000146 0.212782 0.259742 0.236218 988.85 1132.19 1.000 pi(C){all} 0.291451 0.000172 0.265510 0.316320 0.291242 1313.55 1344.10 1.001 pi(G){all} 0.290987 0.000168 0.267402 0.317412 0.290737 1207.59 1227.45 1.000 pi(T){all} 0.181301 0.000127 0.161142 0.205160 0.181016 1335.72 1418.36 1.000 alpha{1,2} 0.419650 0.216206 0.000180 1.356065 0.262052 889.43 1039.19 1.000 alpha{3} 0.457285 0.242008 0.000173 1.409732 0.298038 1224.26 1351.50 1.000 pinvar{all} 0.998709 0.000002 0.995897 0.999999 0.999186 948.94 1079.26 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/fadE23/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 400 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 6 6 6 6 6 6 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0 TTC 6 6 6 6 6 6 | TCC 9 9 9 9 9 9 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2 Leu TTA 4 4 4 4 4 4 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 5 5 5 5 5 | TCG 11 11 11 11 11 11 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1 CTC 6 6 6 6 6 6 | CCC 3 3 3 3 3 3 | CAC 4 4 4 4 4 4 | CGC 10 10 10 10 10 10 CTA 7 7 7 7 7 7 | CCA 4 4 4 4 4 4 | Gln CAA 3 3 3 3 3 3 | CGA 3 3 3 3 3 3 CTG 18 18 18 18 18 18 | CCG 3 3 3 3 3 3 | CAG 8 8 8 8 8 8 | CGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 5 5 5 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1 ATC 15 15 15 15 15 15 | ACC 16 16 16 16 16 16 | AAC 15 15 15 15 15 15 | AGC 2 2 2 2 2 2 ATA 4 4 4 4 4 4 | ACA 1 1 1 1 1 1 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1 Met ATG 10 10 10 10 10 10 | ACG 1 1 1 1 1 1 | AAG 18 18 18 18 18 18 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 8 8 8 8 8 8 | Ala GCT 4 4 4 4 4 4 | Asp GAT 4 4 4 4 4 4 | Gly GGT 7 7 7 7 7 7 GTC 7 7 7 7 7 7 | GCC 28 28 28 28 28 28 | GAC 18 18 18 18 18 18 | GGC 16 16 16 16 16 16 GTA 2 2 2 2 2 2 | GCA 11 11 11 11 11 11 | Glu GAA 17 17 17 17 17 17 | GGA 3 3 3 3 3 3 GTG 7 7 7 7 7 7 | GCG 16 16 16 16 16 16 | GAG 13 13 13 13 13 13 | GGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907859_1_690_MLBR_RS03270 position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 #2: NC_002677_1_NP_301535_1_407_fadE23 position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 #3: NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360 position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 #4: NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305 position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 #5: NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595 position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 #6: NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680 position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 36 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0 TTC 36 | TCC 54 | TAC 30 | TGC 12 Leu L TTA 24 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 30 | TCG 66 | TAG 0 | Trp W TGG 36 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 6 CTC 36 | CCC 18 | CAC 24 | CGC 60 CTA 42 | CCA 24 | Gln Q CAA 18 | CGA 18 CTG 108 | CCG 18 | CAG 48 | CGG 12 ------------------------------------------------------------------------------ Ile I ATT 30 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 6 ATC 90 | ACC 96 | AAC 90 | AGC 12 ATA 24 | ACA 6 | Lys K AAA 30 | Arg R AGA 6 Met M ATG 60 | ACG 6 | AAG 108 | AGG 12 ------------------------------------------------------------------------------ Val V GTT 48 | Ala A GCT 24 | Asp D GAT 24 | Gly G GGT 42 GTC 42 | GCC 168 | GAC 108 | GGC 96 GTA 12 | GCA 66 | Glu E GAA 102 | GGA 18 GTG 42 | GCG 96 | GAG 78 | GGG 24 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14750 C:0.19000 A:0.25000 G:0.41250 position 2: T:0.27500 C:0.28000 A:0.29500 G:0.15000 position 3: T:0.12000 C:0.40500 A:0.16500 G:0.31000 Average T:0.18083 C:0.29167 A:0.23667 G:0.29083 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1568.844034 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.046216 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907859_1_690_MLBR_RS03270: 0.000004, NC_002677_1_NP_301535_1_407_fadE23: 0.000004, NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360: 0.000004, NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305: 0.000004, NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595: 0.000004, NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 1.04622 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 960.3 239.7 1.0462 0.0000 0.0000 0.0 0.0 7..2 0.000 960.3 239.7 1.0462 0.0000 0.0000 0.0 0.0 7..3 0.000 960.3 239.7 1.0462 0.0000 0.0000 0.0 0.0 7..4 0.000 960.3 239.7 1.0462 0.0000 0.0000 0.0 0.0 7..5 0.000 960.3 239.7 1.0462 0.0000 0.0000 0.0 0.0 7..6 0.000 960.3 239.7 1.0462 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1568.843758 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.175493 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907859_1_690_MLBR_RS03270: 0.000004, NC_002677_1_NP_301535_1_407_fadE23: 0.000004, NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360: 0.000004, NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305: 0.000004, NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595: 0.000004, NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.17549 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 960.3 239.7 0.1755 0.0000 0.0000 0.0 0.0 7..2 0.000 960.3 239.7 0.1755 0.0000 0.0000 0.0 0.0 7..3 0.000 960.3 239.7 0.1755 0.0000 0.0000 0.0 0.0 7..4 0.000 960.3 239.7 0.1755 0.0000 0.0000 0.0 0.0 7..5 0.000 960.3 239.7 0.1755 0.0000 0.0000 0.0 0.0 7..6 0.000 960.3 239.7 0.1755 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1568.843468 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907859_1_690_MLBR_RS03270: 0.000004, NC_002677_1_NP_301535_1_407_fadE23: 0.000004, NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360: 0.000004, NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305: 0.000004, NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595: 0.000004, NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907859_1_690_MLBR_RS03270) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099 w2: 0.106 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.011 0.010 0.010 0.011 0.010 0.010 0.010 0.010 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 sum of density on p0-p1 = 1.000000 Time used: 0:05 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1568.843468 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.961972 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907859_1_690_MLBR_RS03270: 0.000004, NC_002677_1_NP_301535_1_407_fadE23: 0.000004, NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360: 0.000004, NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305: 0.000004, NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595: 0.000004, NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.96197 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:07 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1568.843468 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.215493 1.356559 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907859_1_690_MLBR_RS03270: 0.000004, NC_002677_1_NP_301535_1_407_fadE23: 0.000004, NZ_LVXE01000001_1_WP_010907859_1_76_A3216_RS00360: 0.000004, NZ_LYPH01000001_1_WP_010907859_1_64_A8144_RS00305: 0.000004, NZ_CP029543_1_WP_010907859_1_706_DIJ64_RS03595: 0.000004, NZ_AP014567_1_WP_010907859_1_723_JK2ML_RS03680: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.21549 (p1 = 0.00001) w = 1.35656 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.35656 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 960.3 239.7 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907859_1_690_MLBR_RS03270) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.091 0.093 0.095 0.097 0.099 0.101 0.103 0.105 0.107 0.110 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.109 0.107 0.105 0.103 0.101 0.099 0.097 0.095 0.094 0.092 Time used: 0:11
Model 1: NearlyNeutral -1568.843758 Model 2: PositiveSelection -1568.843468 Model 0: one-ratio -1568.844034 Model 7: beta -1568.843468 Model 8: beta&w>1 -1568.843468 Model 0 vs 1 5.51999999970576E-4 Model 2 vs 1 5.799999998998828E-4 Model 8 vs 7 0.0