--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 11 19:12:42 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/206/Chrac-14-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1003.62 -1019.47
2 -1003.82 -1019.20
--------------------------------------
TOTAL -1003.71 -1019.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.741672 0.021176 0.482745 1.030501 0.724172 1244.74 1259.94 1.000
r(A<->C){all} 0.065714 0.000859 0.011769 0.120615 0.061903 802.44 818.04 1.000
r(A<->G){all} 0.212069 0.003302 0.109859 0.333056 0.206406 534.66 608.84 1.000
r(A<->T){all} 0.083458 0.002556 0.000215 0.178753 0.075942 461.48 482.80 1.000
r(C<->G){all} 0.053630 0.000579 0.009429 0.099983 0.051294 692.26 922.20 1.001
r(C<->T){all} 0.511629 0.006240 0.352431 0.663435 0.512056 639.85 685.03 1.000
r(G<->T){all} 0.073500 0.001480 0.011034 0.148840 0.068235 698.19 741.89 1.000
pi(A){all} 0.245949 0.000428 0.207191 0.287520 0.245300 1071.39 1088.14 1.000
pi(C){all} 0.304393 0.000430 0.264670 0.345523 0.303953 1056.12 1148.43 1.000
pi(G){all} 0.296726 0.000466 0.254436 0.338992 0.296180 1254.80 1314.85 1.000
pi(T){all} 0.152932 0.000258 0.122058 0.185669 0.152522 1059.87 1253.58 1.000
alpha{1,2} 0.065419 0.001459 0.000147 0.130183 0.066039 1145.79 1189.27 1.000
alpha{3} 1.883304 0.536422 0.720060 3.367525 1.765320 959.68 1230.34 1.000
pinvar{all} 0.280054 0.009101 0.088615 0.463562 0.284792 1244.97 1372.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -939.061046
Model 2: PositiveSelection -939.061046
Model 0: one-ratio -951.408051
Model 3: discrete -938.716194
Model 7: beta -938.801668
Model 8: beta&w>1 -938.799396
Model 0 vs 1 24.694009999999935
Model 2 vs 1 0.0
Model 8 vs 7 0.004543999999896187
>C1
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSNTAENANASATATAEEAPEo
>C2
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTVENANASSTAAAAEEAAE
>C3
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTAENANASATAAAAEEAAE
>C4
MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSVAESANASATPAAEEAAEo
>C5
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSTTENANAIATAAAEVAAEo
>C6
MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDTSSSENANASSTAVVEEATEo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
C1 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
C2 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
C3 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
C4 MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS
C5 MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
C6 MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS
***************.*****:**:*********.***************
C1 SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
C2 SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
C3 SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
C4 SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
C5 SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
C6 SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
********************************************:**:**
C1 ESKASKKDSNTAENANASATAT-AEEAPEo
C2 ESKASKKDSSTVENANASSTAAAAEEAAE-
C3 ESKASKKDSSTAENANASATAAAAEEAAE-
C4 ESKASKKDSSVAESANASATPA-AEEAAEo
C5 ESKASKKDSSTTENANAIATAA-AEVAAEo
C6 ESKASKKDTSSSENANASSTAV-VEEATEo
********:. *.*** :*.. .* *.*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3974]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3974]--->[3958]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.306 Mb, Max= 30.514 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSNTAENANASATAT-AEEAPEo
>C2
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTVENANASSTAAAAEEAAE-
>C3
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTAENANASATAAAAEEAAE-
>C4
MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSVAESANASATPA-AEEAAEo
>C5
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSTTENANAIATAA-AEVAAEo
>C6
MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDTSSSENANASSTAV-VEEATEo
FORMAT of file /tmp/tmp7879960221030636985aln Not Supported[FATAL:T-COFFEE]
>C1
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSNTAENANASATAT-AEEAPEo
>C2
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTVENANASSTAAAAEEAAE-
>C3
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTAENANASATAAAAEEAAE-
>C4
MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSVAESANASATPA-AEEAAEo
>C5
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSTTENANAIATAA-AEVAAEo
>C6
MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDTSSSENANASSTAV-VEEATEo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:130 S:97 BS:130
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 96.09 C1 C2 96.09
TOP 1 0 96.09 C2 C1 96.09
BOT 0 2 97.66 C1 C3 97.66
TOP 2 0 97.66 C3 C1 97.66
BOT 0 3 92.25 C1 C4 92.25
TOP 3 0 92.25 C4 C1 92.25
BOT 0 4 93.80 C1 C5 93.80
TOP 4 0 93.80 C5 C1 93.80
BOT 0 5 89.15 C1 C6 89.15
TOP 5 0 89.15 C6 C1 89.15
BOT 1 2 98.45 C2 C3 98.45
TOP 2 1 98.45 C3 C2 98.45
BOT 1 3 92.97 C2 C4 92.97
TOP 3 1 92.97 C4 C2 92.97
BOT 1 4 95.31 C2 C5 95.31
TOP 4 1 95.31 C5 C2 95.31
BOT 1 5 90.62 C2 C6 90.62
TOP 5 1 90.62 C6 C2 90.62
BOT 2 3 94.53 C3 C4 94.53
TOP 3 2 94.53 C4 C3 94.53
BOT 2 4 96.09 C3 C5 96.09
TOP 4 2 96.09 C5 C3 96.09
BOT 2 5 89.84 C3 C6 89.84
TOP 5 2 89.84 C6 C3 89.84
BOT 3 4 93.80 C4 C5 93.80
TOP 4 3 93.80 C5 C4 93.80
BOT 3 5 91.47 C4 C6 91.47
TOP 5 3 91.47 C6 C4 91.47
BOT 4 5 89.92 C5 C6 89.92
TOP 5 4 89.92 C6 C5 89.92
AVG 0 C1 * 93.79
AVG 1 C2 * 94.69
AVG 2 C3 * 95.31
AVG 3 C4 * 93.00
AVG 4 C5 * 93.79
AVG 5 C6 * 90.20
TOT TOT * 93.46
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTCGAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTGATTGGCCG
C2 ATGGTCGAGCGCATCGAGGATCTTAACCTACCGAATGCCGTGATTGGCCG
C3 ATGGTCGAGCGCATCGAGGATCTTAACCTACCAAATGCCGTGATTGGCCG
C4 ATGGTCGAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTAATTGCGCG
C5 ATGGTCGAACGCATCGAGGATCTTAACCTGCCGAACGCCGTGATTGGCCG
C6 ATGGTCGAGCGCATCGAGGACCTCAACCTGCCCAACGCTGTGATTGCCCG
********.*********** ** *****.** ** ** **.**** **
C1 GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGC
C2 GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGA
C3 GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGA
C4 GCTCATCAAGGAATCACTGCCGGAGTCAGCCAGCGTCAGCAAGGAAGCGC
C5 GCTCATCAAGGAAGCACTGCCGGAGTCAGCCAGCGTCAGCAAGGAAGCGC
C6 GCTCATCAAGGAATCGCTGCCGGACTCTGCGAGCGTCAGCAAGGAGGCGC
************* *.******** **:** ** ***********.***.
C1 GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTCGTGACATCC
C2 GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
C3 GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
C4 GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
C5 GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
C6 GCGGTGCGATTGCCCGGGCAGCATCCGTGTTTGCCATCTTCGTGACCTCC
*.* :***** *****.**.***** ************** *****.***
C1 TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
C2 TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
C3 TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
C4 TCGTCGACGGCGTTGGCCCACAAGCAGAATCACAAGACCATCACGGCCAA
C5 TCGTCGACGGCTTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
C6 TCGTCGACGGCTCTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
*********** **************** ********************
C1 GGATATTCTACAGACCCTCACCGAGCTAGACTTCGAAAGCTTCGTGCCCT
C2 GGACATTCTACAGACCCTCACCGAGCTAGACTTCGAGAGCTTTGTGCCCT
C3 GGATATTCTACAGACCCTTACCGAGCTAGACTTCGAGAGCTTTGTGCCCT
C4 AGATATTCTACAGACCCTCACTGAGCTGGACTTCGAGAGTTTTGTGCCCT
C5 GGATATTCTACAGACCCTCACCGAGCTGGACTTCGAGAGCTTTGTGCCCT
C6 GGACATTCTGCAGACCCTCACCGAGCTGGACTTCGAGAGTTTCGTGCCCT
.** *****.******** ** *****.********.** ** *******
C1 CTCTGACGCAGGATCTCGAGGTCTATCGTAAAGTGGTCAAGGAGAAAAAG
C2 CCCTGACGCAGGATCTTGAGGTCTATCGAAAAGTGGTCAAGGAGAAAAAG
C3 CCCTGACGCAAGATCTTGAGGTCTATCGAAAAGTGGTCAAGGAGAAAAAG
C4 CCCTGACGCAGGATCTCGAGGTCTATCGCAAGATGGTCAAGGACAAAAAG
C5 CCCTGACGCAGGATCTGGAGGTCTATCGCAAAATGGTCAAGGACAAAAAG
C6 CGCTGACGCAGGACCTGGAGGTCTACCGGAAAATGGTGAAGGATAAGAAG
* ********.** ** ******** ** **..**** ***** **.***
C1 GAGAGCAAGGCCAGCAAGAAGGATTCCAACACTGCCGAAAATGCCAACGC
C2 GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACTGTCGAAAATGCCAACGC
C3 GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACTGCCGAAAATGCCAACGC
C4 GAGAGCAAGGCCAGCAAGAAAGACTCCAGCGTCGCCGAAAGTGCCAATGC
C5 GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACCACCGAAAATGCCAACGC
C6 GAGAGCAAGGCCAGCAAGAAGGACACGAGCAGCTCGGAAAATGCCAACGC
********************.** :* *.*. ****.****** **
C1 CAGTGCCACCGCAACA---GCAGAGGAAGCCCCCGAG---
C2 CAGTTCCACAGCCGCAGCAGCAGAGGAAGCCGCCGAG---
C3 CAGTGCCACCGCCGCAGCAGCAGAGGAAGCCGCCGAG---
C4 AAGTGCGACTCCAGCC---GCAGAGGAGGCTGCCGAG---
C5 CATTGCCACAGCAGCC---GCGGAGGTAGCTGCCGAG---
C6 CAGCAGCACGGCCGTC---GTTGAAGAAGCCACCGAG---
.* ** *.. . * **.*:.** *****
>C1
ATGGTCGAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTGATTGGCCG
GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGC
GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTCGTGACATCC
TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
GGATATTCTACAGACCCTCACCGAGCTAGACTTCGAAAGCTTCGTGCCCT
CTCTGACGCAGGATCTCGAGGTCTATCGTAAAGTGGTCAAGGAGAAAAAG
GAGAGCAAGGCCAGCAAGAAGGATTCCAACACTGCCGAAAATGCCAACGC
CAGTGCCACCGCAACA---GCAGAGGAAGCCCCCGAG---
>C2
ATGGTCGAGCGCATCGAGGATCTTAACCTACCGAATGCCGTGATTGGCCG
GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGA
GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
GGACATTCTACAGACCCTCACCGAGCTAGACTTCGAGAGCTTTGTGCCCT
CCCTGACGCAGGATCTTGAGGTCTATCGAAAAGTGGTCAAGGAGAAAAAG
GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACTGTCGAAAATGCCAACGC
CAGTTCCACAGCCGCAGCAGCAGAGGAAGCCGCCGAG---
>C3
ATGGTCGAGCGCATCGAGGATCTTAACCTACCAAATGCCGTGATTGGCCG
GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGA
GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
GGATATTCTACAGACCCTTACCGAGCTAGACTTCGAGAGCTTTGTGCCCT
CCCTGACGCAAGATCTTGAGGTCTATCGAAAAGTGGTCAAGGAGAAAAAG
GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACTGCCGAAAATGCCAACGC
CAGTGCCACCGCCGCAGCAGCAGAGGAAGCCGCCGAG---
>C4
ATGGTCGAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTAATTGCGCG
GCTCATCAAGGAATCACTGCCGGAGTCAGCCAGCGTCAGCAAGGAAGCGC
GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
TCGTCGACGGCGTTGGCCCACAAGCAGAATCACAAGACCATCACGGCCAA
AGATATTCTACAGACCCTCACTGAGCTGGACTTCGAGAGTTTTGTGCCCT
CCCTGACGCAGGATCTCGAGGTCTATCGCAAGATGGTCAAGGACAAAAAG
GAGAGCAAGGCCAGCAAGAAAGACTCCAGCGTCGCCGAAAGTGCCAATGC
AAGTGCGACTCCAGCC---GCAGAGGAGGCTGCCGAG---
>C5
ATGGTCGAACGCATCGAGGATCTTAACCTGCCGAACGCCGTGATTGGCCG
GCTCATCAAGGAAGCACTGCCGGAGTCAGCCAGCGTCAGCAAGGAAGCGC
GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC
TCGTCGACGGCTTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
GGATATTCTACAGACCCTCACCGAGCTGGACTTCGAGAGCTTTGTGCCCT
CCCTGACGCAGGATCTGGAGGTCTATCGCAAAATGGTCAAGGACAAAAAG
GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACCACCGAAAATGCCAACGC
CATTGCCACAGCAGCC---GCGGAGGTAGCTGCCGAG---
>C6
ATGGTCGAGCGCATCGAGGACCTCAACCTGCCCAACGCTGTGATTGCCCG
GCTCATCAAGGAATCGCTGCCGGACTCTGCGAGCGTCAGCAAGGAGGCGC
GCGGTGCGATTGCCCGGGCAGCATCCGTGTTTGCCATCTTCGTGACCTCC
TCGTCGACGGCTCTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA
GGACATTCTGCAGACCCTCACCGAGCTGGACTTCGAGAGTTTCGTGCCCT
CGCTGACGCAGGACCTGGAGGTCTACCGGAAAATGGTGAAGGATAAGAAG
GAGAGCAAGGCCAGCAAGAAGGACACGAGCAGCTCGGAAAATGCCAACGC
CAGCAGCACGGCCGTC---GTTGAAGAAGCCACCGAG---
>C1
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSNTAENANASATAToAEEAPE
>C2
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTVENANASSTAAAAEEAAE
>C3
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
ESKASKKDSSTAENANASATAAAAEEAAE
>C4
MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSVAESANASATPAoAEEAAE
>C5
MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDSSTTENANAIATAAoAEVAAE
>C6
MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS
SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
ESKASKKDTSSSENANASSTAVoVEEATE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 390 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478891281
Setting output file names to "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1239482024
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3081257782
Seed = 286931855
Swapseed = 1478891281
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 17 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 43 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1260.304617 -- -24.965149
Chain 2 -- -1268.001034 -- -24.965149
Chain 3 -- -1235.591203 -- -24.965149
Chain 4 -- -1240.600134 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1254.449288 -- -24.965149
Chain 2 -- -1243.578408 -- -24.965149
Chain 3 -- -1267.199038 -- -24.965149
Chain 4 -- -1262.915431 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1260.305] (-1268.001) (-1235.591) (-1240.600) * [-1254.449] (-1243.578) (-1267.199) (-1262.915)
500 -- (-1058.495) [-1048.219] (-1060.893) (-1059.339) * [-1051.640] (-1048.782) (-1068.076) (-1056.340) -- 0:00:00
1000 -- (-1054.750) [-1039.016] (-1045.824) (-1036.981) * (-1055.530) (-1035.019) [-1040.325] (-1044.430) -- 0:00:00
1500 -- (-1043.069) [-1022.960] (-1041.281) (-1025.975) * (-1054.582) [-1028.721] (-1023.610) (-1039.519) -- 0:00:00
2000 -- (-1045.433) (-1016.736) [-1031.241] (-1020.691) * (-1051.200) [-1009.488] (-1017.252) (-1031.380) -- 0:00:00
2500 -- (-1036.522) [-1013.339] (-1025.027) (-1011.332) * (-1040.513) [-1007.772] (-1022.137) (-1015.395) -- 0:06:39
3000 -- (-1022.463) (-1012.102) [-1016.366] (-1006.375) * (-1023.319) [-1003.025] (-1010.192) (-1008.362) -- 0:05:32
3500 -- (-1014.250) (-1008.217) [-1008.002] (-1002.599) * (-1020.667) [-1014.398] (-1020.728) (-1005.014) -- 0:04:44
4000 -- (-1008.012) (-1009.810) (-1010.466) [-1005.035] * [-1015.195] (-1005.392) (-1018.238) (-1005.202) -- 0:04:09
4500 -- (-1010.365) [-1014.369] (-1002.091) (-1004.231) * (-1011.114) [-1003.183] (-1012.836) (-1001.914) -- 0:03:41
5000 -- [-1008.141] (-1010.110) (-1010.069) (-1007.734) * [-1006.546] (-1003.942) (-1016.570) (-1001.613) -- 0:03:19
Average standard deviation of split frequencies: 0.125708
5500 -- (-1006.179) (-1006.696) (-1005.581) [-1007.588] * (-1011.829) [-1007.822] (-1008.542) (-1008.328) -- 0:03:00
6000 -- (-1009.425) (-1008.894) (-1016.512) [-1003.427] * (-1007.781) (-1005.306) [-1008.002] (-1010.194) -- 0:02:45
6500 -- (-1012.827) [-1010.985] (-1013.943) (-1004.715) * (-1004.567) (-1011.928) [-1004.034] (-1015.445) -- 0:02:32
7000 -- (-1009.360) [-1004.548] (-1013.504) (-1008.736) * (-1012.689) (-1009.141) (-1005.003) [-1010.493] -- 0:02:21
7500 -- (-1010.816) (-1010.044) (-1013.631) [-1005.062] * (-1008.650) (-1002.646) (-1007.258) [-1006.616] -- 0:04:24
8000 -- (-1009.677) (-1007.050) [-1004.405] (-1010.891) * (-1003.539) (-1007.913) (-1015.946) [-1004.964] -- 0:04:08
8500 -- (-1006.210) (-1010.146) [-1003.467] (-1011.037) * [-1008.160] (-1006.355) (-1017.403) (-1006.158) -- 0:03:53
9000 -- [-1003.822] (-1010.433) (-1008.320) (-1008.936) * (-1003.419) [-1001.125] (-1011.614) (-1003.421) -- 0:03:40
9500 -- (-1014.218) (-1004.408) (-1008.085) [-1011.975] * (-1002.656) [-1001.589] (-1011.733) (-1010.678) -- 0:03:28
10000 -- (-1011.795) [-1004.946] (-1004.747) (-1008.458) * (-1003.964) [-1006.407] (-1014.263) (-1006.895) -- 0:03:18
Average standard deviation of split frequencies: 0.044194
10500 -- (-1012.008) (-1011.867) [-1011.427] (-1008.078) * (-1003.669) [-1009.630] (-1007.145) (-1018.664) -- 0:03:08
11000 -- [-1012.088] (-1005.293) (-1004.665) (-1009.273) * (-1003.290) [-1006.519] (-1011.011) (-1018.292) -- 0:02:59
11500 -- (-1015.394) [-1006.764] (-1005.522) (-1005.239) * [-1010.392] (-1009.143) (-1014.230) (-1005.961) -- 0:02:51
12000 -- (-1005.916) (-1003.365) [-1002.840] (-1011.841) * (-1010.524) [-1005.257] (-1017.899) (-1010.425) -- 0:04:07
12500 -- [-1005.123] (-1005.036) (-1008.431) (-1010.550) * (-1006.213) [-1003.885] (-1011.109) (-1009.271) -- 0:03:57
13000 -- (-1012.783) [-1001.075] (-1002.555) (-1008.995) * (-1006.954) (-1017.228) (-1010.286) [-1006.317] -- 0:03:47
13500 -- (-1007.366) [-1004.868] (-1008.801) (-1005.162) * (-1016.314) (-1011.623) (-1007.692) [-1001.636] -- 0:03:39
14000 -- [-1006.234] (-1008.187) (-1004.714) (-1004.475) * (-1012.300) (-1004.870) (-1007.443) [-1004.520] -- 0:03:31
14500 -- (-1007.239) (-1008.816) (-1012.846) [-1009.999] * (-1012.090) (-1002.218) (-1010.395) [-1002.609] -- 0:03:23
15000 -- (-1010.458) (-1004.729) (-1011.118) [-1001.134] * (-1018.738) [-1005.780] (-1015.095) (-1009.673) -- 0:03:17
Average standard deviation of split frequencies: 0.019642
15500 -- [-1013.965] (-1018.134) (-1010.514) (-1005.824) * (-1008.560) (-1011.985) (-1008.315) [-1006.797] -- 0:03:10
16000 -- (-1011.197) [-1009.028] (-1010.026) (-1011.344) * [-1002.863] (-1006.567) (-1010.123) (-1002.302) -- 0:03:04
16500 -- (-1012.345) [-1011.059] (-1008.254) (-1006.902) * [-1010.282] (-1015.618) (-1007.048) (-1006.731) -- 0:02:58
17000 -- [-1013.098] (-1016.092) (-1006.723) (-1004.411) * (-1008.488) (-1008.177) (-1007.338) [-1007.618] -- 0:03:51
17500 -- (-1007.634) [-1007.562] (-1003.916) (-1019.812) * (-1003.052) [-1005.430] (-1003.880) (-1010.856) -- 0:03:44
18000 -- [-1005.563] (-1021.292) (-1009.557) (-1011.953) * (-1006.389) (-1007.015) (-1010.716) [-1007.942] -- 0:03:38
18500 -- (-1001.024) (-1007.390) (-1007.952) [-1009.757] * [-1005.026] (-1008.264) (-1009.310) (-1006.326) -- 0:03:32
19000 -- [-1009.608] (-1004.274) (-1010.827) (-1005.860) * [-1004.260] (-1008.865) (-1011.647) (-1011.110) -- 0:03:26
19500 -- [-1004.327] (-1004.384) (-1011.990) (-1007.505) * (-1009.027) [-1007.562] (-1017.470) (-1013.361) -- 0:03:21
20000 -- (-1005.187) (-1007.141) (-1012.456) [-1010.505] * (-1014.697) [-1006.387] (-1010.878) (-1014.259) -- 0:03:16
Average standard deviation of split frequencies: 0.045620
20500 -- (-1009.854) (-1006.648) (-1013.549) [-1005.761] * (-1005.980) (-1009.838) [-1008.749] (-1007.278) -- 0:03:11
21000 -- (-1006.783) [-1006.264] (-1005.379) (-1004.971) * (-1007.035) [-1002.230] (-1011.903) (-1012.524) -- 0:03:06
21500 -- (-1011.481) (-1009.746) [-1010.431] (-1012.666) * (-1006.988) (-1013.963) (-1009.540) [-1006.353] -- 0:03:47
22000 -- [-1008.091] (-1007.286) (-1010.461) (-1007.936) * [-1003.144] (-1010.036) (-1014.085) (-1007.812) -- 0:03:42
22500 -- (-1015.792) [-1007.001] (-1005.044) (-1004.138) * (-1014.580) (-1009.094) (-1013.372) [-1006.700] -- 0:03:37
23000 -- (-1019.794) [-1009.220] (-1004.772) (-1016.199) * (-1006.933) (-1008.266) [-1006.024] (-1012.072) -- 0:03:32
23500 -- (-1011.752) (-1003.233) [-1004.379] (-1004.132) * (-1014.036) (-1004.140) [-1011.568] (-1007.274) -- 0:03:27
24000 -- (-1014.903) (-1007.971) (-1013.542) [-1002.336] * (-1016.243) (-1003.677) [-1008.797] (-1017.997) -- 0:03:23
24500 -- (-1010.082) (-1012.794) (-1005.289) [-1005.342] * (-1026.082) [-1005.699] (-1005.858) (-1009.087) -- 0:03:19
25000 -- (-1008.847) (-1008.963) (-1007.840) [-1004.705] * (-1015.898) (-1003.130) (-1012.951) [-1009.120] -- 0:03:15
Average standard deviation of split frequencies: 0.006044
25500 -- (-1010.259) [-1010.515] (-1006.074) (-1011.694) * (-1014.731) [-1006.208] (-1013.600) (-1004.887) -- 0:03:11
26000 -- [-1005.864] (-1014.926) (-1009.652) (-1011.001) * (-1013.409) [-1012.319] (-1017.425) (-1008.645) -- 0:03:44
26500 -- [-1008.872] (-1013.419) (-1007.145) (-1009.778) * (-1004.900) (-1002.794) [-1017.187] (-1004.237) -- 0:03:40
27000 -- [-1009.495] (-1006.960) (-1011.339) (-1010.296) * (-1006.220) [-1005.413] (-1012.694) (-1011.276) -- 0:03:36
27500 -- (-1007.231) (-1009.517) (-1009.780) [-1004.494] * (-1013.796) (-1010.497) (-1007.315) [-1009.202] -- 0:03:32
28000 -- [-1005.496] (-1011.615) (-1004.532) (-1004.487) * (-1008.063) (-1005.293) [-1005.894] (-1013.308) -- 0:03:28
28500 -- [-1008.104] (-1007.628) (-1007.942) (-1002.735) * (-1010.916) (-1011.770) (-1009.555) [-1007.818] -- 0:03:24
29000 -- [-1006.129] (-1013.050) (-1009.673) (-1006.830) * (-1007.176) (-1014.203) [-1012.148] (-1008.878) -- 0:03:20
29500 -- (-1013.254) [-1006.241] (-1010.941) (-1010.343) * [-1010.382] (-1008.024) (-1009.561) (-1020.472) -- 0:03:17
30000 -- (-1007.006) [-1005.267] (-1007.415) (-1006.172) * [-1006.209] (-1010.647) (-1012.540) (-1012.887) -- 0:03:14
Average standard deviation of split frequencies: 0.030744
30500 -- (-1007.963) (-1010.835) (-1007.802) [-1006.399] * (-1007.311) (-1005.951) [-1013.574] (-1014.771) -- 0:03:10
31000 -- (-1008.312) [-1012.360] (-1006.514) (-1002.613) * (-1015.635) (-1006.796) (-1010.680) [-1006.009] -- 0:03:38
31500 -- (-1010.070) (-1014.760) (-1012.518) [-1001.593] * (-1013.534) (-1004.447) (-1012.782) [-1010.597] -- 0:03:35
32000 -- (-1015.678) (-1009.726) [-1008.206] (-1001.775) * (-1009.720) (-1015.396) [-1008.900] (-1007.273) -- 0:03:31
32500 -- (-1015.585) (-1005.375) [-1012.549] (-1006.894) * (-1008.555) (-1017.745) [-1005.921] (-1006.067) -- 0:03:28
33000 -- (-1011.057) (-1013.715) [-1008.360] (-1005.767) * (-1004.613) [-1007.770] (-1013.587) (-1010.280) -- 0:03:25
33500 -- [-1005.645] (-1010.672) (-1006.829) (-1003.425) * (-1008.825) (-1013.839) (-1005.989) [-1009.867] -- 0:03:21
34000 -- [-1010.457] (-1013.217) (-1003.917) (-1011.445) * [-1006.088] (-1012.226) (-1005.863) (-1008.383) -- 0:03:18
34500 -- [-1008.315] (-1006.183) (-1004.690) (-1008.011) * [-1008.701] (-1013.277) (-1009.424) (-1003.460) -- 0:03:15
35000 -- (-1013.461) [-1006.556] (-1010.599) (-1008.602) * [-1008.233] (-1016.302) (-1004.151) (-1005.991) -- 0:03:13
Average standard deviation of split frequencies: 0.021824
35500 -- (-1006.188) (-1013.896) [-1012.888] (-1007.104) * (-1004.722) [-1007.663] (-1019.056) (-1002.251) -- 0:03:10
36000 -- [-1009.133] (-1011.909) (-1004.068) (-1005.334) * [-1008.770] (-1012.518) (-1006.073) (-1006.623) -- 0:03:34
36500 -- (-1008.347) (-1016.210) [-1007.633] (-1002.786) * (-1014.697) (-1005.056) [-1008.382] (-1004.468) -- 0:03:31
37000 -- (-1013.593) (-1013.063) [-1003.789] (-1019.634) * (-1012.463) (-1008.220) (-1010.979) [-1003.789] -- 0:03:28
37500 -- (-1009.291) (-1012.004) (-1004.018) [-1011.332] * (-1012.901) (-1009.710) [-1017.168] (-1009.027) -- 0:03:25
38000 -- (-1008.532) (-1007.694) [-1007.603] (-1011.591) * (-1017.439) (-1006.229) [-1006.275] (-1012.892) -- 0:03:22
38500 -- (-1009.334) (-1004.542) (-1008.453) [-1003.841] * (-1012.079) (-1005.978) [-1005.515] (-1007.098) -- 0:03:19
39000 -- (-1007.726) (-1013.359) (-1005.588) [-1009.953] * (-1011.470) (-1009.427) (-1010.602) [-1007.590] -- 0:03:17
39500 -- (-1008.067) [-1010.587] (-1002.802) (-1014.815) * (-1006.381) (-1014.275) (-1003.263) [-1005.942] -- 0:03:14
40000 -- (-1009.553) (-1005.920) [-1003.059] (-1018.390) * (-1012.222) (-1007.140) (-1008.622) [-1003.602] -- 0:03:12
Average standard deviation of split frequencies: 0.019320
40500 -- [-1007.652] (-1002.349) (-1009.572) (-1010.752) * [-1009.272] (-1009.396) (-1014.101) (-1011.157) -- 0:03:09
41000 -- (-1014.067) [-1003.055] (-1005.227) (-1013.343) * (-1011.511) (-1010.777) (-1011.674) [-1007.641] -- 0:03:30
41500 -- [-1006.913] (-1002.395) (-1015.271) (-1007.255) * [-1012.868] (-1009.161) (-1004.273) (-1019.045) -- 0:03:27
42000 -- (-1009.578) (-1004.852) (-1008.023) [-1000.641] * (-1009.342) (-1009.973) (-1007.995) [-1007.342] -- 0:03:25
42500 -- (-1012.682) [-1008.165] (-1004.272) (-1008.363) * [-1009.230] (-1007.784) (-1011.380) (-1007.626) -- 0:03:22
43000 -- (-1005.079) [-1006.171] (-1005.671) (-1006.362) * (-1011.857) (-1004.680) [-1008.310] (-1005.790) -- 0:03:20
43500 -- (-1005.407) (-1004.089) [-1002.531] (-1010.308) * (-1007.014) [-1012.141] (-1006.671) (-1014.460) -- 0:03:17
44000 -- (-1005.148) [-1006.948] (-1005.814) (-1007.056) * (-1013.969) (-1008.908) [-1006.680] (-1007.145) -- 0:03:15
44500 -- (-1002.054) (-1013.066) [-1002.423] (-1014.296) * (-1006.522) (-1019.347) [-1003.469] (-1014.061) -- 0:03:13
45000 -- (-1005.207) (-1007.781) [-1003.736] (-1009.380) * (-1006.149) (-1016.415) [-1008.034] (-1012.299) -- 0:03:11
Average standard deviation of split frequencies: 0.017080
45500 -- (-1009.526) [-1002.245] (-1009.485) (-1004.039) * (-1009.551) (-1007.236) (-1008.452) [-1009.025] -- 0:03:08
46000 -- (-1003.021) (-1003.242) [-1003.673] (-1008.737) * (-1014.708) (-1010.993) (-1010.629) [-1014.619] -- 0:03:27
46500 -- (-1006.863) (-1011.211) (-1005.401) [-1007.927] * (-1013.830) (-1003.849) [-1009.502] (-1020.758) -- 0:03:25
47000 -- (-1011.749) (-1005.333) (-1011.700) [-1002.845] * (-1004.572) (-1009.658) [-1004.924] (-1013.141) -- 0:03:22
47500 -- [-1008.421] (-1007.767) (-1005.232) (-1011.938) * (-1011.355) (-1004.869) [-1005.297] (-1010.069) -- 0:03:20
48000 -- (-1004.448) (-1013.165) [-1005.892] (-1010.752) * (-1002.213) (-1009.698) [-1008.949] (-1012.168) -- 0:03:18
48500 -- (-1006.571) (-1007.111) (-1007.414) [-1011.722] * (-1007.076) (-1013.075) (-1003.587) [-1010.913] -- 0:03:16
49000 -- [-1006.489] (-1006.261) (-1009.203) (-1002.754) * (-1007.424) (-1013.883) [-1002.460] (-1007.033) -- 0:03:14
49500 -- (-1009.279) (-1009.965) (-1015.417) [-1005.404] * (-1006.876) [-1010.656] (-1016.874) (-1007.828) -- 0:03:12
50000 -- (-1005.091) (-1009.386) [-1002.764] (-1012.665) * [-1002.003] (-1007.999) (-1007.809) (-1010.449) -- 0:03:10
Average standard deviation of split frequencies: 0.018608
50500 -- [-1009.433] (-1009.201) (-1005.541) (-1013.176) * (-1003.147) (-1002.306) (-1006.260) [-1006.970] -- 0:03:26
51000 -- (-1007.848) (-1005.815) (-1006.787) [-1004.169] * (-1005.628) (-1009.959) [-1006.480] (-1006.650) -- 0:03:24
51500 -- (-1012.876) (-1016.908) [-1007.378] (-1007.492) * (-1005.569) (-1005.711) [-1010.053] (-1006.613) -- 0:03:22
52000 -- (-1007.797) (-1007.745) (-1006.251) [-1010.991] * (-1006.601) (-1004.514) [-1004.778] (-1003.091) -- 0:03:20
52500 -- (-1019.288) (-1012.489) (-1007.982) [-1005.597] * (-1010.042) (-1000.733) [-1012.606] (-1005.847) -- 0:03:18
53000 -- (-1019.508) [-1007.170] (-1011.750) (-1010.836) * (-1011.685) (-1009.213) [-1005.378] (-1004.491) -- 0:03:16
53500 -- (-1004.358) (-1000.930) (-1007.378) [-1002.993] * (-1010.814) (-1008.926) [-1004.935] (-1012.213) -- 0:03:14
54000 -- [-1006.362] (-1005.421) (-1005.064) (-1005.908) * [-1009.334] (-1009.962) (-1004.959) (-1009.716) -- 0:03:12
54500 -- [-1009.230] (-1004.561) (-1000.978) (-1005.798) * (-1006.688) (-1012.673) (-1005.970) [-1006.589] -- 0:03:10
55000 -- (-1007.832) (-1003.663) [-1005.629] (-1005.668) * (-1009.557) (-1011.617) (-1004.095) [-1008.771] -- 0:03:09
Average standard deviation of split frequencies: 0.027358
55500 -- [-1001.491] (-1012.166) (-1003.979) (-1005.719) * (-1012.771) (-1006.460) [-1008.982] (-1006.506) -- 0:03:24
56000 -- (-1007.512) (-1011.547) (-1007.127) [-1007.803] * (-1007.898) [-1009.116] (-1009.772) (-1019.485) -- 0:03:22
56500 -- (-1010.380) (-1008.041) (-1007.308) [-1013.588] * (-1006.144) (-1006.113) [-1012.062] (-1007.353) -- 0:03:20
57000 -- (-1019.040) (-1015.556) (-1002.027) [-1006.201] * [-1008.794] (-1009.306) (-1008.962) (-1009.212) -- 0:03:18
57500 -- (-1013.903) (-1003.857) (-1005.633) [-1009.031] * (-1014.236) (-1006.031) (-1015.632) [-1009.187] -- 0:03:16
58000 -- (-1012.402) [-1008.100] (-1008.659) (-1013.706) * (-1005.458) (-1010.777) (-1007.727) [-1006.207] -- 0:03:14
58500 -- (-1012.143) [-1002.224] (-1008.434) (-1013.949) * (-1005.215) [-1003.091] (-1011.059) (-1001.405) -- 0:03:13
59000 -- (-1014.065) [-1007.118] (-1020.839) (-1007.399) * [-1006.136] (-1004.990) (-1009.967) (-1001.089) -- 0:03:11
59500 -- (-1015.435) [-1002.913] (-1007.870) (-1007.762) * (-1009.168) (-1006.786) (-1003.202) [-1000.943] -- 0:03:09
60000 -- (-1004.245) [-1008.116] (-1009.916) (-1013.715) * (-1015.501) (-1010.313) [-1005.472] (-1007.807) -- 0:03:23
Average standard deviation of split frequencies: 0.023311
60500 -- [-1003.459] (-1002.005) (-1005.102) (-1007.381) * (-1010.631) (-1004.749) (-1013.082) [-1007.488] -- 0:03:21
61000 -- [-1011.648] (-1006.219) (-1010.629) (-1006.336) * (-1010.740) (-1006.343) (-1007.667) [-1005.381] -- 0:03:20
61500 -- (-1009.895) (-1006.179) (-1011.673) [-1005.518] * (-1009.384) (-1010.236) [-1006.031] (-1006.119) -- 0:03:18
62000 -- (-1004.387) (-1009.099) [-1000.637] (-1005.785) * (-1006.450) (-1007.608) (-1001.176) [-1003.594] -- 0:03:16
62500 -- (-1011.462) (-1003.825) [-1010.361] (-1004.948) * (-1016.071) (-1011.662) [-1007.583] (-1008.605) -- 0:03:15
63000 -- (-1009.294) (-1009.066) (-1003.919) [-1007.442] * [-1006.181] (-1009.117) (-1002.009) (-1001.405) -- 0:03:13
63500 -- (-1009.270) (-1009.039) [-1004.171] (-1009.353) * (-1006.371) [-1019.358] (-1005.312) (-1006.353) -- 0:03:11
64000 -- (-1016.517) (-1006.552) (-1007.361) [-1006.515] * [-1007.746] (-1017.391) (-1006.444) (-1006.127) -- 0:03:24
64500 -- (-1017.397) (-1010.452) (-1008.706) [-1002.751] * [-1010.546] (-1014.929) (-1009.076) (-1009.553) -- 0:03:23
65000 -- [-1009.809] (-1002.494) (-1010.377) (-1008.884) * (-1004.838) [-1001.431] (-1005.628) (-1007.249) -- 0:03:21
Average standard deviation of split frequencies: 0.021427
65500 -- (-1006.665) [-1010.057] (-1005.535) (-1008.599) * (-1014.705) (-1006.901) (-1002.423) [-1005.315] -- 0:03:19
66000 -- [-1008.879] (-1001.726) (-1014.289) (-1010.215) * [-1005.882] (-1010.058) (-1003.654) (-1012.877) -- 0:03:18
66500 -- [-1014.154] (-1007.523) (-1006.754) (-1018.665) * (-1005.092) (-1006.503) [-1000.617] (-1009.709) -- 0:03:16
67000 -- (-1010.585) [-1005.612] (-1007.137) (-1010.164) * (-1008.169) (-1012.787) (-1005.056) [-1001.861] -- 0:03:14
67500 -- (-1010.908) [-1006.388] (-1007.917) (-1016.657) * [-1010.703] (-1005.110) (-1008.699) (-1006.094) -- 0:03:13
68000 -- [-1002.149] (-1011.717) (-1013.132) (-1008.748) * [-1004.187] (-1015.873) (-1011.821) (-1011.727) -- 0:03:25
68500 -- (-1007.150) (-1012.029) (-1008.535) [-1006.218] * (-1007.210) [-1005.595] (-1016.503) (-1011.040) -- 0:03:23
69000 -- [-1009.212] (-1017.743) (-1008.596) (-1005.798) * [-1007.050] (-1004.667) (-1010.061) (-1006.143) -- 0:03:22
69500 -- (-1010.317) [-1005.988] (-1013.485) (-1010.353) * (-1004.027) [-1006.323] (-1005.587) (-1010.331) -- 0:03:20
70000 -- (-1005.568) [-1009.951] (-1008.226) (-1004.166) * [-1002.670] (-1005.226) (-1009.723) (-1003.540) -- 0:03:19
Average standard deviation of split frequencies: 0.028351
70500 -- (-1016.085) (-1013.664) [-1005.087] (-1007.965) * [-1009.537] (-1003.150) (-1007.440) (-1006.037) -- 0:03:17
71000 -- (-1008.936) (-1008.239) (-1005.166) [-1006.980] * (-1004.508) (-1005.809) [-1000.938] (-1009.446) -- 0:03:16
71500 -- [-1007.583] (-1011.227) (-1005.277) (-1009.200) * (-1009.893) [-1003.369] (-1008.355) (-1009.595) -- 0:03:14
72000 -- (-1009.074) [-1007.523] (-1005.893) (-1009.776) * (-1010.312) (-1013.580) [-1001.895] (-1005.531) -- 0:03:26
72500 -- [-1000.107] (-1014.590) (-1009.297) (-1010.307) * (-1009.605) [-1010.231] (-1004.848) (-1006.010) -- 0:03:24
73000 -- (-1010.059) (-1025.381) (-1011.571) [-1007.540] * (-1005.700) [-1008.544] (-1005.573) (-1010.000) -- 0:03:23
73500 -- (-1003.624) (-1014.073) (-1000.780) [-1003.666] * (-1003.848) (-1006.747) (-1010.690) [-1001.924] -- 0:03:21
74000 -- (-1014.157) (-1008.904) (-1009.143) [-1005.815] * [-1007.459] (-1013.480) (-1005.325) (-1008.809) -- 0:03:20
74500 -- (-1014.320) [-1009.355] (-1007.651) (-1007.619) * [-1006.447] (-1010.313) (-1008.857) (-1008.013) -- 0:03:18
75000 -- (-1012.643) (-1015.655) [-1009.167] (-1004.894) * (-1006.939) (-1004.652) [-1001.648] (-1004.764) -- 0:03:17
Average standard deviation of split frequencies: 0.029463
75500 -- (-1013.352) [-1008.599] (-1001.614) (-1005.714) * (-1007.245) (-1013.594) [-1004.647] (-1000.525) -- 0:03:15
76000 -- (-1008.332) [-1006.686] (-1008.869) (-1004.765) * [-1004.552] (-1016.690) (-1009.789) (-1010.941) -- 0:03:14
76500 -- [-1003.088] (-1006.522) (-1007.062) (-1012.444) * (-1003.370) (-1004.708) [-1007.492] (-1015.742) -- 0:03:25
77000 -- [-1001.943] (-1008.006) (-1007.339) (-1002.729) * (-1006.791) [-1008.522] (-1007.645) (-1009.461) -- 0:03:23
77500 -- [-1004.112] (-1015.196) (-1007.855) (-1014.263) * (-1007.510) (-1008.513) [-1010.786] (-1003.993) -- 0:03:22
78000 -- (-1004.854) [-1007.193] (-1017.321) (-1010.745) * (-1017.910) (-1008.532) (-1009.476) [-1006.196] -- 0:03:20
78500 -- (-1006.656) [-1006.983] (-1008.403) (-1002.539) * (-1011.510) (-1005.506) [-1005.319] (-1006.575) -- 0:03:19
79000 -- (-1007.663) (-1009.926) (-1013.247) [-1009.350] * [-1012.030] (-1007.849) (-1009.341) (-1008.344) -- 0:03:18
79500 -- (-1003.676) (-1006.201) (-1008.946) [-1007.972] * [-1003.930] (-1009.200) (-1002.961) (-1005.446) -- 0:03:16
80000 -- (-1014.394) (-1006.251) [-1009.828] (-1004.587) * (-1008.786) (-1005.822) [-1002.839] (-1008.338) -- 0:03:15
Average standard deviation of split frequencies: 0.030680
80500 -- [-1006.125] (-1011.614) (-1004.776) (-1011.579) * [-1001.595] (-1002.514) (-1008.718) (-1013.328) -- 0:03:25
81000 -- (-1009.633) [-1006.657] (-1008.121) (-1007.347) * (-1007.662) (-1012.891) (-1011.731) [-1005.106] -- 0:03:24
81500 -- (-1007.516) (-1005.823) (-1007.762) [-1006.097] * (-1008.252) (-1010.779) [-1007.896] (-1011.911) -- 0:03:22
82000 -- (-1008.319) [-1004.493] (-1009.298) (-1004.587) * [-1004.693] (-1016.013) (-1007.602) (-1008.187) -- 0:03:21
82500 -- [-1015.497] (-1007.426) (-1004.132) (-1010.375) * (-1006.857) (-1017.595) (-1012.912) [-1002.791] -- 0:03:20
83000 -- [-1013.187] (-1008.167) (-1006.386) (-1011.764) * (-1009.052) (-1012.171) (-1016.613) [-1003.982] -- 0:03:18
83500 -- [-1004.588] (-1003.383) (-1009.323) (-1009.549) * [-1011.140] (-1006.358) (-1010.232) (-1006.597) -- 0:03:17
84000 -- (-1009.495) (-1002.463) (-1010.121) [-1007.159] * [-1008.986] (-1010.449) (-1009.002) (-1016.229) -- 0:03:16
84500 -- (-1013.713) (-1003.021) [-1011.050] (-1006.214) * [-1002.662] (-1007.226) (-1011.423) (-1007.529) -- 0:03:15
85000 -- (-1013.635) (-1009.135) [-1007.272] (-1010.179) * [-1008.964] (-1015.440) (-1009.691) (-1011.179) -- 0:03:24
Average standard deviation of split frequencies: 0.026037
85500 -- (-1008.577) [-1002.510] (-1015.365) (-1010.968) * [-1003.394] (-1011.019) (-1009.628) (-1013.464) -- 0:03:23
86000 -- (-1006.441) (-1010.332) [-1008.395] (-1017.459) * (-1009.680) (-1013.263) [-1009.409] (-1003.876) -- 0:03:21
86500 -- [-1010.677] (-1007.149) (-1017.528) (-1007.265) * (-1011.752) [-1005.285] (-1007.225) (-1007.589) -- 0:03:20
87000 -- (-1008.277) (-1005.016) (-1004.057) [-1007.572] * [-1007.973] (-1012.158) (-1010.736) (-1015.653) -- 0:03:19
87500 -- [-1002.699] (-1005.329) (-1000.965) (-1017.378) * (-1015.028) [-1009.274] (-1009.469) (-1010.950) -- 0:03:18
88000 -- (-1004.122) (-1004.867) [-1009.840] (-1013.291) * (-1004.817) (-1008.808) (-1006.138) [-1014.421] -- 0:03:16
88500 -- (-1010.041) [-1003.463] (-1007.280) (-1006.081) * (-1004.024) [-1009.084] (-1005.104) (-1003.737) -- 0:03:15
89000 -- (-1010.213) (-1004.079) [-1003.415] (-1007.783) * [-1005.175] (-1005.369) (-1006.560) (-1005.827) -- 0:03:14
89500 -- (-1008.099) [-1005.155] (-1008.443) (-1009.336) * [-1002.882] (-1020.136) (-1004.696) (-1005.130) -- 0:03:13
90000 -- (-1005.076) (-999.997) [-1004.240] (-1005.300) * [-1004.036] (-1012.012) (-1005.546) (-1009.459) -- 0:03:22
Average standard deviation of split frequencies: 0.027296
90500 -- (-1009.978) (-1001.732) [-1007.145] (-1004.420) * (-1010.708) (-1004.118) [-1002.255] (-1016.725) -- 0:03:20
91000 -- (-1017.295) [-1007.376] (-1009.934) (-1009.589) * (-1011.219) (-1006.950) [-1007.183] (-1008.329) -- 0:03:19
91500 -- [-1004.369] (-1002.450) (-1012.319) (-1013.038) * (-1004.699) [-1004.202] (-1009.023) (-1006.378) -- 0:03:18
92000 -- [-1006.811] (-1005.849) (-1007.813) (-1005.792) * (-1005.428) [-1009.306] (-1006.657) (-1008.397) -- 0:03:17
92500 -- [-1004.673] (-1012.992) (-1012.056) (-1004.482) * (-1009.834) [-1006.121] (-1013.009) (-1016.248) -- 0:03:16
93000 -- (-1005.071) (-1009.086) (-1006.522) [-1003.806] * (-1005.045) (-1008.662) (-1010.676) [-1004.112] -- 0:03:15
93500 -- (-1000.897) (-1006.245) [-1008.158] (-1001.954) * (-1010.456) [-1004.159] (-1011.062) (-1001.899) -- 0:03:13
94000 -- (-1006.015) [-1003.402] (-1002.993) (-1007.369) * [-1006.760] (-1006.560) (-1009.844) (-1009.540) -- 0:03:12
94500 -- [-1004.152] (-1008.506) (-1007.159) (-1021.023) * (-1014.597) (-1011.116) [-1011.038] (-1014.287) -- 0:03:21
95000 -- (-1008.695) [-1012.356] (-1011.432) (-1013.212) * [-1012.085] (-1006.690) (-1010.761) (-1008.611) -- 0:03:20
Average standard deviation of split frequencies: 0.025780
95500 -- (-1010.904) (-1007.669) [-1007.494] (-1012.744) * (-1012.911) [-1002.538] (-1002.646) (-1004.109) -- 0:03:18
96000 -- (-1009.729) [-1006.521] (-1012.917) (-1009.251) * (-1009.504) [-1003.535] (-1000.543) (-1006.617) -- 0:03:17
96500 -- [-1006.305] (-1006.282) (-1020.599) (-1007.409) * [-1014.797] (-1004.971) (-1014.592) (-1014.937) -- 0:03:16
97000 -- (-1007.232) (-1012.080) [-1005.768] (-1002.358) * (-1010.078) [-1004.274] (-1004.962) (-1009.006) -- 0:03:15
97500 -- (-1005.780) (-1010.207) (-1009.453) [-1014.821] * (-1002.802) (-1006.484) (-1010.973) [-1007.318] -- 0:03:14
98000 -- [-1004.919] (-1008.610) (-1001.335) (-1014.972) * [-1004.853] (-1004.061) (-1008.775) (-1008.299) -- 0:03:13
98500 -- (-1009.768) (-1005.117) (-1006.795) [-1000.870] * (-1008.162) (-1009.405) (-1008.166) [-1010.579] -- 0:03:21
99000 -- (-1010.637) (-1001.563) (-1005.953) [-1008.988] * [-1014.164] (-1009.655) (-1006.272) (-1009.733) -- 0:03:20
99500 -- (-1005.030) (-1004.429) (-1011.922) [-1008.245] * [-1004.334] (-1010.348) (-1006.549) (-1006.316) -- 0:03:19
100000 -- [-1008.213] (-1006.847) (-1017.233) (-1004.206) * (-1008.168) (-1005.273) [-1003.524] (-1011.044) -- 0:03:18
Average standard deviation of split frequencies: 0.015609
100500 -- [-1007.720] (-1006.373) (-1024.128) (-1011.502) * (-1019.442) [-1003.191] (-1008.518) (-1003.413) -- 0:03:16
101000 -- [-1002.956] (-1012.635) (-1015.732) (-1011.653) * (-1006.459) (-1011.449) (-1007.930) [-1004.470] -- 0:03:15
101500 -- [-1008.620] (-1007.955) (-1028.129) (-1008.448) * (-1010.486) (-1004.604) (-1008.231) [-1004.755] -- 0:03:14
102000 -- [-1004.590] (-1011.609) (-1014.059) (-1006.600) * (-1012.957) (-1011.202) (-1015.836) [-1007.791] -- 0:03:13
102500 -- (-1009.092) (-1009.284) [-1013.127] (-1008.533) * (-1011.911) (-1005.652) (-1016.235) [-1008.968] -- 0:03:12
103000 -- (-1009.031) [-1008.852] (-1012.838) (-1010.209) * [-1015.536] (-1008.550) (-1008.696) (-1011.905) -- 0:03:20
103500 -- (-1009.306) [-1002.051] (-1014.511) (-1004.159) * (-1011.800) (-1006.629) (-1012.859) [-1006.659] -- 0:03:19
104000 -- (-1015.953) [-1001.306] (-1015.053) (-1010.587) * (-1011.369) [-1003.469] (-1017.740) (-1002.823) -- 0:03:18
104500 -- (-1001.970) (-1006.571) [-1008.958] (-1001.763) * (-1006.322) (-1013.286) (-1012.015) [-1008.250] -- 0:03:17
105000 -- (-1012.451) (-1008.164) (-1012.809) [-1005.600] * (-1002.212) [-1012.166] (-1010.295) (-1000.956) -- 0:03:16
Average standard deviation of split frequencies: 0.011859
105500 -- (-1009.413) (-1005.418) (-1007.205) [-1011.295] * (-1009.418) (-1004.462) (-1013.207) [-1006.018] -- 0:03:15
106000 -- (-1003.946) (-1010.319) (-1006.572) [-1005.686] * (-1006.822) (-1006.909) (-1010.712) [-1003.779] -- 0:03:13
106500 -- (-1018.446) (-1008.752) [-1020.301] (-1008.522) * (-1011.343) (-1015.986) (-1013.237) [-1009.025] -- 0:03:12
107000 -- (-1014.011) (-1005.395) (-1012.487) [-1006.867] * (-1016.730) [-1005.192] (-1005.833) (-1010.133) -- 0:03:11
107500 -- (-1015.946) [-1008.164] (-1009.460) (-1010.190) * (-1015.411) (-1003.483) [-1008.502] (-1010.129) -- 0:03:19
108000 -- (-1018.602) (-1010.530) (-1005.896) [-1004.949] * (-1002.799) (-1006.984) (-1011.049) [-1009.650] -- 0:03:18
108500 -- (-1008.358) (-1005.466) (-1004.493) [-1007.721] * [-1002.076] (-1010.174) (-1008.353) (-1009.883) -- 0:03:17
109000 -- [-1009.598] (-1010.417) (-1014.891) (-1008.981) * (-1006.778) (-1003.536) [-1009.771] (-1013.937) -- 0:03:16
109500 -- (-1003.398) [-1008.260] (-1009.901) (-1013.133) * (-1001.923) [-1007.481] (-1014.207) (-1010.264) -- 0:03:15
110000 -- [-1005.189] (-1015.598) (-1008.063) (-1013.627) * (-1008.887) [-1007.810] (-1012.757) (-1006.677) -- 0:03:14
Average standard deviation of split frequencies: 0.002840
110500 -- (-1014.313) [-1002.431] (-1005.092) (-1013.032) * (-1019.794) [-1007.789] (-1009.600) (-1005.120) -- 0:03:13
111000 -- (-1008.481) (-1009.180) [-1005.898] (-1008.880) * [-1005.480] (-1004.004) (-1005.954) (-1007.315) -- 0:03:12
111500 -- (-1012.373) (-1012.128) [-1003.573] (-1011.691) * (-1009.694) (-1006.834) [-1005.411] (-1003.448) -- 0:03:11
112000 -- (-1008.637) (-1011.364) (-1012.352) [-1006.697] * [-1007.266] (-1011.830) (-1005.131) (-1009.436) -- 0:03:10
112500 -- (-1005.223) (-1002.841) (-1015.193) [-1009.002] * (-1017.125) [-1015.117] (-1007.224) (-1008.696) -- 0:03:17
113000 -- (-1009.636) [-1003.494] (-1007.844) (-1011.126) * (-1006.590) [-1014.227] (-1003.382) (-1012.874) -- 0:03:16
113500 -- [-1006.791] (-1009.055) (-1007.800) (-1007.481) * (-1009.843) (-1017.290) [-1004.433] (-1007.937) -- 0:03:15
114000 -- [-1003.163] (-1007.138) (-1009.068) (-1016.218) * (-1014.828) (-1005.607) [-1008.260] (-1008.283) -- 0:03:14
114500 -- [-1007.394] (-1010.088) (-1010.808) (-1008.186) * (-1009.888) (-1007.850) [-1011.036] (-1003.497) -- 0:03:13
115000 -- [-1013.089] (-1007.456) (-1008.801) (-1006.002) * (-1009.561) [-1001.859] (-1006.862) (-1008.834) -- 0:03:12
Average standard deviation of split frequencies: 0.004064
115500 -- (-1007.613) (-1010.941) [-1009.995] (-1004.552) * (-1006.746) (-1007.222) (-1011.825) [-1004.625] -- 0:03:11
116000 -- (-1006.818) (-1007.972) (-1009.949) [-1004.836] * (-1010.893) [-1012.096] (-1012.431) (-1007.507) -- 0:03:10
116500 -- [-1004.623] (-1003.140) (-1006.858) (-1014.411) * (-1010.369) (-1008.649) (-1007.389) [-1013.144] -- 0:03:09
117000 -- [-1005.396] (-1003.440) (-1014.069) (-1009.456) * [-1009.621] (-1010.477) (-1005.349) (-1011.501) -- 0:03:08
117500 -- [-1008.736] (-1004.452) (-1008.667) (-1011.979) * (-1010.140) [-1006.354] (-1010.117) (-1010.500) -- 0:03:15
118000 -- (-1011.402) (-1012.923) [-1006.381] (-1010.297) * (-1009.216) (-1008.291) (-1006.020) [-1006.854] -- 0:03:14
118500 -- (-1011.382) [-1010.153] (-1012.790) (-1008.743) * [-1009.044] (-1005.797) (-1001.974) (-1006.463) -- 0:03:13
119000 -- [-1005.654] (-1016.943) (-1007.855) (-1017.232) * (-1005.760) [-1006.631] (-1007.656) (-1015.924) -- 0:03:12
119500 -- [-1003.423] (-1016.133) (-1014.815) (-1014.837) * (-1009.389) (-1006.993) [-1003.149] (-1013.317) -- 0:03:11
120000 -- (-1006.579) [-1009.436] (-1012.990) (-1006.258) * (-1003.618) (-1010.847) (-1010.942) [-1010.331] -- 0:03:10
Average standard deviation of split frequencies: 0.003907
120500 -- [-1002.698] (-1008.606) (-1007.417) (-1014.774) * [-1012.432] (-1013.431) (-1008.196) (-1010.547) -- 0:03:09
121000 -- (-1004.028) (-1002.195) [-1004.622] (-1014.330) * [-1005.305] (-1013.396) (-1003.164) (-1012.980) -- 0:03:08
121500 -- (-1001.307) [-1004.902] (-1003.365) (-1008.652) * (-1017.052) (-1003.059) (-1010.005) [-1002.317] -- 0:03:07
122000 -- (-1010.385) (-1008.889) [-1002.677] (-1007.779) * [-1004.250] (-1008.179) (-1004.917) (-1005.231) -- 0:03:14
122500 -- (-1001.258) (-1005.798) [-1004.060] (-1006.397) * (-1005.669) (-1006.346) [-1002.339] (-1006.235) -- 0:03:13
123000 -- (-1004.934) (-1009.201) [-1006.559] (-1014.895) * [-1013.226] (-1009.579) (-1005.732) (-1008.899) -- 0:03:12
123500 -- (-1006.715) (-1007.546) [-1010.688] (-1013.545) * (-1007.646) (-1008.219) (-1006.977) [-1006.277] -- 0:03:11
124000 -- (-1006.078) (-1005.829) [-1009.372] (-1007.780) * (-1008.492) (-1010.548) (-1007.450) [-1005.850] -- 0:03:10
124500 -- (-1009.366) [-1005.620] (-1011.478) (-1002.475) * (-1018.511) [-1009.039] (-1011.473) (-1002.671) -- 0:03:09
125000 -- (-1014.123) (-1005.529) (-1008.371) [-1005.065] * (-1019.274) [-1013.741] (-1009.690) (-1004.551) -- 0:03:09
Average standard deviation of split frequencies: 0.004988
125500 -- (-1010.882) (-1009.175) [-1012.045] (-1002.939) * [-1008.004] (-1004.284) (-1004.307) (-1006.869) -- 0:03:08
126000 -- [-1004.836] (-1009.701) (-1007.560) (-1013.595) * (-1013.668) (-1005.060) (-1012.351) [-1003.440] -- 0:03:07
126500 -- (-1004.256) (-1010.430) (-1013.475) [-1004.464] * (-1008.724) (-1005.894) (-1010.952) [-1006.129] -- 0:03:06
127000 -- (-1009.322) [-1010.249] (-1007.647) (-1006.424) * (-1013.168) (-1008.238) (-1021.188) [-1001.948] -- 0:03:12
127500 -- [-1006.063] (-1003.687) (-1006.643) (-1015.937) * (-1011.028) (-1005.391) (-1012.625) [-1002.088] -- 0:03:11
128000 -- [-1005.733] (-1003.665) (-1007.708) (-1015.277) * (-1008.206) [-1008.907] (-1012.498) (-998.910) -- 0:03:10
128500 -- (-1012.001) (-1003.557) (-1015.063) [-1012.996] * (-1005.495) (-1017.053) (-1014.822) [-1007.356] -- 0:03:09
129000 -- (-1013.567) (-1002.823) (-1015.053) [-1014.769] * (-1010.845) (-1020.863) [-1001.374] (-1011.933) -- 0:03:09
129500 -- (-1012.381) (-1008.187) (-1009.758) [-1009.791] * [-1012.585] (-1012.559) (-1008.139) (-1008.966) -- 0:03:08
130000 -- (-1007.296) [-1008.321] (-1012.299) (-1010.445) * (-1013.413) [-1007.008] (-1009.078) (-1006.397) -- 0:03:07
Average standard deviation of split frequencies: 0.007215
130500 -- (-1015.473) (-1004.413) (-1008.877) [-1006.998] * [-1014.283] (-1007.491) (-1006.097) (-1009.253) -- 0:03:06
131000 -- (-1005.869) [-1011.782] (-1005.051) (-1005.916) * [-1007.437] (-1005.650) (-1005.878) (-1013.007) -- 0:03:05
131500 -- (-1004.290) (-1001.587) (-1015.088) [-1008.117] * [-1007.817] (-1005.811) (-1008.039) (-1012.270) -- 0:03:04
132000 -- (-1015.995) [-1004.801] (-1011.731) (-1010.915) * [-1002.894] (-1003.048) (-1012.344) (-1012.018) -- 0:03:10
132500 -- (-1010.176) [-1003.324] (-1017.663) (-1005.286) * (-1006.239) [-1009.172] (-1011.111) (-1009.917) -- 0:03:09
133000 -- (-1008.917) (-1010.236) (-1008.236) [-1009.981] * (-1006.675) [-1008.553] (-1006.556) (-1014.146) -- 0:03:09
133500 -- (-1010.336) [-1006.710] (-1016.604) (-1003.730) * [-1005.685] (-1006.720) (-1010.773) (-1012.702) -- 0:03:08
134000 -- (-1011.220) (-1012.207) (-1005.429) [-1004.390] * [-1009.321] (-1008.915) (-1013.449) (-1012.722) -- 0:03:07
134500 -- (-1013.688) (-1008.310) [-1007.424] (-1002.271) * (-1008.679) (-1003.941) (-1008.329) [-1017.126] -- 0:03:06
135000 -- (-1009.009) (-1006.827) [-1005.437] (-1006.317) * (-1006.079) (-1005.740) (-1004.461) [-1011.031] -- 0:03:05
Average standard deviation of split frequencies: 0.004622
135500 -- (-1008.242) (-1006.209) [-1007.532] (-1008.415) * [-1002.283] (-1009.767) (-1007.674) (-1007.265) -- 0:03:05
136000 -- (-1012.185) (-1014.191) [-1007.866] (-1006.829) * (-1008.921) (-1006.278) (-1007.969) [-1012.861] -- 0:03:04
136500 -- (-1006.548) [-1002.271] (-1009.197) (-1008.701) * (-1008.336) (-1006.648) [-1007.411] (-1011.380) -- 0:03:03
137000 -- (-1008.632) [-1003.599] (-1004.563) (-1011.425) * (-1008.285) (-1001.269) [-1003.956] (-1006.586) -- 0:03:08
137500 -- (-1010.655) (-1009.359) (-1012.091) [-1001.932] * (-1010.990) [-1007.071] (-1008.508) (-1015.629) -- 0:03:08
138000 -- (-1009.503) [-1003.051] (-1010.514) (-1014.630) * [-1004.951] (-1017.459) (-1018.011) (-1006.710) -- 0:03:07
138500 -- (-1005.293) (-1010.649) (-1008.423) [-1003.623] * (-1010.970) (-1006.716) [-1010.444] (-1017.054) -- 0:03:06
139000 -- (-1006.221) (-1010.855) (-1012.515) [-1006.660] * (-1003.553) [-1003.778] (-1010.624) (-1012.011) -- 0:03:05
139500 -- [-1005.781] (-1013.687) (-1008.889) (-1004.505) * (-1016.944) (-1004.321) [-1010.477] (-1004.277) -- 0:03:05
140000 -- (-1004.221) (-1002.175) [-1003.346] (-1010.579) * (-1021.229) (-1002.980) [-1005.774] (-1006.764) -- 0:03:04
Average standard deviation of split frequencies: 0.005585
140500 -- (-1011.053) (-1003.791) [-1006.623] (-1006.633) * (-1010.752) [-1005.090] (-1005.477) (-1004.063) -- 0:03:03
141000 -- (-1007.694) (-1005.577) [-1004.916] (-1004.596) * (-1006.123) [-1006.011] (-1010.795) (-1011.266) -- 0:03:02
141500 -- (-1007.626) (-1010.499) (-1008.886) [-1003.197] * (-1018.839) [-1005.160] (-1012.637) (-1013.032) -- 0:03:02
142000 -- (-1007.793) (-1011.409) [-1007.906] (-1004.422) * (-1009.559) (-1022.574) [-1012.404] (-1010.188) -- 0:03:07
142500 -- (-1008.629) (-1004.025) (-1013.768) [-1006.192] * (-1005.175) [-1013.019] (-1012.315) (-1006.219) -- 0:03:06
143000 -- (-1015.947) (-1005.530) (-1009.096) [-1007.797] * (-1010.603) [-1002.718] (-1007.344) (-1010.946) -- 0:03:05
143500 -- (-1003.600) [-1005.985] (-1006.227) (-1011.031) * [-1003.982] (-1007.172) (-1013.571) (-1007.713) -- 0:03:05
144000 -- (-1017.640) (-1007.784) [-1002.878] (-1005.320) * (-1011.412) [-1007.411] (-1007.715) (-1008.066) -- 0:03:04
144500 -- (-1013.577) (-1004.579) [-1002.448] (-1004.787) * [-1008.013] (-1004.968) (-1013.632) (-1004.624) -- 0:03:03
145000 -- (-1005.351) (-1009.763) (-1000.736) [-1002.735] * (-1008.815) (-1010.952) [-1003.859] (-1008.634) -- 0:03:02
Average standard deviation of split frequencies: 0.003229
145500 -- (-1004.437) (-1010.573) [-1011.927] (-1006.208) * (-1011.511) (-1003.809) (-1006.727) [-1004.153] -- 0:03:02
146000 -- (-1015.037) [-1004.358] (-1014.474) (-1014.388) * (-1009.389) [-1005.031] (-1009.542) (-1007.714) -- 0:03:01
146500 -- (-1012.914) [-1004.750] (-1008.561) (-1012.614) * [-1005.474] (-1008.043) (-1014.858) (-1006.679) -- 0:03:00
147000 -- (-1006.682) (-1005.720) (-1011.631) [-1015.068] * [-1007.529] (-1010.676) (-1008.996) (-1012.305) -- 0:03:05
147500 -- (-1019.257) [-1008.909] (-1009.780) (-1010.013) * (-1010.091) [-1003.668] (-1009.192) (-1015.467) -- 0:03:04
148000 -- (-1004.937) (-1007.399) (-1002.427) [-1004.535] * [-1010.049] (-1003.417) (-1010.656) (-1009.971) -- 0:03:04
148500 -- (-1003.965) [-1003.931] (-1009.177) (-1007.926) * [-1002.712] (-1003.615) (-1003.066) (-1005.380) -- 0:03:03
149000 -- (-1006.635) (-1005.045) (-1008.428) [-1006.666] * (-1001.493) [-1003.928] (-1002.770) (-1011.232) -- 0:03:02
149500 -- (-1002.966) (-1004.654) (-1003.665) [-1013.269] * [-1001.639] (-1009.900) (-1010.675) (-1007.975) -- 0:03:02
150000 -- [-1004.072] (-1004.907) (-1012.650) (-1006.790) * (-1006.461) [-1004.319] (-1008.960) (-1013.206) -- 0:03:01
Average standard deviation of split frequencies: 0.004172
150500 -- (-1010.926) [-1000.763] (-1009.055) (-1011.064) * (-1005.375) [-1005.479] (-1004.501) (-1011.928) -- 0:03:00
151000 -- (-1012.519) (-1007.127) [-1001.281] (-1008.670) * (-1013.133) [-1008.188] (-1006.944) (-1012.602) -- 0:02:59
151500 -- [-1008.243] (-1010.931) (-1004.569) (-1006.706) * (-1004.883) (-1011.443) [-1005.089] (-1009.165) -- 0:02:59
152000 -- (-1017.447) [-1015.910] (-1004.723) (-1007.540) * (-1013.016) (-1014.691) [-1010.007] (-1005.441) -- 0:03:04
152500 -- (-1020.781) [-1002.846] (-1005.526) (-1003.207) * (-1011.743) [-1009.969] (-1005.892) (-1015.174) -- 0:03:03
153000 -- (-1007.908) (-1002.830) [-1003.839] (-1002.204) * (-1014.257) (-1003.063) (-1010.072) [-1008.021] -- 0:03:02
153500 -- (-1008.334) (-1006.592) (-1007.083) [-1004.144] * (-1004.675) [-1003.626] (-1015.141) (-1007.339) -- 0:03:01
154000 -- (-1013.063) (-1006.727) [-1003.164] (-1006.228) * [-1007.416] (-1007.023) (-1010.465) (-1012.272) -- 0:03:01
154500 -- (-1007.237) [-1002.280] (-1004.449) (-1004.350) * [-1006.737] (-1002.585) (-1018.901) (-1013.627) -- 0:03:00
155000 -- (-1009.146) (-1011.579) [-1007.575] (-1005.587) * (-1006.900) (-1008.088) [-1009.623] (-1013.520) -- 0:02:59
Average standard deviation of split frequencies: 0.004029
155500 -- [-1007.299] (-1012.561) (-1006.360) (-1009.349) * (-1007.941) [-1012.292] (-1010.651) (-1010.366) -- 0:02:59
156000 -- (-1005.681) [-1009.083] (-1002.122) (-1008.863) * [-1003.633] (-1008.742) (-1006.761) (-1007.538) -- 0:02:58
156500 -- (-1006.761) (-1008.496) [-1006.733] (-1008.039) * (-1006.188) (-1014.791) [-1008.127] (-1004.645) -- 0:02:57
157000 -- (-1005.711) [-1004.184] (-1005.720) (-1007.762) * [-1011.865] (-1009.592) (-1013.315) (-1009.899) -- 0:03:02
157500 -- (-1003.687) (-1001.505) (-1005.093) [-1003.238] * (-1008.396) [-1005.974] (-1012.769) (-1005.202) -- 0:03:01
158000 -- [-1007.133] (-1007.881) (-1008.884) (-1006.318) * (-1011.151) (-1007.626) [-1004.622] (-1011.154) -- 0:03:01
158500 -- [-1007.811] (-1010.777) (-1008.768) (-1005.269) * (-1010.675) (-1013.345) [-1013.844] (-1003.590) -- 0:03:00
159000 -- [-1005.745] (-1009.114) (-1017.093) (-1003.761) * [-1010.244] (-1011.925) (-1005.887) (-1010.792) -- 0:02:59
159500 -- [-1005.222] (-1009.555) (-1017.673) (-1004.805) * [-1007.151] (-1010.491) (-1007.070) (-1003.545) -- 0:02:59
160000 -- (-1015.913) [-1008.616] (-1009.878) (-1010.034) * (-1005.984) [-1007.843] (-1008.403) (-1008.196) -- 0:02:58
Average standard deviation of split frequencies: 0.005868
160500 -- (-1010.212) (-1008.954) (-1012.353) [-1002.799] * (-1002.109) (-1009.051) (-1009.185) [-1009.183] -- 0:02:57
161000 -- (-1016.590) (-1007.926) (-1011.029) [-1012.176] * (-1011.868) [-1010.227] (-1008.551) (-1008.909) -- 0:02:57
161500 -- (-1006.499) [-1004.798] (-1006.056) (-1008.580) * [-1010.010] (-1009.692) (-1017.183) (-1005.181) -- 0:02:56
162000 -- (-1012.576) (-1009.926) [-1002.066] (-1001.309) * (-1013.649) (-1008.924) [-1003.875] (-1006.352) -- 0:03:01
162500 -- (-1009.889) [-1007.994] (-1013.854) (-1004.543) * (-1007.654) (-1008.221) (-1010.026) [-1002.418] -- 0:03:00
163000 -- (-1006.302) (-1007.459) [-1008.733] (-1015.456) * (-1005.457) (-1012.261) [-1003.157] (-1006.110) -- 0:02:59
163500 -- (-1011.674) (-1012.036) [-1005.262] (-1011.125) * [-1011.880] (-1006.415) (-1015.746) (-1003.709) -- 0:02:59
164000 -- (-1008.670) (-1008.282) (-1007.391) [-1011.467] * [-1009.009] (-1010.974) (-1008.743) (-1004.752) -- 0:02:58
164500 -- [-1004.985] (-1004.807) (-1000.842) (-1020.138) * (-1004.511) (-1008.010) [-1003.847] (-1011.575) -- 0:02:57
165000 -- [-1003.792] (-1023.361) (-1016.164) (-1008.162) * (-1009.906) (-1006.966) (-1004.413) [-1007.514] -- 0:02:57
Average standard deviation of split frequencies: 0.015619
165500 -- [-1011.602] (-1004.335) (-1012.274) (-1010.535) * (-1009.004) [-1010.746] (-1007.563) (-1008.221) -- 0:02:56
166000 -- (-1019.086) (-1005.816) (-1007.803) [-1002.177] * (-1007.188) [-1005.257] (-1015.523) (-1012.635) -- 0:02:55
166500 -- (-1008.021) (-1007.805) [-1007.293] (-1006.766) * [-1006.590] (-1014.894) (-1015.062) (-1007.535) -- 0:02:55
167000 -- (-1009.313) [-1007.961] (-1004.983) (-1007.127) * [-1009.570] (-1008.876) (-1006.763) (-1005.270) -- 0:02:59
167500 -- (-1017.009) (-1006.003) [-1008.981] (-1008.229) * (-1009.543) (-1013.298) (-1009.019) [-1007.726] -- 0:02:58
168000 -- (-1018.130) (-1011.988) [-1008.977] (-1012.083) * [-1007.003] (-1014.537) (-1013.132) (-1018.357) -- 0:02:58
168500 -- (-1021.166) [-1010.183] (-1007.252) (-1004.289) * (-1012.519) [-1006.684] (-1011.009) (-1018.049) -- 0:02:57
169000 -- (-1017.134) (-1012.593) [-1006.934] (-1012.201) * [-1008.839] (-1006.664) (-1014.193) (-1017.558) -- 0:02:57
169500 -- (-1015.715) (-1017.609) (-1005.065) [-1007.955] * [-1011.352] (-1006.493) (-1016.698) (-1007.437) -- 0:02:56
170000 -- (-1018.372) (-1008.024) [-1001.772] (-1003.933) * (-1001.835) (-1006.172) [-1011.341] (-1012.003) -- 0:02:55
Average standard deviation of split frequencies: 0.015882
170500 -- [-1014.171] (-1004.370) (-1006.255) (-1009.926) * (-1011.617) (-1005.096) [-1006.654] (-1012.815) -- 0:02:55
171000 -- (-1007.339) (-1008.087) [-1006.238] (-1009.619) * [-1012.562] (-1005.222) (-1011.931) (-1015.986) -- 0:02:54
171500 -- (-1010.780) (-1013.339) (-1010.522) [-1009.595] * (-1011.321) (-1014.177) [-1007.619] (-1010.617) -- 0:02:53
172000 -- (-1006.975) (-1019.067) [-1007.530] (-1006.807) * (-1013.594) [-1005.502] (-1005.219) (-1011.835) -- 0:02:53
172500 -- [-1009.004] (-1009.151) (-1008.321) (-1009.698) * [-1013.327] (-1010.214) (-1010.672) (-1004.133) -- 0:02:57
173000 -- [-1003.097] (-1013.945) (-1011.501) (-1008.527) * (-1010.437) [-1011.347] (-1004.230) (-1005.925) -- 0:02:56
173500 -- (-1007.021) (-1012.511) (-1008.270) [-1005.882] * (-1012.521) (-1015.989) (-1012.329) [-1008.154] -- 0:02:56
174000 -- (-1011.682) [-1015.086] (-1007.284) (-1006.490) * (-1011.183) (-1010.613) (-1011.260) [-1022.700] -- 0:02:55
174500 -- (-1009.456) (-1014.776) [-1006.327] (-1014.317) * (-1013.189) (-1005.638) [-1004.564] (-1012.952) -- 0:02:55
175000 -- (-1012.105) (-1019.044) [-1003.842] (-1012.170) * (-1018.233) [-1011.517] (-1011.438) (-1010.293) -- 0:02:54
Average standard deviation of split frequencies: 0.010714
175500 -- (-1007.616) (-1012.347) [-1002.306] (-1013.767) * (-1009.037) [-1011.368] (-1015.244) (-1012.264) -- 0:02:53
176000 -- (-1010.307) (-1010.404) [-1005.809] (-1006.635) * (-1006.022) (-1007.875) [-1011.477] (-1012.677) -- 0:02:53
176500 -- [-1009.923] (-1007.254) (-1007.941) (-1006.409) * [-1003.650] (-1016.240) (-1005.251) (-1011.437) -- 0:02:52
177000 -- (-1010.490) (-1013.365) (-1007.261) [-1008.560] * (-1002.839) [-1012.468] (-1016.799) (-1019.663) -- 0:02:52
177500 -- [-1008.187] (-1003.154) (-1007.749) (-1006.360) * (-1009.313) (-1007.266) (-1010.687) [-1013.133] -- 0:02:56
178000 -- [-1006.499] (-1006.911) (-1001.395) (-1002.732) * (-1007.506) [-1006.491] (-1009.908) (-1007.126) -- 0:02:55
178500 -- (-1005.783) (-1010.653) (-1012.438) [-1005.961] * [-1010.907] (-1008.979) (-1007.003) (-1007.049) -- 0:02:54
179000 -- (-1013.015) [-1011.761] (-1012.008) (-1004.833) * (-1010.427) (-1008.636) (-1009.156) [-1008.070] -- 0:02:54
179500 -- [-1005.005] (-1011.820) (-1006.113) (-1006.110) * (-1007.976) (-1005.845) [-1006.066] (-1008.045) -- 0:02:53
180000 -- (-1011.222) (-1009.018) (-1003.713) [-1009.333] * (-1004.829) (-1010.200) [-1005.379] (-1008.707) -- 0:02:53
Average standard deviation of split frequencies: 0.002609
180500 -- (-1007.955) [-1003.008] (-1007.124) (-1008.588) * [-1010.241] (-1009.624) (-1008.499) (-1011.913) -- 0:02:52
181000 -- (-1013.147) (-1007.891) [-1005.152] (-1006.965) * (-1002.013) [-1012.646] (-1013.820) (-1017.727) -- 0:02:51
181500 -- (-1014.403) (-1011.922) (-1002.969) [-1008.671] * (-1015.979) (-1010.680) [-1002.324] (-1009.965) -- 0:02:51
182000 -- (-1017.254) (-1009.681) [-1004.689] (-1013.492) * (-1008.462) (-1010.974) [-1006.987] (-1004.000) -- 0:02:50
182500 -- [-1009.079] (-1014.873) (-1004.779) (-1008.759) * [-1009.882] (-1005.131) (-1009.778) (-1006.627) -- 0:02:54
183000 -- (-1003.953) [-1008.242] (-1002.129) (-1013.997) * [-1004.014] (-1009.014) (-1009.743) (-1007.507) -- 0:02:54
183500 -- (-1002.502) [-1008.021] (-1006.733) (-1007.578) * (-1005.103) (-1016.325) (-1005.826) [-1009.838] -- 0:02:53
184000 -- (-1006.984) (-1014.712) [-1007.177] (-1010.271) * (-1015.190) [-1009.382] (-1003.545) (-1011.822) -- 0:02:52
184500 -- (-1016.671) [-1013.712] (-1004.922) (-1006.332) * [-1009.068] (-1006.654) (-1004.209) (-1005.932) -- 0:02:52
185000 -- (-1012.441) (-1015.919) (-1008.088) [-1003.867] * (-1006.554) [-1011.211] (-1007.159) (-1006.233) -- 0:02:51
Average standard deviation of split frequencies: 0.007603
185500 -- (-1013.421) [-1009.197] (-1012.417) (-1008.369) * [-1006.333] (-1009.901) (-1008.235) (-1004.965) -- 0:02:51
186000 -- [-1000.281] (-1009.077) (-1011.219) (-1010.819) * (-1012.403) [-1014.665] (-1015.113) (-1011.675) -- 0:02:50
186500 -- (-1008.536) [-1004.856] (-1014.024) (-1011.986) * [-1007.108] (-1007.255) (-1004.266) (-1008.428) -- 0:02:50
187000 -- [-1001.144] (-1009.672) (-1011.186) (-1009.746) * (-1008.927) (-1004.278) [-1016.954] (-1010.408) -- 0:02:49
187500 -- (-1007.987) (-1004.079) [-1007.050] (-1009.328) * (-1003.000) (-1006.831) [-1007.198] (-1007.149) -- 0:02:53
188000 -- (-1002.659) (-1008.814) (-1015.785) [-1006.552] * (-1009.158) (-1008.581) [-1005.561] (-1010.559) -- 0:02:52
188500 -- (-1006.037) (-1008.066) [-1006.621] (-1013.926) * (-1006.437) [-1002.708] (-1006.264) (-1009.429) -- 0:02:52
189000 -- (-1006.016) (-1014.597) (-1005.602) [-1006.576] * [-1009.997] (-1010.369) (-1007.530) (-1012.477) -- 0:02:51
189500 -- (-1014.499) (-1010.487) [-1002.186] (-1009.183) * (-1010.465) (-1012.348) [-1004.068] (-1003.071) -- 0:02:51
190000 -- (-1011.400) (-1008.619) (-1000.199) [-1010.045] * (-1012.529) [-1011.971] (-1010.192) (-1002.088) -- 0:02:50
Average standard deviation of split frequencies: 0.002472
190500 -- (-1002.317) (-1008.856) [-1005.710] (-1010.640) * [-1008.873] (-1012.239) (-1000.810) (-1009.056) -- 0:02:49
191000 -- (-1007.075) [-1007.896] (-1017.193) (-1009.538) * (-1006.293) (-1015.043) (-1007.042) [-1008.998] -- 0:02:49
191500 -- (-1008.185) (-1019.217) (-1014.376) [-1007.742] * [-1002.866] (-1009.211) (-1012.948) (-1011.296) -- 0:02:48
192000 -- (-1020.224) (-1020.221) [-1008.143] (-1004.190) * [-1003.757] (-1015.273) (-1002.669) (-1012.750) -- 0:02:48
192500 -- (-1028.343) [-1012.885] (-1006.492) (-1008.731) * [-1009.480] (-1009.195) (-1001.207) (-1012.497) -- 0:02:51
193000 -- (-1011.097) (-1017.446) (-1007.880) [-1009.039] * (-1018.924) [-1007.397] (-1003.565) (-1010.790) -- 0:02:51
193500 -- [-1006.424] (-1012.197) (-1008.909) (-1008.449) * (-1009.538) [-1008.781] (-1012.184) (-1009.184) -- 0:02:50
194000 -- (-1008.540) [-1006.980] (-1010.477) (-1004.540) * (-1005.658) (-1009.378) [-1007.704] (-1006.562) -- 0:02:50
194500 -- [-1013.128] (-1009.725) (-1011.518) (-1008.274) * [-1012.036] (-1008.888) (-1013.036) (-1015.873) -- 0:02:49
195000 -- [-1003.548] (-1005.076) (-1004.298) (-1009.737) * (-1015.914) (-1007.586) [-1008.119] (-1012.678) -- 0:02:49
Average standard deviation of split frequencies: 0.002405
195500 -- [-1004.687] (-1006.329) (-1009.800) (-1009.474) * (-1016.085) (-1006.696) [-1009.486] (-1003.234) -- 0:02:48
196000 -- (-1012.113) (-1009.755) [-1007.309] (-1003.293) * (-1009.169) (-1006.975) [-1002.214] (-1008.249) -- 0:02:48
196500 -- (-1018.310) [-1004.473] (-1008.707) (-1005.738) * (-1011.037) (-1002.456) (-1004.878) [-1008.417] -- 0:02:47
197000 -- (-1012.033) (-1003.992) (-1006.331) [-1004.437] * (-1005.089) (-1004.344) [-1009.101] (-1010.775) -- 0:02:47
197500 -- (-1012.287) [-1003.696] (-1004.486) (-1008.700) * (-1007.741) (-1006.949) (-1004.627) [-1006.657] -- 0:02:50
198000 -- (-1014.239) (-1002.664) (-1008.818) [-1010.547] * (-1013.380) (-1006.364) [-1003.547] (-1006.581) -- 0:02:50
198500 -- (-1004.943) (-1005.770) [-1005.797] (-1011.906) * (-1011.670) [-1004.033] (-1003.886) (-1008.890) -- 0:02:49
199000 -- (-1009.051) (-1000.574) [-1005.561] (-1007.349) * (-1005.410) (-1002.761) (-1003.499) [-1009.516] -- 0:02:49
199500 -- (-1008.757) [-1008.684] (-1012.386) (-1005.705) * [-1002.475] (-1009.408) (-1008.650) (-1011.870) -- 0:02:48
200000 -- (-1011.781) [-1005.788] (-1008.328) (-1004.997) * [-1003.234] (-1006.142) (-1013.971) (-1010.000) -- 0:02:48
Average standard deviation of split frequencies: 0.003132
200500 -- [-1006.839] (-1011.112) (-1001.423) (-1012.765) * [-1003.243] (-1005.727) (-1009.520) (-1011.731) -- 0:02:47
201000 -- (-1003.839) (-1010.907) [-1005.766] (-1019.852) * (-1006.242) [-1007.492] (-1007.924) (-1011.023) -- 0:02:46
201500 -- (-1008.709) (-1009.612) [-1013.022] (-1011.938) * [-1009.690] (-1006.251) (-1012.839) (-1006.719) -- 0:02:46
202000 -- [-1003.378] (-1015.522) (-1014.825) (-1008.317) * (-1003.872) (-1007.690) [-1006.892] (-1011.465) -- 0:02:45
202500 -- (-1008.387) (-1017.523) [-1006.249] (-1009.292) * (-1011.519) (-1010.152) [-1007.953] (-1018.587) -- 0:02:49
203000 -- (-1004.358) [-1007.414] (-1008.885) (-1006.214) * (-1008.787) (-1005.385) [-1003.590] (-1013.155) -- 0:02:48
203500 -- [-1011.439] (-1011.609) (-1002.977) (-1008.052) * (-1010.267) [-1005.522] (-1007.145) (-1008.311) -- 0:02:48
204000 -- (-1005.358) (-1008.456) [-1000.998] (-1008.994) * (-1011.134) [-1004.601] (-1012.884) (-1009.312) -- 0:02:47
204500 -- (-1009.624) (-1010.296) [-1006.822] (-1007.954) * [-1005.789] (-1002.686) (-1010.804) (-1008.470) -- 0:02:47
205000 -- [-1007.878] (-1014.484) (-1002.842) (-1006.253) * (-1007.249) (-1016.204) (-1002.884) [-1004.473] -- 0:02:46
Average standard deviation of split frequencies: 0.008009
205500 -- (-1008.066) (-1013.668) (-1002.828) [-1004.566] * (-1006.830) [-1007.967] (-1009.044) (-1005.301) -- 0:02:46
206000 -- (-1005.322) (-1010.366) (-1005.227) [-1003.368] * (-1007.359) [-1006.931] (-1012.072) (-1012.636) -- 0:02:45
206500 -- (-1008.833) (-1011.684) [-1003.214] (-1014.362) * (-1009.020) (-1009.977) (-1011.309) [-1007.166] -- 0:02:45
207000 -- (-1008.822) [-1008.086] (-1007.746) (-1016.115) * (-1011.674) [-1008.957] (-1007.274) (-1007.010) -- 0:02:44
207500 -- (-1010.355) (-1014.240) [-1007.481] (-1009.604) * (-1011.171) [-1004.856] (-1009.050) (-1007.925) -- 0:02:44
208000 -- [-1007.025] (-1005.434) (-1010.776) (-1009.687) * [-1011.327] (-1014.753) (-1006.470) (-1007.141) -- 0:02:47
208500 -- [-1008.780] (-1005.471) (-1007.212) (-1008.381) * (-1020.557) (-1008.999) [-1002.654] (-1004.803) -- 0:02:47
209000 -- (-1003.899) [-1009.445] (-1002.609) (-1008.473) * (-1005.415) (-1007.936) [-1005.329] (-1003.417) -- 0:02:46
209500 -- (-1003.918) (-1011.635) (-1011.514) [-1015.358] * (-1009.049) [-1005.324] (-1010.263) (-1004.327) -- 0:02:46
210000 -- (-1011.362) (-1010.417) [-1009.096] (-1016.747) * (-1005.574) [-1008.787] (-1006.265) (-1009.258) -- 0:02:45
Average standard deviation of split frequencies: 0.002984
210500 -- (-1006.903) (-1006.377) [-1011.923] (-1022.927) * (-1009.193) (-1007.340) (-1014.270) [-1007.757] -- 0:02:45
211000 -- [-1005.983] (-1008.055) (-1007.355) (-1014.568) * [-1008.232] (-1009.045) (-1006.386) (-1013.652) -- 0:02:44
211500 -- [-1007.811] (-1006.545) (-1003.663) (-1012.066) * (-1010.862) (-1005.802) [-1009.399] (-1012.672) -- 0:02:44
212000 -- [-1007.915] (-1013.806) (-1009.103) (-1017.353) * (-1011.321) (-1007.058) (-1013.779) [-1004.534] -- 0:02:43
212500 -- (-1009.121) (-1010.845) (-1003.010) [-1011.077] * (-1009.617) (-1006.836) [-1010.210] (-1005.742) -- 0:02:43
213000 -- [-1007.686] (-1013.326) (-1006.288) (-1009.582) * (-1008.495) (-1007.210) [-1009.640] (-1007.048) -- 0:02:46
213500 -- (-1008.411) [-1004.761] (-1010.592) (-1009.103) * (-1008.799) (-1002.368) [-1006.902] (-1010.856) -- 0:02:45
214000 -- (-1009.302) (-1007.220) (-1006.319) [-1004.861] * (-1009.349) (-1014.781) (-1002.086) [-1004.985] -- 0:02:45
214500 -- (-1010.755) (-1006.940) [-1005.359] (-1009.445) * (-1008.184) (-1003.865) [-1008.551] (-1008.750) -- 0:02:44
215000 -- (-1014.776) (-1014.953) [-1003.750] (-1011.156) * (-1006.985) [-1007.700] (-1008.910) (-1007.939) -- 0:02:44
Average standard deviation of split frequencies: 0.002910
215500 -- (-1008.692) (-1017.854) [-1010.916] (-1007.158) * (-1015.502) [-1012.174] (-1011.212) (-1005.860) -- 0:02:43
216000 -- (-1011.931) (-1017.512) [-1006.827] (-1008.031) * (-1010.192) (-1009.178) (-1011.749) [-1004.929] -- 0:02:43
216500 -- (-1006.694) (-1008.434) (-1010.254) [-1008.953] * (-1005.044) (-1005.420) (-1001.892) [-1004.425] -- 0:02:42
217000 -- (-1017.082) [-1007.390] (-1005.383) (-1014.594) * [-1007.375] (-1007.364) (-1008.223) (-1008.521) -- 0:02:42
217500 -- (-1008.632) (-1008.880) [-1008.822] (-1014.554) * (-1005.724) (-1007.195) (-1005.225) [-1002.265] -- 0:02:41
218000 -- [-1007.528] (-1010.477) (-1012.468) (-1012.986) * (-1006.890) (-1007.344) (-1008.429) [-1000.739] -- 0:02:45
218500 -- [-1006.546] (-1005.492) (-1010.655) (-1005.945) * (-1008.704) (-1015.229) (-1018.322) [-1008.067] -- 0:02:44
219000 -- (-1002.839) (-1010.909) (-1008.908) [-1013.466] * [-1011.574] (-1007.084) (-1009.358) (-1009.265) -- 0:02:44
219500 -- (-1002.060) (-1012.231) (-1010.018) [-1004.338] * [-1006.638] (-1005.830) (-1012.134) (-1013.994) -- 0:02:43
220000 -- (-1008.019) (-1013.008) [-1004.307] (-1007.209) * (-1008.802) (-1008.697) [-1007.287] (-1012.537) -- 0:02:43
Average standard deviation of split frequencies: 0.002848
220500 -- (-1010.630) [-1009.866] (-1005.606) (-1010.025) * [-1008.414] (-1011.453) (-1006.863) (-1012.336) -- 0:02:42
221000 -- (-1007.649) (-1010.138) (-1010.916) [-1007.809] * (-1006.725) [-1006.635] (-1021.985) (-1007.009) -- 0:02:42
221500 -- [-1005.458] (-1004.773) (-1010.746) (-1005.051) * (-1008.464) [-1002.746] (-1008.985) (-1008.600) -- 0:02:41
222000 -- [-1008.718] (-1004.330) (-1004.393) (-1005.538) * (-1010.494) (-1002.740) (-1004.035) [-1004.120] -- 0:02:41
222500 -- (-1005.487) [-1004.826] (-1007.061) (-1007.321) * (-1014.019) (-1008.311) (-1009.054) [-1002.356] -- 0:02:40
223000 -- [-1007.201] (-1007.332) (-1010.421) (-1003.910) * (-1005.935) [-1003.297] (-1002.688) (-1005.137) -- 0:02:43
223500 -- (-1012.998) (-1007.494) (-1012.812) [-1004.898] * (-1010.428) (-1011.655) (-1005.465) [-1009.295] -- 0:02:43
224000 -- (-1006.929) [-1006.139] (-1004.723) (-1010.979) * (-1010.264) (-1004.648) (-1014.269) [-1003.125] -- 0:02:42
224500 -- (-1010.333) [-1006.227] (-1000.793) (-1006.294) * [-1007.917] (-1011.722) (-1010.171) (-1007.575) -- 0:02:42
225000 -- (-1011.998) [-1005.509] (-1002.022) (-1006.229) * (-1011.022) (-1013.746) (-1007.002) [-1009.994] -- 0:02:41
Average standard deviation of split frequencies: 0.001391
225500 -- (-1003.432) [-1010.208] (-1012.129) (-1008.449) * (-1011.004) (-1016.591) (-1011.885) [-1001.903] -- 0:02:41
226000 -- [-1011.873] (-1006.020) (-1017.561) (-1006.394) * (-1013.091) (-1012.729) (-1005.371) [-1000.550] -- 0:02:40
226500 -- [-1009.441] (-1013.775) (-1010.785) (-1009.599) * (-1009.614) [-1018.496] (-1009.293) (-1006.975) -- 0:02:40
227000 -- (-1015.937) (-1002.531) [-1008.835] (-1012.762) * (-1008.792) (-1017.807) [-1015.246] (-1007.060) -- 0:02:40
227500 -- (-1009.233) [-1008.212] (-1015.436) (-1006.842) * (-1013.317) [-1011.771] (-1008.297) (-1004.762) -- 0:02:39
228000 -- (-1013.187) (-1014.423) (-1008.533) [-1004.598] * [-1009.717] (-1004.899) (-1011.184) (-1003.496) -- 0:02:42
228500 -- (-1009.457) (-1009.071) [-1003.445] (-1016.517) * (-1012.813) [-1001.233] (-1013.753) (-1014.446) -- 0:02:42
229000 -- (-1014.565) [-1016.032] (-1012.640) (-1003.233) * (-1012.375) (-1005.291) (-1020.343) [-1013.716] -- 0:02:41
229500 -- [-1003.256] (-1013.113) (-1007.101) (-1011.749) * (-1007.081) (-1008.318) (-1015.642) [-1011.183] -- 0:02:41
230000 -- (-1008.338) [-1004.974] (-1014.475) (-1006.826) * (-1009.800) (-1010.386) [-1012.674] (-1011.638) -- 0:02:40
Average standard deviation of split frequencies: 0.002044
230500 -- (-1010.135) [-1010.669] (-1008.368) (-1015.017) * [-1007.247] (-1010.440) (-1008.837) (-1009.649) -- 0:02:40
231000 -- (-1009.920) (-1013.525) [-1008.861] (-1009.981) * [-1014.003] (-1003.882) (-1008.790) (-1010.083) -- 0:02:39
231500 -- (-1008.204) (-1013.282) [-1012.134] (-1006.026) * (-1011.271) (-1010.667) [-1010.804] (-1006.707) -- 0:02:39
232000 -- (-1004.329) [-1012.208] (-1016.104) (-1007.961) * [-1003.440] (-1001.761) (-1016.408) (-1010.979) -- 0:02:38
232500 -- (-1009.637) [-1011.703] (-1011.799) (-1004.591) * [-1011.388] (-1017.808) (-1008.793) (-1001.965) -- 0:02:38
233000 -- (-1012.130) [-1007.027] (-1022.100) (-1008.864) * (-1003.959) [-1010.832] (-1011.872) (-1005.968) -- 0:02:41
233500 -- (-1008.047) [-1007.738] (-1016.269) (-1005.703) * (-1004.454) (-1008.085) [-1005.862] (-1008.067) -- 0:02:40
234000 -- (-1007.467) (-1009.797) (-1012.637) [-1008.015] * [-1008.363] (-1008.876) (-1006.928) (-1012.674) -- 0:02:40
234500 -- (-1007.481) (-1012.453) (-1005.313) [-1006.071] * (-1008.942) (-1005.443) [-1007.644] (-1012.727) -- 0:02:39
235000 -- (-1019.714) (-1012.885) (-1005.508) [-1008.814] * (-1006.173) (-1007.245) (-1009.646) [-1007.426] -- 0:02:39
Average standard deviation of split frequencies: 0.004661
235500 -- [-1009.788] (-1011.144) (-1013.800) (-1013.466) * (-1008.543) (-1008.613) [-1011.706] (-1006.291) -- 0:02:39
236000 -- [-1006.082] (-1000.508) (-1004.609) (-1012.209) * (-1010.299) [-1005.654] (-1007.162) (-1002.778) -- 0:02:38
236500 -- (-1008.333) (-1002.201) (-1021.776) [-1004.040] * (-1008.235) (-1015.280) [-1004.947] (-1005.830) -- 0:02:38
237000 -- [-1008.170] (-1005.846) (-1004.356) (-1009.407) * (-1003.009) (-1004.948) [-1013.148] (-1007.762) -- 0:02:37
237500 -- [-1012.686] (-1004.669) (-1012.974) (-1014.677) * (-1005.027) (-1009.851) (-1015.604) [-1002.940] -- 0:02:37
238000 -- (-1019.465) (-1007.962) [-1003.761] (-1007.322) * (-1007.975) (-1005.263) (-1013.188) [-1005.950] -- 0:02:40
238500 -- (-1010.436) (-1007.809) [-1003.406] (-1003.382) * [-1006.423] (-1015.433) (-1012.988) (-1012.603) -- 0:02:39
239000 -- [-1007.551] (-1006.520) (-1012.885) (-1003.840) * (-1007.083) (-1005.014) [-1005.656] (-1011.489) -- 0:02:39
239500 -- (-1013.631) (-1005.797) (-1007.476) [-1008.032] * [-1010.513] (-1005.392) (-1007.136) (-1008.943) -- 0:02:38
240000 -- [-1013.366] (-1009.026) (-1012.841) (-1012.727) * (-1009.531) [-1006.054] (-1010.059) (-1009.621) -- 0:02:38
Average standard deviation of split frequencies: 0.005223
240500 -- [-1007.294] (-1008.389) (-1009.294) (-1010.073) * [-1010.764] (-1009.409) (-1011.748) (-1005.351) -- 0:02:37
241000 -- (-1004.670) (-1014.132) (-1008.749) [-1003.619] * (-1014.991) (-1005.044) (-1005.512) [-1002.876] -- 0:02:37
241500 -- [-1006.167] (-1013.330) (-1008.170) (-1009.821) * [-1003.418] (-1012.348) (-1006.391) (-1005.335) -- 0:02:37
242000 -- [-1005.123] (-1014.631) (-1007.490) (-1011.965) * (-1010.733) [-1005.279] (-1011.471) (-1008.712) -- 0:02:36
242500 -- (-1007.533) (-1011.025) [-1011.811] (-1019.285) * [-1005.722] (-1008.333) (-1012.426) (-1009.387) -- 0:02:36
243000 -- (-1008.107) [-1013.867] (-1009.783) (-1006.867) * (-1008.633) [-1011.012] (-1004.318) (-1007.330) -- 0:02:38
243500 -- [-1004.372] (-1006.126) (-1010.597) (-1013.405) * (-1010.436) (-1012.137) (-1009.483) [-1012.265] -- 0:02:38
244000 -- (-1005.328) (-1010.279) [-1009.272] (-1011.050) * [-1003.064] (-1011.256) (-1007.064) (-1016.372) -- 0:02:38
244500 -- (-1007.598) (-1002.764) (-1008.398) [-1004.554] * [-1004.424] (-1008.222) (-1011.650) (-1010.700) -- 0:02:37
245000 -- (-1018.747) (-1013.465) [-1009.367] (-1005.084) * (-1011.056) (-1007.348) (-1014.031) [-1012.889] -- 0:02:37
Average standard deviation of split frequencies: 0.005110
245500 -- (-1005.796) (-1007.184) (-1012.003) [-1007.190] * (-1009.236) (-1010.742) [-1012.212] (-1012.141) -- 0:02:36
246000 -- (-1006.867) (-1013.756) [-1004.648] (-1006.729) * (-1001.482) [-1001.662] (-1005.609) (-1006.015) -- 0:02:36
246500 -- (-1007.629) (-1002.651) [-1005.359] (-1013.031) * [-1004.357] (-1008.174) (-1008.419) (-1007.195) -- 0:02:35
247000 -- (-1013.672) (-1006.440) (-1005.901) [-1011.065] * [-1006.427] (-1014.400) (-1006.575) (-1014.321) -- 0:02:35
247500 -- (-1003.348) (-1003.693) [-1002.400] (-1007.608) * (-1005.707) (-1011.332) [-1004.252] (-1004.610) -- 0:02:35
248000 -- (-1007.851) (-1004.459) (-1008.369) [-1004.330] * (-1011.503) (-1014.918) [-1004.222] (-1012.440) -- 0:02:34
248500 -- [-1005.147] (-1006.852) (-1012.686) (-1008.839) * (-1013.608) (-1009.766) [-1009.975] (-1004.850) -- 0:02:37
249000 -- (-1010.832) (-1007.946) [-1012.191] (-1008.432) * [-1006.872] (-1008.771) (-1007.208) (-1004.745) -- 0:02:36
249500 -- [-1001.969] (-1015.441) (-1004.920) (-1007.973) * (-1011.086) (-1004.709) (-1011.186) [-1004.204] -- 0:02:36
250000 -- [-1002.460] (-1006.475) (-1009.174) (-1009.001) * [-1014.421] (-1010.215) (-1003.641) (-1003.443) -- 0:02:36
Average standard deviation of split frequencies: 0.003761
250500 -- (-1014.830) (-1007.146) (-1014.395) [-1003.801] * (-1010.901) [-1007.679] (-1011.379) (-1023.885) -- 0:02:35
251000 -- [-1011.273] (-1004.223) (-1015.912) (-1010.729) * (-1012.331) (-1006.143) [-1013.326] (-1003.083) -- 0:02:35
251500 -- [-1008.186] (-1019.636) (-1012.779) (-1007.724) * (-1012.480) [-999.341] (-1013.324) (-1003.463) -- 0:02:34
252000 -- (-1007.415) (-1007.998) (-1008.847) [-1008.787] * (-1008.693) (-1009.098) [-1008.174] (-1007.643) -- 0:02:34
252500 -- [-1007.687] (-1014.691) (-1010.244) (-1012.185) * (-1018.719) (-1001.369) [-1006.193] (-1018.060) -- 0:02:33
253000 -- (-1005.674) [-1011.396] (-1011.407) (-1013.044) * [-1017.006] (-1014.578) (-1010.166) (-1007.136) -- 0:02:33
253500 -- (-1003.065) (-1010.468) [-1006.712] (-1008.809) * (-1008.862) (-1001.872) (-1009.943) [-1009.508] -- 0:02:36
254000 -- [-1006.786] (-1005.948) (-1007.541) (-1007.731) * (-1020.499) (-1010.679) [-1011.517] (-1007.155) -- 0:02:35
254500 -- (-1007.642) (-1003.829) (-1007.677) [-1008.032] * (-1005.577) (-1010.786) [-1006.853] (-1021.018) -- 0:02:35
255000 -- [-1005.340] (-1005.864) (-1008.328) (-1006.134) * (-1006.561) (-1003.688) (-1007.758) [-1004.835] -- 0:02:34
Average standard deviation of split frequencies: 0.004910
255500 -- (-1012.069) (-1003.739) [-1006.679] (-1013.850) * (-1013.476) (-1006.542) [-1008.261] (-1008.675) -- 0:02:34
256000 -- (-1004.863) (-1001.494) (-1014.655) [-1004.627] * (-1015.996) (-1004.327) [-1004.192] (-1013.858) -- 0:02:34
256500 -- (-1008.477) (-1007.395) (-1010.003) [-1008.059] * (-1014.199) [-1006.690] (-1009.094) (-1013.287) -- 0:02:33
257000 -- (-1006.108) (-1010.207) (-1005.033) [-1002.928] * (-1008.226) (-1008.885) (-1010.814) [-1008.346] -- 0:02:33
257500 -- (-1012.766) (-1005.294) [-1004.348] (-1003.931) * (-1004.281) [-1008.330] (-1014.574) (-1010.698) -- 0:02:32
258000 -- (-1009.784) (-1006.698) [-1006.664] (-1013.596) * (-1003.007) (-1009.606) (-1013.617) [-1002.424] -- 0:02:32
258500 -- [-1005.989] (-1000.273) (-1005.458) (-1011.179) * (-1014.311) (-1006.796) (-1017.585) [-1011.308] -- 0:02:34
259000 -- [-1009.599] (-1001.966) (-1012.877) (-1009.371) * (-1007.305) [-1007.011] (-1009.710) (-1003.751) -- 0:02:34
259500 -- (-1017.671) [-1009.267] (-1004.883) (-1012.529) * (-1008.407) (-1010.536) (-1007.260) [-1003.096] -- 0:02:34
260000 -- (-1000.663) (-1005.467) [-1007.328] (-1016.313) * (-1008.271) [-1002.608] (-1013.786) (-1015.631) -- 0:02:33
Average standard deviation of split frequencies: 0.004823
260500 -- (-1011.778) [-1006.848] (-1008.876) (-1012.977) * (-1010.218) [-1007.673] (-1012.378) (-1012.922) -- 0:02:33
261000 -- (-1009.571) [-1002.188] (-1007.220) (-1008.447) * (-1016.623) (-1008.278) [-1006.097] (-1012.616) -- 0:02:32
261500 -- [-1003.904] (-1005.311) (-1004.440) (-1006.227) * (-1008.210) (-1004.044) (-1006.043) [-1001.079] -- 0:02:32
262000 -- [-1007.822] (-1007.935) (-1013.291) (-1014.589) * (-1009.898) (-1009.112) [-1004.447] (-1003.191) -- 0:02:32
262500 -- (-1020.559) [-1012.755] (-1019.276) (-1006.040) * (-1007.046) (-1005.466) (-1011.706) [-1003.778] -- 0:02:31
263000 -- (-1007.827) (-1006.146) [-1012.437] (-1005.828) * (-1011.785) (-1013.660) [-1006.228] (-1004.033) -- 0:02:34
263500 -- [-1003.664] (-1008.762) (-1016.554) (-1005.150) * (-1012.956) [-1009.871] (-1004.908) (-1006.736) -- 0:02:33
264000 -- (-1009.598) [-1005.794] (-1013.666) (-1004.193) * (-1006.836) (-1019.112) [-1007.329] (-1010.817) -- 0:02:33
264500 -- (-1006.494) (-1004.996) [-1010.734] (-1008.243) * [-1005.241] (-1016.569) (-1007.522) (-1008.847) -- 0:02:32
265000 -- (-1010.863) (-1008.524) (-1007.842) [-1003.508] * [-1009.504] (-1016.334) (-1010.478) (-1010.585) -- 0:02:32
Average standard deviation of split frequencies: 0.005317
265500 -- [-1007.267] (-1014.820) (-1008.618) (-1002.802) * (-1007.380) (-1015.074) (-1009.871) [-1014.379] -- 0:02:32
266000 -- [-1009.762] (-1008.987) (-1003.624) (-1005.591) * [-1006.992] (-1009.741) (-1011.723) (-1009.378) -- 0:02:31
266500 -- (-1012.278) (-1009.877) [-1003.790] (-1010.017) * [-1009.119] (-1008.214) (-1015.612) (-1012.846) -- 0:02:31
267000 -- (-1016.176) (-1006.788) (-1004.022) [-1002.812] * (-1008.281) (-1014.220) (-1013.646) [-1007.655] -- 0:02:30
267500 -- (-1009.414) (-1009.089) [-1007.627] (-1009.992) * (-1011.490) [-1011.671] (-1011.454) (-1002.699) -- 0:02:30
268000 -- (-1010.704) (-1006.659) [-1010.847] (-1003.356) * (-1003.702) (-1010.243) [-1009.143] (-1006.981) -- 0:02:32
268500 -- (-1005.714) (-1004.423) [-1011.605] (-1012.198) * (-1009.373) (-1011.227) [-1004.942] (-1007.149) -- 0:02:32
269000 -- (-1004.356) (-1004.242) (-1006.271) [-1006.406] * (-1011.516) (-1020.412) (-1009.529) [-1006.782] -- 0:02:32
269500 -- (-1006.215) (-1008.619) (-1014.655) [-1005.788] * [-1005.883] (-1005.744) (-1009.096) (-1004.877) -- 0:02:31
270000 -- (-1005.170) (-1010.980) [-1006.215] (-1004.329) * (-1013.255) [-1004.685] (-1006.266) (-1006.651) -- 0:02:31
Average standard deviation of split frequencies: 0.006386
270500 -- (-1005.144) (-1007.325) [-1012.349] (-1003.401) * [-1007.643] (-1012.469) (-1008.083) (-1009.829) -- 0:02:31
271000 -- (-1003.858) (-1004.747) (-1004.810) [-1006.670] * (-1013.268) [-1008.804] (-1005.124) (-1005.776) -- 0:02:30
271500 -- (-1009.206) (-1007.309) (-1004.080) [-1006.331] * (-1002.335) (-1005.208) [-1002.459] (-1004.418) -- 0:02:30
272000 -- (-1016.200) (-1004.555) [-1005.814] (-1010.870) * (-1003.539) [-1010.855] (-1002.599) (-1005.049) -- 0:02:29
272500 -- (-1010.444) (-1010.133) [-1008.342] (-1006.469) * [-1004.339] (-1008.395) (-1003.195) (-1010.945) -- 0:02:29
273000 -- (-1019.138) (-1012.292) [-1008.656] (-1003.919) * (-1007.416) (-1004.178) [-1003.634] (-1010.866) -- 0:02:31
273500 -- (-1016.051) [-1005.164] (-1011.372) (-1006.890) * [-1003.904] (-1009.086) (-1002.516) (-1001.533) -- 0:02:31
274000 -- (-1007.964) (-1005.116) (-1006.688) [-1008.730] * [-1002.078] (-1008.051) (-1007.386) (-1007.401) -- 0:02:31
274500 -- (-1008.767) [-1007.469] (-1007.689) (-1013.585) * (-1006.227) (-1012.926) (-1006.666) [-1010.162] -- 0:02:30
275000 -- [-1010.280] (-1012.936) (-1010.474) (-1004.977) * (-1006.135) (-1008.758) (-1005.376) [-1008.248] -- 0:02:30
Average standard deviation of split frequencies: 0.007401
275500 -- (-1007.628) (-1006.980) (-1005.593) [-1007.512] * (-1010.837) [-1007.766] (-1005.651) (-1008.398) -- 0:02:29
276000 -- (-1011.744) (-1010.654) [-1005.673] (-1003.928) * [-1006.139] (-1009.638) (-1012.102) (-1006.821) -- 0:02:29
276500 -- (-1006.871) (-1012.241) (-1006.924) [-1010.733] * (-1011.440) (-1015.840) (-1007.419) [-1004.969] -- 0:02:29
277000 -- (-1010.814) [-1008.881] (-1009.750) (-1003.801) * (-1001.268) (-1015.662) (-1003.635) [-1005.220] -- 0:02:28
277500 -- (-1017.746) (-1010.254) (-1004.959) [-1004.211] * (-1005.378) [-1002.936] (-1011.458) (-1021.311) -- 0:02:28
278000 -- [-1007.682] (-1010.694) (-1008.411) (-1002.003) * (-1009.950) [-1002.211] (-1006.620) (-1019.466) -- 0:02:30
278500 -- (-1010.975) (-1004.576) (-1009.088) [-1005.361] * (-1011.428) (-1005.630) [-1005.702] (-1015.314) -- 0:02:30
279000 -- [-1006.212] (-1009.983) (-1004.507) (-1009.021) * (-1006.196) (-1004.771) (-1010.261) [-1006.543] -- 0:02:29
279500 -- (-1010.199) (-1010.606) (-1015.838) [-1001.127] * (-1008.847) (-1009.416) (-1011.320) [-1008.728] -- 0:02:29
280000 -- (-1007.696) [-1006.093] (-1012.315) (-1006.391) * [-1006.526] (-1013.410) (-1011.301) (-1012.788) -- 0:02:29
Average standard deviation of split frequencies: 0.006718
280500 -- (-1010.322) [-1009.698] (-1015.942) (-1007.828) * (-1004.829) (-1011.910) (-1012.618) [-1007.552] -- 0:02:28
281000 -- (-1015.694) (-1007.806) [-1011.754] (-1013.395) * (-1006.624) (-1011.530) (-1007.783) [-1010.299] -- 0:02:28
281500 -- (-1013.651) [-1007.819] (-1007.542) (-1008.906) * (-1007.505) (-1009.922) [-1010.690] (-1009.837) -- 0:02:28
282000 -- (-1005.990) [-1011.634] (-1007.487) (-1009.365) * [-1011.184] (-1003.721) (-1007.029) (-1010.348) -- 0:02:27
282500 -- (-1004.234) [-1004.644] (-1008.758) (-1015.594) * [-1026.506] (-1021.233) (-1013.620) (-1015.095) -- 0:02:27
283000 -- (-1007.816) (-1006.999) (-1009.279) [-1003.059] * (-1014.736) (-1012.346) (-1010.930) [-1004.473] -- 0:02:29
283500 -- [-1002.354] (-1004.364) (-1014.696) (-1004.334) * (-1006.301) (-1006.089) [-1013.049] (-1012.802) -- 0:02:29
284000 -- (-1007.114) [-1006.468] (-1003.458) (-1014.104) * (-1006.771) (-1012.311) [-1015.877] (-1011.750) -- 0:02:28
284500 -- (-1002.660) (-1012.506) (-1012.816) [-1012.377] * (-1011.626) [-1006.828] (-1011.517) (-1011.877) -- 0:02:28
285000 -- (-1010.094) (-1014.954) [-1007.974] (-1008.670) * [-1012.094] (-1007.015) (-1007.466) (-1005.714) -- 0:02:28
Average standard deviation of split frequencies: 0.007142
285500 -- (-1004.206) (-1010.170) (-1009.189) [-1005.356] * (-1011.393) (-1010.744) [-1008.305] (-1006.941) -- 0:02:27
286000 -- [-1004.119] (-1012.484) (-1005.661) (-1006.424) * (-1007.307) (-1007.087) (-1011.506) [-1010.960] -- 0:02:27
286500 -- (-1009.961) (-1010.749) (-1009.903) [-1005.634] * (-1010.946) (-1008.724) (-1009.659) [-1011.438] -- 0:02:26
287000 -- (-1007.331) (-1009.352) [-1006.926] (-1006.299) * (-1008.282) (-1013.611) [-1014.057] (-1002.664) -- 0:02:26
287500 -- (-1010.240) (-1009.005) [-1008.488] (-1004.965) * [-1007.260] (-1003.833) (-1009.601) (-1009.036) -- 0:02:26
288000 -- (-1012.894) (-1011.047) (-1007.790) [-1006.451] * (-1007.856) (-1017.286) (-1011.296) [-1008.668] -- 0:02:28
288500 -- [-1010.727] (-1008.629) (-1014.529) (-1005.869) * (-1010.692) (-1009.846) (-1017.475) [-1002.813] -- 0:02:27
289000 -- (-1009.116) [-1004.095] (-1004.331) (-1014.489) * [-1001.357] (-1008.507) (-1009.427) (-1012.256) -- 0:02:27
289500 -- [-1008.484] (-1009.930) (-1012.383) (-1021.692) * [-1006.903] (-1013.697) (-1017.528) (-1001.436) -- 0:02:27
290000 -- (-1015.239) [-1004.032] (-1004.274) (-1004.223) * (-1007.709) (-1009.843) (-1015.044) [-1009.034] -- 0:02:26
Average standard deviation of split frequencies: 0.008109
290500 -- (-1020.266) (-1018.068) [-1002.074] (-1008.538) * (-1010.335) (-1007.653) (-1011.692) [-1014.411] -- 0:02:26
291000 -- (-1007.222) [-1004.723] (-1002.672) (-1008.885) * (-1010.908) (-1006.863) (-1013.977) [-1010.937] -- 0:02:26
291500 -- [-1009.196] (-1007.118) (-1005.146) (-1013.162) * (-1010.876) (-1006.278) [-1013.930] (-1007.851) -- 0:02:25
292000 -- (-1012.402) (-1007.044) (-1007.303) [-1005.168] * [-1004.479] (-1004.282) (-1023.968) (-1007.086) -- 0:02:25
292500 -- (-1005.058) [-1008.648] (-1003.500) (-1007.228) * (-1009.240) (-1006.274) (-1005.466) [-1006.440] -- 0:02:25
293000 -- (-1009.362) (-1006.840) [-1004.671] (-1008.379) * [-1003.251] (-1006.459) (-1005.613) (-1010.243) -- 0:02:27
293500 -- (-1007.750) (-1010.930) [-1004.243] (-1002.534) * (-1006.920) (-1016.466) (-1012.292) [-1007.368] -- 0:02:26
294000 -- [-1009.689] (-1010.605) (-1006.371) (-1013.649) * [-1004.389] (-1011.100) (-1016.599) (-1008.827) -- 0:02:26
294500 -- (-1008.163) (-1011.883) [-1009.362] (-1007.000) * (-1004.805) [-1004.713] (-1003.825) (-1008.476) -- 0:02:26
295000 -- (-1005.828) (-1011.821) (-1000.847) [-1005.409] * (-1010.558) [-1000.797] (-1006.788) (-1011.396) -- 0:02:25
Average standard deviation of split frequencies: 0.007963
295500 -- [-1006.366] (-1009.584) (-1011.045) (-1007.078) * [-1007.938] (-1006.292) (-1008.115) (-1009.068) -- 0:02:25
296000 -- (-1014.770) (-1005.028) [-1005.840] (-1006.236) * (-1011.277) (-1007.632) [-1009.391] (-1010.841) -- 0:02:25
296500 -- (-1014.576) [-1004.249] (-1005.203) (-1000.802) * (-1014.622) [-1005.868] (-1015.203) (-1012.185) -- 0:02:24
297000 -- (-1006.102) (-1006.190) [-1012.970] (-1018.058) * (-1004.785) (-1009.051) [-1005.513] (-1014.598) -- 0:02:24
297500 -- [-1008.985] (-1011.310) (-1015.010) (-1006.990) * (-1003.860) [-1006.156] (-1005.829) (-1007.145) -- 0:02:24
298000 -- [-1007.090] (-1008.102) (-1012.477) (-1015.460) * (-1003.644) (-1009.351) (-1006.042) [-1005.031] -- 0:02:23
298500 -- [-1003.720] (-1015.905) (-1009.323) (-1012.173) * [-1005.921] (-1016.192) (-1008.568) (-1008.526) -- 0:02:25
299000 -- (-1003.279) (-1017.548) [-1004.124] (-1011.000) * (-1006.613) (-1009.772) (-1005.022) [-1001.755] -- 0:02:25
299500 -- (-1011.631) [-1008.324] (-1014.389) (-1009.376) * [-1007.909] (-1004.980) (-1017.125) (-1007.090) -- 0:02:25
300000 -- [-1004.704] (-1006.321) (-1012.356) (-1010.088) * (-1011.312) (-1012.265) (-1006.450) [-1006.704] -- 0:02:24
Average standard deviation of split frequencies: 0.007839
300500 -- (-1008.777) (-1010.899) [-1004.888] (-1009.601) * [-1005.384] (-1010.444) (-1007.092) (-1004.630) -- 0:02:24
301000 -- [-1003.360] (-1006.617) (-1013.392) (-1013.325) * [-1003.840] (-1007.636) (-1011.292) (-1004.956) -- 0:02:23
301500 -- (-1005.435) [-1006.638] (-1009.727) (-1006.535) * [-1006.693] (-1002.814) (-1006.735) (-1004.789) -- 0:02:23
302000 -- [-1000.814] (-1005.629) (-1003.567) (-1010.307) * [-1008.926] (-1012.344) (-1006.282) (-1010.410) -- 0:02:23
302500 -- (-1005.854) (-1004.380) (-1003.482) [-1008.586] * (-1008.579) (-1007.364) (-1007.671) [-1012.461] -- 0:02:22
303000 -- (-1010.467) (-1003.843) (-1008.806) [-1000.954] * (-1014.559) (-1012.487) (-1012.597) [-1004.008] -- 0:02:24
303500 -- (-1011.256) [-1003.906] (-1012.660) (-1005.480) * (-1003.794) [-1006.730] (-1005.580) (-1004.885) -- 0:02:24
304000 -- [-1004.731] (-1012.433) (-1007.305) (-1002.888) * (-1012.434) (-1003.758) (-1008.421) [-1013.666] -- 0:02:24
304500 -- (-1005.633) (-1015.352) (-1005.905) [-1008.251] * [-1015.673] (-1005.552) (-1011.220) (-1008.985) -- 0:02:23
305000 -- (-1009.099) (-1007.100) [-1008.258] (-1007.114) * (-1009.143) [-1006.329] (-1008.641) (-1005.017) -- 0:02:23
Average standard deviation of split frequencies: 0.009243
305500 -- (-1009.054) (-1022.002) (-1012.427) [-1004.472] * (-1006.879) (-1005.126) (-1011.947) [-1004.162] -- 0:02:23
306000 -- (-1004.361) (-1013.559) (-1008.683) [-1000.637] * [-1009.664] (-1014.265) (-1013.390) (-1012.643) -- 0:02:22
306500 -- (-1014.327) (-1014.321) [-1013.833] (-1010.643) * (-1014.982) [-1003.530] (-1004.948) (-1009.043) -- 0:02:22
307000 -- (-1002.880) (-1014.245) (-1013.667) [-1010.167] * (-1006.154) (-1005.759) [-1006.063] (-1012.696) -- 0:02:22
307500 -- (-1013.079) [-1006.124] (-1007.933) (-1007.059) * (-1003.520) (-1007.426) [-1008.230] (-1011.027) -- 0:02:21
308000 -- (-1007.890) (-1007.894) (-1014.137) [-1003.470] * [-1008.725] (-1002.338) (-1010.719) (-1006.386) -- 0:02:21
308500 -- (-1005.462) [-1003.674] (-1013.095) (-1002.947) * (-1012.443) (-1015.572) [-1009.025] (-1008.351) -- 0:02:23
309000 -- (-1005.441) (-1004.541) (-1012.301) [-1008.168] * (-1012.099) [-1010.983] (-1007.000) (-1007.225) -- 0:02:23
309500 -- (-1007.643) (-1011.553) (-1014.113) [-1018.000] * (-1010.641) (-1005.821) [-1010.133] (-1011.244) -- 0:02:22
310000 -- [-1006.126] (-1008.701) (-1008.911) (-1011.746) * (-1020.184) (-1005.161) (-1008.650) [-1007.307] -- 0:02:22
Average standard deviation of split frequencies: 0.009610
310500 -- [-1000.876] (-1013.767) (-1010.593) (-1003.724) * (-1007.678) [-1006.895] (-1008.661) (-1005.506) -- 0:02:22
311000 -- [-1003.177] (-1010.541) (-1006.014) (-1012.000) * [-1005.233] (-1021.861) (-1013.618) (-1005.838) -- 0:02:21
311500 -- (-1006.483) (-1009.970) (-1006.877) [-1003.584] * [-1007.553] (-1013.204) (-1003.979) (-1009.775) -- 0:02:21
312000 -- (-1007.476) (-1007.433) (-1003.719) [-1002.192] * (-1012.917) [-1003.284] (-1008.912) (-1017.603) -- 0:02:21
312500 -- [-1003.124] (-1015.163) (-1004.791) (-1009.434) * (-1016.167) (-1010.692) (-1009.106) [-1012.428] -- 0:02:20
313000 -- [-1006.706] (-1007.278) (-1004.951) (-1015.333) * (-1005.695) (-1005.075) [-1008.625] (-1014.128) -- 0:02:20
313500 -- (-1007.467) [-1005.907] (-1012.399) (-1007.950) * (-1007.504) (-1014.300) [-1004.198] (-1009.134) -- 0:02:22
314000 -- (-1010.154) [-1002.254] (-1010.074) (-1005.327) * [-1005.164] (-1009.285) (-1007.311) (-1019.728) -- 0:02:22
314500 -- (-1019.437) [-1007.525] (-1010.151) (-1012.128) * (-1008.468) (-1011.891) (-1009.486) [-1011.290] -- 0:02:21
315000 -- [-1005.626] (-1007.262) (-1006.564) (-1010.030) * [-1002.891] (-1009.251) (-1008.232) (-1002.883) -- 0:02:21
Average standard deviation of split frequencies: 0.008951
315500 -- (-1008.185) [-1004.139] (-1010.530) (-1012.711) * [-1006.759] (-1008.759) (-1005.841) (-1008.886) -- 0:02:21
316000 -- (-1008.886) (-1004.508) [-1002.525] (-1014.223) * [-1006.903] (-1002.902) (-1012.549) (-1010.360) -- 0:02:20
316500 -- (-1011.311) [-1009.660] (-1009.313) (-1015.114) * (-1008.567) (-1006.249) (-1011.877) [-1005.826] -- 0:02:20
317000 -- [-1008.993] (-1010.670) (-1011.394) (-1002.738) * (-1005.751) (-1001.475) [-1002.533] (-1014.516) -- 0:02:20
317500 -- (-1013.046) (-1005.371) (-1013.870) [-1004.359] * (-1008.975) (-1006.295) [-1006.082] (-1011.028) -- 0:02:19
318000 -- (-1010.462) (-1007.795) [-1006.035] (-1014.256) * (-1011.372) (-1011.867) (-1011.527) [-1005.256] -- 0:02:19
318500 -- (-1010.193) (-1005.179) (-1003.687) [-1008.845] * [-1006.097] (-1005.226) (-1005.152) (-1011.415) -- 0:02:21
319000 -- (-1010.126) [-1008.975] (-1003.889) (-1007.507) * (-1015.280) (-1004.421) (-1008.942) [-1007.040] -- 0:02:20
319500 -- (-1012.232) (-1012.199) (-1011.270) [-1005.175] * (-1007.683) (-1004.299) (-1008.421) [-1003.498] -- 0:02:20
320000 -- (-1017.167) (-1010.086) (-1005.045) [-1006.471] * [-1005.028] (-1013.798) (-1008.520) (-1007.414) -- 0:02:20
Average standard deviation of split frequencies: 0.009310
320500 -- [-1010.962] (-1004.402) (-1004.927) (-1006.062) * (-1009.641) [-1007.546] (-1015.559) (-1009.996) -- 0:02:19
321000 -- (-1008.012) (-1013.677) [-1002.177] (-1007.509) * [-1011.471] (-1008.114) (-1014.093) (-1015.652) -- 0:02:19
321500 -- [-1007.221] (-1019.481) (-1010.423) (-1009.067) * (-1011.114) (-1008.232) [-1008.547] (-1010.755) -- 0:02:19
322000 -- [-1009.026] (-1022.461) (-1015.820) (-1014.774) * [-1003.841] (-1008.167) (-1014.127) (-1017.053) -- 0:02:18
322500 -- (-1007.736) (-1009.614) (-1008.501) [-1011.556] * (-1007.115) [-1006.639] (-1007.264) (-1012.161) -- 0:02:18
323000 -- (-1009.885) (-1014.744) (-1008.139) [-1009.218] * (-1009.458) (-1007.250) (-1006.999) [-1005.104] -- 0:02:18
323500 -- [-1000.777] (-1008.559) (-1007.256) (-1008.403) * (-1015.025) [-1012.072] (-1005.262) (-1008.319) -- 0:02:20
324000 -- (-1005.386) (-1011.852) [-1004.521] (-1006.991) * [-1006.854] (-1007.283) (-1008.506) (-1010.171) -- 0:02:19
324500 -- (-1005.863) (-1014.013) (-1000.933) [-1003.941] * [-1005.112] (-1007.520) (-1003.698) (-1009.011) -- 0:02:19
325000 -- (-1006.453) [-1011.527] (-1003.329) (-1004.118) * (-1005.977) (-1004.495) [-1008.334] (-1007.325) -- 0:02:19
Average standard deviation of split frequencies: 0.009158
325500 -- (-1012.241) (-1011.122) (-1004.001) [-1005.606] * (-1004.449) (-1006.307) (-1006.284) [-1008.028] -- 0:02:18
326000 -- (-1003.888) (-1012.703) (-1008.597) [-1001.609] * [-1005.381] (-1009.174) (-1006.198) (-1013.725) -- 0:02:18
326500 -- [-1006.189] (-1013.217) (-1008.031) (-1008.589) * [-1002.799] (-1007.568) (-1004.947) (-1009.933) -- 0:02:18
327000 -- (-1012.088) (-1004.058) [-1009.739] (-1014.632) * [-1004.900] (-1005.425) (-1007.309) (-1011.567) -- 0:02:17
327500 -- (-1004.285) (-1011.571) [-1010.223] (-1019.498) * [-1003.556] (-1004.558) (-1008.266) (-1013.599) -- 0:02:17
328000 -- (-1008.142) [-1006.904] (-1010.972) (-1023.338) * (-1008.007) (-1007.317) (-1003.578) [-1004.720] -- 0:02:17
328500 -- (-1003.299) [-1009.316] (-1007.405) (-1017.116) * (-1006.180) (-1008.403) (-1006.609) [-1006.238] -- 0:02:19
329000 -- (-1011.560) [-1008.963] (-1009.577) (-1007.213) * (-1004.962) (-1004.071) [-1006.590] (-1008.918) -- 0:02:18
329500 -- (-1009.398) [-1005.716] (-1004.991) (-1010.562) * (-1018.177) [-1003.388] (-1009.457) (-1006.903) -- 0:02:18
330000 -- (-1008.988) (-1004.357) (-1005.907) [-1002.759] * (-1007.240) (-1005.048) (-1012.913) [-1006.727] -- 0:02:18
Average standard deviation of split frequencies: 0.008079
330500 -- (-1013.750) [-1010.343] (-1006.788) (-1009.410) * (-1012.700) [-1000.756] (-1007.145) (-1008.840) -- 0:02:17
331000 -- (-1011.159) (-1010.091) [-1012.693] (-1008.337) * (-1006.869) [-1002.021] (-1005.291) (-1017.352) -- 0:02:17
331500 -- [-1008.661] (-1010.300) (-1016.925) (-1006.910) * (-1006.415) (-1006.917) [-1006.648] (-1010.889) -- 0:02:17
332000 -- [-1006.686] (-1010.979) (-1010.883) (-1006.405) * (-1006.797) (-1010.960) [-1007.268] (-1010.269) -- 0:02:16
332500 -- (-1007.984) (-1013.813) [-1009.581] (-1014.042) * [-1005.325] (-1007.845) (-1015.029) (-1009.386) -- 0:02:16
333000 -- [-1004.700] (-1014.870) (-1007.968) (-1006.319) * (-1011.939) (-1006.685) (-1013.227) [-1004.274] -- 0:02:16
333500 -- (-1005.530) (-1011.767) (-1005.760) [-1009.956] * [-1010.236] (-1015.215) (-1007.749) (-1010.319) -- 0:02:17
334000 -- [-1004.561] (-1013.805) (-1008.805) (-1011.789) * [-1002.807] (-1010.723) (-1008.108) (-1005.062) -- 0:02:17
334500 -- (-1007.420) (-1008.824) [-1005.690] (-1006.424) * (-1008.163) (-1007.565) [-1006.296] (-1006.486) -- 0:02:17
335000 -- (-1007.357) [-1014.710] (-1007.179) (-1008.516) * (-1003.785) [-1007.895] (-1007.392) (-1010.749) -- 0:02:16
Average standard deviation of split frequencies: 0.008418
335500 -- [-1006.216] (-1007.827) (-1003.834) (-1013.702) * (-1006.335) (-1005.379) (-1012.572) [-1011.762] -- 0:02:16
336000 -- (-1005.325) (-1008.350) [-1004.275] (-1021.856) * (-1004.745) [-1001.640] (-1003.661) (-1014.206) -- 0:02:16
336500 -- (-1007.500) (-1005.715) [-1011.758] (-1018.255) * (-1011.402) [-1006.075] (-1013.362) (-1006.736) -- 0:02:16
337000 -- (-1009.992) (-1008.961) (-1005.386) [-1008.277] * (-1001.842) [-1005.910] (-1009.470) (-1010.537) -- 0:02:15
337500 -- [-1011.187] (-1007.643) (-1003.845) (-1006.503) * (-1004.319) (-1009.393) (-1004.329) [-1002.807] -- 0:02:15
338000 -- (-1020.289) (-1008.236) (-1001.486) [-1007.754] * (-1009.740) (-1006.527) [-1007.963] (-1002.180) -- 0:02:15
338500 -- (-1008.066) (-1014.416) [-1008.373] (-1011.552) * (-1011.604) (-1009.193) (-1020.918) [-1004.651] -- 0:02:16
339000 -- (-1005.526) [-1009.353] (-1008.821) (-1006.541) * (-1000.551) (-1003.798) [-1012.946] (-1014.877) -- 0:02:16
339500 -- (-1009.733) (-1008.678) (-1014.857) [-1006.328] * (-1007.038) (-1009.547) (-1008.455) [-1009.801] -- 0:02:16
340000 -- [-1005.979] (-1006.734) (-1008.404) (-1015.464) * (-1006.254) (-1007.453) [-1010.299] (-1012.921) -- 0:02:15
Average standard deviation of split frequencies: 0.007841
340500 -- (-1003.997) (-1008.372) (-1007.806) [-1007.215] * (-1011.415) (-1004.977) (-1004.623) [-1010.063] -- 0:02:15
341000 -- [-1005.115] (-1008.727) (-1017.039) (-1005.396) * (-1006.679) [-1005.575] (-1010.250) (-1007.708) -- 0:02:15
341500 -- (-1007.545) [-1007.729] (-1019.024) (-1000.006) * [-1006.664] (-1005.138) (-1009.823) (-1014.961) -- 0:02:14
342000 -- [-1016.935] (-1016.580) (-1011.505) (-1006.864) * (-1011.304) (-1008.392) [-1005.561] (-1008.412) -- 0:02:14
342500 -- (-1008.587) (-1014.215) (-1021.951) [-1002.984] * [-1004.551] (-1002.736) (-1017.116) (-1004.628) -- 0:02:14
343000 -- (-1006.808) [-1003.743] (-1013.026) (-1000.497) * (-1008.837) [-1002.005] (-1014.146) (-1002.993) -- 0:02:14
343500 -- (-1003.789) (-1006.693) [-1005.206] (-1003.571) * (-1007.793) (-1007.771) (-1012.573) [-1004.185] -- 0:02:15
344000 -- [-1006.383] (-1012.527) (-1012.655) (-1014.392) * (-1009.124) (-1006.061) [-1006.026] (-1011.147) -- 0:02:15
344500 -- (-1002.750) [-1007.205] (-1008.478) (-1013.219) * (-1011.309) (-1006.766) [-1012.483] (-1010.376) -- 0:02:15
345000 -- (-1003.738) [-1012.655] (-1016.334) (-1010.010) * (-1009.652) [-1011.613] (-1008.184) (-1003.634) -- 0:02:14
Average standard deviation of split frequencies: 0.008175
345500 -- [-1005.992] (-1004.827) (-1019.507) (-1008.935) * (-1010.439) (-1008.124) [-1006.359] (-1002.105) -- 0:02:14
346000 -- (-1008.236) [-1009.945] (-1018.672) (-1012.464) * (-1009.548) [-1001.007] (-1010.274) (-1006.022) -- 0:02:14
346500 -- (-1010.478) [-1005.602] (-1005.171) (-1015.017) * (-1009.553) (-1008.392) (-1010.979) [-1003.889] -- 0:02:13
347000 -- (-1008.578) (-1012.545) (-1002.871) [-1004.809] * (-1011.713) (-1004.914) [-1012.347] (-1007.594) -- 0:02:13
347500 -- (-1008.178) (-1013.095) (-1009.285) [-1016.028] * (-1011.845) (-1005.394) [-1005.519] (-1011.279) -- 0:02:13
348000 -- [-1008.632] (-1020.803) (-1001.794) (-1010.202) * [-1003.647] (-1011.573) (-1006.534) (-1003.680) -- 0:02:13
348500 -- (-1010.246) [-1002.932] (-1005.937) (-1009.743) * (-1006.807) (-1005.868) (-1010.118) [-1001.386] -- 0:02:14
349000 -- (-1004.458) (-1011.984) [-1007.730] (-1014.415) * (-1006.472) (-1003.937) (-1005.503) [-1003.555] -- 0:02:14
349500 -- (-1012.789) (-1011.321) [-1010.560] (-1008.732) * (-1006.820) (-1008.513) [-1005.107] (-1013.669) -- 0:02:14
350000 -- [-1007.393] (-1002.622) (-1007.882) (-1006.260) * (-1006.895) [-1008.058] (-1003.351) (-1009.666) -- 0:02:13
Average standard deviation of split frequencies: 0.008514
350500 -- (-1006.394) [-1009.312] (-1008.926) (-1011.152) * [-999.987] (-1006.548) (-1018.451) (-1013.529) -- 0:02:13
351000 -- (-1011.743) (-1012.148) [-1009.254] (-1003.999) * [-1002.809] (-1011.148) (-1006.971) (-1009.628) -- 0:02:13
351500 -- (-1018.702) [-1011.453] (-1009.470) (-1004.973) * (-1010.623) (-1014.697) (-1012.490) [-1008.940] -- 0:02:12
352000 -- (-1012.161) (-1007.699) [-1009.096] (-1007.386) * (-1005.185) (-1008.465) (-1010.934) [-1005.712] -- 0:02:12
352500 -- (-1008.643) (-1006.826) [-1006.209] (-1004.397) * (-1009.172) [-1014.882] (-1010.492) (-1008.750) -- 0:02:12
353000 -- (-1009.271) (-1009.107) (-1019.372) [-1005.796] * [-1006.188] (-1021.162) (-1001.935) (-1012.377) -- 0:02:11
353500 -- [-1001.247] (-1010.292) (-1005.366) (-1007.602) * (-1009.200) (-1012.559) [-1013.226] (-1009.068) -- 0:02:13
354000 -- (-1011.414) [-1008.315] (-1010.950) (-1006.261) * (-1016.490) [-1008.848] (-1010.549) (-1008.078) -- 0:02:13
354500 -- (-1005.278) [-1012.534] (-1013.546) (-1003.153) * (-1012.736) (-1006.110) (-1010.238) [-1007.715] -- 0:02:12
355000 -- (-1011.745) (-1009.696) (-1009.252) [-1010.555] * [-1007.159] (-1006.092) (-1008.858) (-1006.170) -- 0:02:12
Average standard deviation of split frequencies: 0.007504
355500 -- (-1004.199) (-1003.367) [-1009.107] (-1013.297) * (-1007.965) (-1014.748) [-1008.398] (-1009.080) -- 0:02:12
356000 -- (-1018.849) [-1000.862] (-1008.416) (-1006.854) * (-1004.430) (-1008.292) [-1006.927] (-1003.423) -- 0:02:12
356500 -- (-1012.454) (-1005.037) (-1020.719) [-1000.735] * (-1003.955) [-1008.252] (-1010.802) (-1012.624) -- 0:02:11
357000 -- (-1011.295) (-1006.287) (-1017.019) [-1002.215] * [-1004.066] (-1008.867) (-1010.631) (-1015.045) -- 0:02:11
357500 -- (-1012.137) (-1001.522) (-1010.769) [-1012.759] * [-1003.724] (-1004.727) (-1007.162) (-1019.077) -- 0:02:11
358000 -- (-1007.130) [-1001.026] (-1010.996) (-1010.857) * (-1010.664) (-1012.091) [-1005.379] (-1014.602) -- 0:02:10
358500 -- (-1004.330) (-1006.161) [-1006.902] (-1016.609) * (-1008.611) (-1009.258) [-1008.630] (-1004.314) -- 0:02:12
359000 -- (-1009.829) [-1006.596] (-1009.634) (-1011.507) * (-1016.583) (-1010.628) (-1011.880) [-1008.213] -- 0:02:12
359500 -- [-1004.717] (-1002.432) (-1008.098) (-1021.636) * [-1010.280] (-1012.138) (-1011.369) (-1004.947) -- 0:02:11
360000 -- (-1014.131) (-1008.612) [-1003.234] (-1006.924) * (-1006.460) [-1010.705] (-1007.220) (-1010.227) -- 0:02:11
Average standard deviation of split frequencies: 0.007407
360500 -- (-1004.998) (-1012.579) [-1005.588] (-1009.832) * (-1005.259) (-1009.131) [-1012.342] (-1016.128) -- 0:02:11
361000 -- (-1008.477) [-1002.548] (-1009.264) (-1007.870) * (-1005.995) (-1010.332) [-1010.412] (-1017.987) -- 0:02:10
361500 -- [-1010.323] (-1012.292) (-1001.515) (-1005.627) * [-1006.144] (-1007.511) (-1015.374) (-1011.843) -- 0:02:10
362000 -- [-1012.040] (-1012.238) (-1015.509) (-1007.322) * [-1007.893] (-1008.462) (-1015.248) (-1018.840) -- 0:02:10
362500 -- [-1009.823] (-1011.061) (-1010.068) (-1011.715) * (-1006.380) [-1008.324] (-1008.791) (-1013.507) -- 0:02:10
363000 -- (-1005.592) [-1007.305] (-1003.685) (-1006.916) * (-1013.440) (-1005.912) [-1008.122] (-1014.063) -- 0:02:09
363500 -- (-1006.497) (-1008.759) [-1007.446] (-1016.090) * (-1010.229) (-1006.941) [-1005.005] (-1013.053) -- 0:02:11
364000 -- (-1008.557) (-1014.623) (-1015.209) [-1011.807] * (-1002.983) (-1008.675) (-1009.530) [-1007.880] -- 0:02:11
364500 -- [-1005.136] (-1007.484) (-1009.938) (-1006.318) * (-1007.536) (-1014.680) [-1012.311] (-1013.407) -- 0:02:10
365000 -- [-1004.807] (-1005.792) (-1007.499) (-1008.890) * (-1014.103) (-1007.779) [-1009.935] (-1009.769) -- 0:02:10
Average standard deviation of split frequencies: 0.007299
365500 -- (-1016.419) [-1007.045] (-1012.863) (-1009.756) * (-1008.889) [-1007.666] (-1007.093) (-1013.264) -- 0:02:10
366000 -- [-1015.309] (-1008.705) (-1004.290) (-1003.429) * (-1010.710) (-1013.636) [-1009.560] (-1016.064) -- 0:02:09
366500 -- (-1012.464) [-1005.151] (-1010.291) (-1009.004) * (-1008.394) (-1010.079) [-1006.592] (-1016.440) -- 0:02:09
367000 -- (-1015.446) [-1008.415] (-1007.513) (-1006.202) * (-1006.087) [-1007.371] (-1010.463) (-1011.091) -- 0:02:09
367500 -- (-1008.916) [-1011.791] (-1006.414) (-1005.920) * (-1006.873) (-1008.101) [-1016.331] (-1010.447) -- 0:02:09
368000 -- [-1009.050] (-1008.191) (-1009.374) (-1011.563) * (-1013.006) (-1007.865) [-1006.613] (-1006.724) -- 0:02:08
368500 -- (-1011.141) (-1008.772) (-1014.275) [-1006.270] * [-1006.385] (-1006.740) (-1007.654) (-1012.026) -- 0:02:10
369000 -- (-1008.574) (-1008.958) (-1016.073) [-1010.208] * (-1011.880) [-1005.480] (-1011.215) (-1009.992) -- 0:02:09
369500 -- (-1014.063) (-1009.027) (-1010.940) [-1011.872] * (-1011.709) [-1008.005] (-1003.967) (-1006.376) -- 0:02:09
370000 -- (-1011.077) (-1011.357) [-1002.815] (-1010.142) * (-1012.717) (-1015.685) (-1009.917) [-1004.784] -- 0:02:09
Average standard deviation of split frequencies: 0.007207
370500 -- (-1014.413) (-1003.449) (-1008.641) [-1003.482] * (-1008.663) (-1005.872) [-1005.419] (-1014.134) -- 0:02:09
371000 -- (-1008.063) (-1005.965) (-1003.263) [-1003.646] * (-1005.328) (-1008.363) [-1009.649] (-1016.499) -- 0:02:08
371500 -- (-1009.223) (-1013.225) (-1010.565) [-1002.620] * [-1005.950] (-1010.929) (-1009.609) (-1008.277) -- 0:02:08
372000 -- [-1007.239] (-1003.278) (-1009.019) (-1015.639) * (-1013.367) [-1005.302] (-1003.284) (-1007.955) -- 0:02:08
372500 -- (-1009.967) (-1012.226) (-1008.135) [-1002.794] * (-1010.082) (-1008.290) [-1003.607] (-1008.378) -- 0:02:08
373000 -- [-1008.124] (-1005.569) (-1004.912) (-1007.962) * (-1004.493) (-1009.285) (-1007.244) [-1003.393] -- 0:02:07
373500 -- (-1016.250) (-1004.230) [-1000.116] (-1008.706) * (-1005.995) [-1006.114] (-1011.427) (-1008.598) -- 0:02:09
374000 -- (-1005.320) (-1005.882) (-1000.967) [-1009.340] * (-1013.071) (-1009.742) (-1004.946) [-1010.845] -- 0:02:08
374500 -- (-1003.684) [-1006.882] (-1006.173) (-1005.576) * (-1010.377) [-1006.334] (-1013.276) (-1015.526) -- 0:02:08
375000 -- (-1010.393) (-1004.116) [-1004.682] (-1007.791) * [-1009.942] (-1006.417) (-1010.373) (-1012.675) -- 0:02:08
Average standard deviation of split frequencies: 0.007105
375500 -- (-1007.280) (-1005.544) [-1004.935] (-1008.561) * (-1005.368) [-1009.415] (-1012.179) (-1014.092) -- 0:02:08
376000 -- [-1009.015] (-1007.002) (-1013.635) (-1016.078) * (-1003.338) (-1005.318) (-1017.338) [-1006.604] -- 0:02:07
376500 -- [-1008.881] (-1006.928) (-1006.258) (-1005.954) * (-1004.218) (-1002.378) (-1013.296) [-1003.356] -- 0:02:07
377000 -- (-1007.713) [-1002.887] (-1009.586) (-1008.793) * (-1009.394) (-1012.159) [-1014.416] (-1005.700) -- 0:02:07
377500 -- (-1006.873) [-1006.234] (-1015.639) (-1011.899) * (-1001.789) (-1007.357) (-1009.965) [-1005.622] -- 0:02:06
378000 -- [-1014.817] (-1008.495) (-1023.495) (-1002.988) * (-1008.559) [-1003.985] (-1011.981) (-1003.946) -- 0:02:06
378500 -- (-1002.044) (-1011.541) (-1006.345) [-1006.773] * [-1006.209] (-1006.867) (-1017.681) (-1008.591) -- 0:02:08
379000 -- (-1004.163) (-1005.183) (-1004.240) [-1003.860] * [-1007.674] (-1015.109) (-1004.730) (-1009.741) -- 0:02:07
379500 -- (-1006.146) (-1012.446) (-1006.406) [-1016.783] * [-1007.615] (-1010.360) (-1006.205) (-1004.650) -- 0:02:07
380000 -- [-1008.379] (-1014.404) (-1009.761) (-1011.278) * [-1013.994] (-1001.567) (-1004.876) (-1006.746) -- 0:02:07
Average standard deviation of split frequencies: 0.005779
380500 -- [-1008.057] (-1009.989) (-1004.208) (-1012.608) * (-1008.020) (-1015.255) [-1010.708] (-1004.713) -- 0:02:06
381000 -- [-1011.138] (-1007.052) (-1008.970) (-1023.246) * (-1005.881) (-1003.553) (-1010.225) [-1010.924] -- 0:02:06
381500 -- (-1012.859) [-1011.621] (-1013.675) (-1007.102) * (-1008.282) (-1006.509) [-1007.518] (-1006.650) -- 0:02:06
382000 -- (-1016.166) [-1005.865] (-1012.629) (-1010.157) * (-1015.649) (-1008.160) (-1006.690) [-1002.391] -- 0:02:06
382500 -- [-1010.498] (-1019.740) (-1016.119) (-1012.656) * (-1010.233) [-1004.531] (-1008.685) (-1003.369) -- 0:02:05
383000 -- (-1007.120) (-1008.452) [-1013.713] (-1004.589) * (-1012.300) (-1004.297) (-1015.424) [-1009.680] -- 0:02:05
383500 -- (-1011.744) (-1006.022) (-1012.069) [-1004.092] * (-1013.030) [-1004.357] (-1015.337) (-1009.688) -- 0:02:06
384000 -- [-1005.141] (-1005.653) (-1008.709) (-1012.044) * (-1012.840) (-1007.835) [-1015.757] (-1011.076) -- 0:02:06
384500 -- (-1003.090) (-1008.908) [-1003.425] (-1005.978) * [-1004.200] (-1011.841) (-1014.932) (-1010.241) -- 0:02:06
385000 -- [-1006.809] (-1008.761) (-1006.401) (-1007.343) * (-1012.059) [-1001.557] (-1010.826) (-1006.006) -- 0:02:06
Average standard deviation of split frequencies: 0.004478
385500 -- [-1008.774] (-1013.623) (-1007.111) (-1010.325) * (-1007.400) (-1007.699) (-1006.888) [-1002.686] -- 0:02:05
386000 -- [-1005.933] (-1006.496) (-1004.293) (-1007.865) * (-1002.977) (-1004.698) (-1009.047) [-1005.274] -- 0:02:05
386500 -- (-1005.045) (-1007.063) (-1007.826) [-1004.938] * (-1004.127) (-1009.469) (-1008.015) [-1005.470] -- 0:02:05
387000 -- (-1005.752) (-1007.755) (-1003.965) [-1002.749] * [-1008.996] (-1010.107) (-1016.673) (-1007.800) -- 0:02:05
387500 -- (-1005.304) (-1009.864) (-1008.698) [-1001.746] * [-1014.398] (-1013.457) (-1012.945) (-1010.375) -- 0:02:04
388000 -- (-1006.315) (-1010.652) [-1003.185] (-1016.730) * (-1004.880) (-1025.807) [-1005.819] (-1006.294) -- 0:02:04
388500 -- (-1011.190) [-1001.108] (-1010.382) (-1006.830) * (-1005.379) [-1015.462] (-1002.888) (-1005.393) -- 0:02:05
389000 -- (-1006.751) (-1007.347) [-1005.301] (-1007.002) * (-1006.491) (-1009.115) [-1008.721] (-1013.499) -- 0:02:05
389500 -- [-1012.086] (-1014.130) (-1008.660) (-1001.945) * (-1008.747) (-1007.885) [-1007.965] (-1008.161) -- 0:02:05
390000 -- (-1008.125) (-1013.962) (-1005.739) [-1001.524] * [-1007.681] (-1009.610) (-1006.765) (-1011.134) -- 0:02:05
Average standard deviation of split frequencies: 0.004827
390500 -- (-1012.576) (-1011.737) [-1008.024] (-1004.950) * (-1003.987) (-1009.606) [-1003.480] (-1003.832) -- 0:02:04
391000 -- (-1010.412) (-1013.801) [-1006.037] (-1002.269) * [-1007.459] (-1013.838) (-1005.240) (-1014.635) -- 0:02:04
391500 -- (-1012.664) (-1012.831) (-1006.936) [-1000.208] * (-1003.234) [-1005.924] (-1009.715) (-1006.077) -- 0:02:04
392000 -- (-1011.300) (-1011.389) [-1003.670] (-1001.029) * (-1002.077) (-1002.094) (-1012.206) [-1010.891] -- 0:02:04
392500 -- [-1006.255] (-1014.393) (-1005.439) (-1003.256) * (-1005.461) [-1004.366] (-1012.681) (-1008.852) -- 0:02:03
393000 -- (-1006.694) (-1012.400) (-1008.287) [-1005.236] * (-1011.286) (-1017.990) (-1005.893) [-1004.710] -- 0:02:03
393500 -- (-1005.502) (-1013.038) (-1001.078) [-1010.005] * (-1005.437) (-1015.135) [-1008.943] (-1010.243) -- 0:02:04
394000 -- (-1008.382) [-1013.083] (-1012.043) (-1006.236) * (-1006.295) (-1010.612) [-1011.593] (-1004.204) -- 0:02:04
394500 -- [-1001.939] (-1010.543) (-1003.181) (-1007.099) * (-1010.878) (-1009.632) (-1008.787) [-1003.412] -- 0:02:04
395000 -- (-1005.793) (-1012.265) [-1003.406] (-1020.734) * (-1010.651) (-1012.422) (-1012.737) [-1008.552] -- 0:02:04
Average standard deviation of split frequencies: 0.006349
395500 -- (-1004.384) (-1009.929) [-1006.877] (-1009.120) * (-1004.308) (-1011.039) [-1006.648] (-1006.133) -- 0:02:03
396000 -- [-1007.420] (-1006.308) (-1011.454) (-1010.707) * [-1004.272] (-1006.527) (-1008.969) (-1004.136) -- 0:02:03
396500 -- (-1009.337) (-1005.043) [-1005.878] (-1006.304) * (-1002.499) (-1006.907) [-1006.061] (-1005.237) -- 0:02:03
397000 -- (-1011.858) (-1010.072) (-1007.198) [-1005.805] * (-1003.419) (-1012.647) (-1007.856) [-1003.466] -- 0:02:03
397500 -- (-1006.436) (-1009.637) [-1005.224] (-1008.193) * (-1006.435) [-1007.214] (-1006.452) (-1006.772) -- 0:02:02
398000 -- (-1010.596) [-1006.375] (-1005.242) (-1012.101) * [-1002.576] (-1010.147) (-1007.981) (-1003.581) -- 0:02:02
398500 -- (-1007.306) (-1014.626) (-1008.173) [-1008.752] * (-1007.160) (-1006.114) [-1000.563] (-1004.936) -- 0:02:03
399000 -- (-1008.749) [-1006.098] (-1016.392) (-1006.014) * (-1012.560) (-1024.608) [-1006.741] (-1004.632) -- 0:02:03
399500 -- (-1004.342) [-1001.846] (-1006.547) (-1008.001) * [-1007.765] (-1016.638) (-1007.120) (-1007.531) -- 0:02:03
400000 -- (-1008.646) (-1009.886) (-1017.449) [-1009.267] * [-1002.914] (-1004.700) (-1012.365) (-1011.947) -- 0:02:03
Average standard deviation of split frequencies: 0.007059
400500 -- [-1003.019] (-1010.446) (-1008.522) (-1004.046) * [-1002.373] (-1014.486) (-1010.346) (-1013.717) -- 0:02:02
401000 -- (-1011.305) (-1005.332) [-1006.289] (-1006.226) * [-1005.827] (-1013.010) (-1009.451) (-1012.597) -- 0:02:02
401500 -- (-1005.517) (-1009.620) [-1005.203] (-1013.315) * (-1009.437) (-1012.277) [-1003.604] (-1001.731) -- 0:02:02
402000 -- (-1001.819) (-1008.753) (-1007.824) [-1011.879] * (-1009.069) [-1008.246] (-1006.620) (-1003.659) -- 0:02:01
402500 -- [-1011.981] (-1003.107) (-1016.187) (-1016.177) * (-1008.272) [-1008.421] (-1004.975) (-1005.429) -- 0:02:01
403000 -- (-1011.006) [-1006.241] (-1007.043) (-1010.916) * (-1005.277) [-1008.647] (-1012.209) (-1004.630) -- 0:02:01
403500 -- (-1006.073) (-1008.065) (-1014.166) [-1010.279] * (-1011.688) (-1007.750) [-1009.300] (-1008.009) -- 0:02:02
404000 -- (-1010.546) (-1009.889) (-1008.807) [-1002.061] * (-1012.713) [-1002.640] (-1008.131) (-1005.619) -- 0:02:02
404500 -- (-1014.565) [-1012.767] (-1006.118) (-1007.978) * (-1007.841) (-1005.506) [-1005.318] (-1014.800) -- 0:02:02
405000 -- (-1008.393) [-1006.964] (-1008.645) (-1005.646) * (-1008.861) [-1004.172] (-1006.921) (-1011.314) -- 0:02:01
Average standard deviation of split frequencies: 0.006193
405500 -- (-1004.798) (-1002.792) (-1010.850) [-1007.960] * [-1003.092] (-1001.842) (-1007.340) (-1005.217) -- 0:02:01
406000 -- (-1007.972) (-1007.711) [-1010.304] (-1004.330) * (-1006.583) [-1009.980] (-1009.577) (-1008.147) -- 0:02:01
406500 -- (-1007.726) (-1011.419) (-1008.200) [-1005.182] * [-1006.267] (-1011.129) (-1006.708) (-1006.437) -- 0:02:01
407000 -- [-1003.008] (-1016.468) (-1010.017) (-1003.870) * (-1012.690) (-1015.608) [-1003.517] (-1009.392) -- 0:02:00
407500 -- (-1003.178) (-1012.233) (-1008.615) [-1002.501] * (-1012.009) (-1008.432) (-1003.945) [-1008.432] -- 0:02:00
408000 -- (-1010.694) (-1014.208) [-1009.296] (-1009.447) * [-1004.482] (-1005.912) (-1013.126) (-1012.359) -- 0:02:00
408500 -- (-1003.768) [-1009.917] (-1011.226) (-1006.492) * [-1006.904] (-1008.271) (-1004.997) (-1014.749) -- 0:02:01
409000 -- [-1004.105] (-1007.503) (-1008.905) (-1009.067) * (-1004.324) (-1014.073) [-1007.202] (-1008.133) -- 0:02:01
409500 -- (-1012.436) (-1011.223) (-1008.566) [-1014.768] * [-1004.660] (-1006.979) (-1013.271) (-1008.830) -- 0:02:01
410000 -- [-1008.075] (-1003.294) (-1013.433) (-1012.152) * [-1011.613] (-1013.096) (-1008.257) (-1001.215) -- 0:02:00
Average standard deviation of split frequencies: 0.006122
410500 -- (-1012.262) (-1004.044) (-1013.592) [-1015.298] * (-1014.842) [-1013.672] (-1002.270) (-1008.558) -- 0:02:00
411000 -- [-1003.048] (-1013.341) (-1007.865) (-1011.378) * (-1009.486) (-1004.204) (-1006.719) [-1004.159] -- 0:02:00
411500 -- (-1007.974) (-1010.132) [-1010.227] (-1013.378) * (-1006.123) [-1005.995] (-1009.852) (-1005.467) -- 0:02:00
412000 -- (-1010.481) (-1006.096) (-1010.495) [-1007.504] * (-1009.421) [-1001.570] (-1007.286) (-1008.275) -- 0:01:59
412500 -- (-1016.783) (-1004.119) [-1004.548] (-1006.122) * (-1008.474) (-1010.154) [-1011.272] (-1003.299) -- 0:01:59
413000 -- (-1010.144) (-1004.153) [-1007.750] (-1010.382) * (-1005.320) (-1000.751) (-1007.267) [-1005.172] -- 0:01:59
413500 -- (-999.724) (-1005.583) (-1011.767) [-1005.666] * (-1003.773) [-1003.807] (-1012.282) (-1003.630) -- 0:02:00
414000 -- (-1006.217) (-1003.394) (-1002.020) [-1009.736] * [-1005.524] (-1005.077) (-1006.069) (-1008.431) -- 0:02:00
414500 -- (-1010.470) (-1014.862) [-1012.280] (-1012.058) * (-1010.852) [-1011.293] (-1009.551) (-1010.364) -- 0:02:00
415000 -- [-1007.377] (-1006.271) (-1016.675) (-1010.942) * (-1012.499) (-1011.323) [-1002.919] (-1004.798) -- 0:01:59
Average standard deviation of split frequencies: 0.006421
415500 -- (-1002.034) [-1005.633] (-1004.905) (-1007.219) * (-1011.784) (-1012.111) [-1004.639] (-1018.378) -- 0:01:59
416000 -- (-1006.826) (-1002.888) (-1008.184) [-1005.960] * (-1005.446) (-1005.371) [-1003.941] (-1015.995) -- 0:01:59
416500 -- [-1006.022] (-1006.154) (-1009.923) (-1007.959) * (-1007.360) [-1003.146] (-1009.590) (-1011.375) -- 0:01:59
417000 -- [-1007.162] (-1012.311) (-1011.013) (-1012.452) * (-1007.884) (-1010.381) [-1005.662] (-1013.786) -- 0:01:58
417500 -- [-1008.206] (-1009.476) (-1011.584) (-1010.665) * (-1006.109) [-1013.160] (-1007.089) (-1009.945) -- 0:01:58
418000 -- (-1008.862) (-1005.884) (-1006.104) [-1011.960] * [-1013.196] (-1008.461) (-1005.381) (-1002.545) -- 0:01:58
418500 -- (-1012.226) [-1006.495] (-1007.810) (-1015.548) * (-1009.454) (-1006.201) (-1008.772) [-1011.711] -- 0:01:59
419000 -- (-1007.160) [-1004.060] (-1012.196) (-1001.393) * (-1011.189) (-1010.764) [-1004.887] (-1008.413) -- 0:01:59
419500 -- [-1006.979] (-1007.460) (-1011.395) (-1011.304) * (-1012.442) (-1001.955) (-1010.750) [-1011.332] -- 0:01:59
420000 -- (-1000.813) (-1005.427) (-1010.789) [-1011.554] * (-1009.337) (-1009.603) [-1005.469] (-1011.254) -- 0:01:58
Average standard deviation of split frequencies: 0.005977
420500 -- [-1004.065] (-1000.508) (-1006.883) (-1009.541) * (-1009.451) (-1009.328) [-1006.928] (-1013.089) -- 0:01:58
421000 -- [-1011.813] (-1006.553) (-1004.183) (-1013.476) * (-1011.858) (-1016.421) (-1008.225) [-1007.580] -- 0:01:58
421500 -- [-1003.524] (-1012.716) (-1006.867) (-1010.138) * [-1002.450] (-1008.666) (-1006.894) (-1010.534) -- 0:01:58
422000 -- (-1007.200) (-1020.400) [-1010.566] (-1009.212) * (-1013.912) [-1007.636] (-1012.165) (-1011.087) -- 0:01:57
422500 -- [-1002.526] (-1012.870) (-1012.785) (-1007.371) * (-1011.665) [-1007.779] (-1009.680) (-1008.937) -- 0:01:57
423000 -- (-1010.156) (-1013.412) (-1005.638) [-1007.367] * [-1007.151] (-1006.776) (-1007.332) (-1005.848) -- 0:01:57
423500 -- (-1007.324) [-1007.270] (-1013.852) (-1003.136) * (-1006.738) [-1003.208] (-1012.279) (-1008.852) -- 0:01:58
424000 -- [-1006.682] (-1008.145) (-1011.512) (-1013.861) * (-1003.571) (-1009.525) (-1008.303) [-1003.667] -- 0:01:58
424500 -- [-1004.862] (-1011.616) (-1008.327) (-1005.116) * [-1006.686] (-1008.809) (-1017.333) (-1016.777) -- 0:01:57
425000 -- (-1007.553) (-1016.306) (-1004.473) [-1007.889] * (-1015.024) (-1008.250) [-1012.093] (-1008.594) -- 0:01:57
Average standard deviation of split frequencies: 0.005533
425500 -- (-1010.158) (-1013.602) [-1003.001] (-1005.551) * (-1006.578) [-1004.484] (-1011.726) (-999.780) -- 0:01:57
426000 -- [-1006.227] (-1008.717) (-1006.771) (-1018.100) * (-1008.755) [-1010.428] (-1008.097) (-1001.398) -- 0:01:57
426500 -- (-1010.027) (-1018.532) (-1011.021) [-1003.073] * (-1001.996) (-1006.525) (-1012.407) [-1010.907] -- 0:01:56
427000 -- (-1006.127) (-1016.095) [-1010.191] (-1010.289) * (-1005.744) (-1007.638) [-1010.127] (-1005.949) -- 0:01:56
427500 -- [-1004.735] (-1014.257) (-1004.253) (-1004.557) * (-1015.903) [-1008.546] (-1008.605) (-1003.676) -- 0:01:56
428000 -- (-1008.995) (-1010.262) (-1013.657) [-1004.092] * (-1007.889) [-1008.557] (-1010.571) (-1011.491) -- 0:01:56
428500 -- (-1006.129) [-1013.535] (-1004.272) (-1006.094) * (-1017.271) [-1002.621] (-1017.140) (-1009.506) -- 0:01:56
429000 -- [-1007.466] (-1008.414) (-1006.472) (-1009.474) * (-1016.355) (-1009.920) (-1004.404) [-1011.996] -- 0:01:57
429500 -- (-1007.692) [-1004.513] (-1009.565) (-1010.790) * (-1018.588) (-1008.838) (-1003.758) [-1002.998] -- 0:01:56
430000 -- (-1007.613) [-1006.973] (-1006.597) (-1006.377) * (-1012.262) (-1008.066) (-1006.874) [-1008.776] -- 0:01:56
Average standard deviation of split frequencies: 0.007297
430500 -- (-1007.847) [-1004.614] (-1007.778) (-1007.581) * (-1008.297) [-1003.959] (-1008.225) (-1010.481) -- 0:01:56
431000 -- (-1007.254) (-1010.463) (-1012.247) [-1004.868] * (-1013.951) (-1003.057) (-1003.500) [-1007.926] -- 0:01:56
431500 -- (-1007.983) (-1005.357) (-1003.648) [-1012.581] * (-1016.574) (-1005.592) [-1006.709] (-1003.642) -- 0:01:55
432000 -- (-1009.542) (-1005.215) (-1011.856) [-1003.637] * (-1003.072) [-1005.681] (-1012.671) (-1010.969) -- 0:01:55
432500 -- [-999.403] (-1008.560) (-1002.360) (-1012.986) * (-1008.903) (-1009.349) (-1010.369) [-1010.575] -- 0:01:55
433000 -- (-1009.761) (-1010.711) [-1002.670] (-1007.577) * (-1010.593) [-1012.921] (-1014.599) (-1011.786) -- 0:01:55
433500 -- (-1005.443) (-1011.152) [-1004.112] (-1008.466) * [-1005.775] (-1008.436) (-1011.212) (-1011.320) -- 0:01:54
434000 -- (-1005.450) (-1009.849) [-1008.228] (-1008.118) * (-1008.388) [-1002.840] (-1006.658) (-1005.762) -- 0:01:56
434500 -- (-1003.885) [-1004.012] (-1010.075) (-1007.292) * (-1007.557) (-1014.075) (-1016.313) [-1004.389] -- 0:01:55
435000 -- (-1011.092) [-1006.384] (-1009.263) (-1011.890) * (-1007.947) (-1005.182) [-1005.242] (-1009.053) -- 0:01:55
Average standard deviation of split frequencies: 0.008289
435500 -- (-1011.286) [-1007.098] (-1003.187) (-1009.594) * (-1010.872) (-1015.819) [-1004.538] (-1014.415) -- 0:01:55
436000 -- (-1006.944) [-1009.056] (-1005.908) (-1006.884) * (-1009.089) (-1006.867) (-1012.562) [-1004.579] -- 0:01:55
436500 -- (-1011.974) (-1004.766) (-1005.648) [-1009.509] * [-1011.655] (-1004.846) (-1012.588) (-1003.674) -- 0:01:54
437000 -- (-1002.830) (-1010.048) (-1006.871) [-1003.118] * (-1001.202) (-1004.694) [-1005.789] (-1013.797) -- 0:01:54
437500 -- [-1010.493] (-1012.247) (-1008.592) (-1000.971) * (-1007.362) (-1006.434) [-1013.273] (-1013.833) -- 0:01:54
438000 -- (-1012.184) (-1008.216) [-1006.443] (-1003.114) * (-1005.403) [-1010.751] (-1006.745) (-1007.838) -- 0:01:54
438500 -- (-1007.864) (-1006.331) (-1005.134) [-1012.685] * [-1012.078] (-1010.308) (-1009.886) (-1007.776) -- 0:01:53
439000 -- (-1004.128) (-1006.850) [-1006.179] (-1008.669) * [-1002.523] (-1009.380) (-1015.241) (-1010.555) -- 0:01:55
439500 -- (-1004.227) [-1004.939] (-1005.934) (-1010.806) * [-1004.237] (-1016.174) (-1007.482) (-1012.040) -- 0:01:54
440000 -- (-1002.093) (-1005.908) (-1003.864) [-1004.679] * (-1008.697) [-1016.710] (-1016.313) (-1003.329) -- 0:01:54
Average standard deviation of split frequencies: 0.009271
440500 -- (-1009.944) (-1009.230) [-1007.579] (-1014.362) * (-1005.193) (-1008.029) [-1005.683] (-1008.520) -- 0:01:54
441000 -- [-1002.099] (-1006.296) (-1012.546) (-1005.631) * [-1016.708] (-1011.196) (-1009.584) (-1008.292) -- 0:01:54
441500 -- (-1015.456) (-1002.652) [-1006.840] (-1010.253) * (-1005.028) (-1008.560) [-1009.818] (-1008.729) -- 0:01:53
442000 -- (-1009.982) (-1005.537) [-1008.356] (-1019.267) * (-1012.302) [-1005.563] (-1011.886) (-1006.655) -- 0:01:53
442500 -- (-1015.726) (-1010.283) [-1004.751] (-1007.971) * (-1010.386) (-1014.928) (-1014.784) [-1005.260] -- 0:01:53
443000 -- (-1009.279) (-1006.650) [-1002.618] (-1019.507) * (-1016.978) [-1003.801] (-1008.130) (-1003.462) -- 0:01:53
443500 -- (-1011.932) (-1007.832) [-1011.657] (-1008.947) * (-1015.370) (-1008.412) [-1008.389] (-1007.284) -- 0:01:52
444000 -- (-1006.512) (-1005.429) (-1010.756) [-1013.145] * (-1008.829) (-1008.803) (-1002.059) [-1018.038] -- 0:01:53
444500 -- (-1014.425) (-1007.504) [-1003.761] (-1012.427) * [-1008.984] (-1007.165) (-1003.798) (-1008.139) -- 0:01:53
445000 -- (-1011.293) (-1005.843) [-1003.508] (-1009.476) * (-1010.920) (-1011.600) (-1008.514) [-1007.284] -- 0:01:53
Average standard deviation of split frequencies: 0.008808
445500 -- (-1017.649) (-1010.821) (-1005.447) [-1015.168] * (-1008.979) (-1010.677) [-1005.865] (-1007.412) -- 0:01:53
446000 -- [-1007.236] (-1010.903) (-1009.925) (-1017.549) * (-1009.878) (-1012.496) (-1011.822) [-1005.366] -- 0:01:53
446500 -- (-1011.003) [-1012.661] (-1019.611) (-1013.209) * (-1005.995) (-1007.967) [-1004.751] (-1006.251) -- 0:01:52
447000 -- (-1002.275) (-1001.269) (-1010.412) [-1006.259] * (-1016.759) [-1009.691] (-1007.316) (-1012.537) -- 0:01:52
447500 -- (-1007.005) [-1005.910] (-1010.322) (-1004.867) * (-1006.597) (-1007.143) (-1002.135) [-1013.634] -- 0:01:52
448000 -- (-1011.670) (-1017.444) (-1014.383) [-1011.227] * [-1003.787] (-1008.790) (-1002.477) (-1017.913) -- 0:01:52
448500 -- (-1007.224) [-1002.439] (-1011.354) (-1010.676) * (-1009.705) (-1010.826) [-1003.520] (-1008.765) -- 0:01:51
449000 -- (-1005.614) [-1007.894] (-1014.080) (-1009.301) * [-1005.060] (-1006.266) (-1008.606) (-1005.887) -- 0:01:52
449500 -- [-1003.286] (-1012.550) (-1020.352) (-1010.974) * (-1005.554) (-1009.463) (-1003.943) [-1006.982] -- 0:01:52
450000 -- (-1008.660) (-1011.583) (-1017.734) [-1009.424] * [-1007.787] (-1011.503) (-1005.478) (-1017.506) -- 0:01:52
Average standard deviation of split frequencies: 0.008368
450500 -- (-1006.264) (-1016.502) (-1007.265) [-1014.539] * [-1005.183] (-1016.441) (-1004.006) (-1010.292) -- 0:01:52
451000 -- (-1009.007) (-1009.208) [-1003.039] (-1015.342) * (-1011.126) (-1015.282) (-1009.804) [-1003.662] -- 0:01:51
451500 -- (-999.520) [-1013.092] (-1001.249) (-1013.983) * [-1004.044] (-1011.562) (-1004.967) (-1006.710) -- 0:01:51
452000 -- (-1011.221) (-1010.497) [-1002.905] (-1007.858) * (-1006.731) [-1007.019] (-1008.026) (-1003.946) -- 0:01:51
452500 -- (-1006.237) [-1004.685] (-1005.286) (-1008.448) * (-1004.381) (-1010.852) (-1008.068) [-1002.690] -- 0:01:51
453000 -- (-1011.377) [-1008.777] (-1006.708) (-1016.614) * (-1008.977) (-1012.764) [-1005.615] (-1012.995) -- 0:01:51
453500 -- [-1004.865] (-1005.331) (-1004.115) (-1011.244) * (-1007.725) (-1002.862) (-1008.560) [-1005.307] -- 0:01:50
454000 -- (-1004.014) [-1007.385] (-1001.512) (-1011.293) * [-1009.858] (-1005.733) (-1008.289) (-1010.129) -- 0:01:51
454500 -- [-1001.717] (-1005.761) (-1009.102) (-1006.802) * [-1007.830] (-1014.299) (-1009.496) (-1010.909) -- 0:01:51
455000 -- [-1007.807] (-1000.831) (-1008.455) (-1011.614) * (-1007.650) (-1010.592) (-1002.943) [-1002.722] -- 0:01:51
Average standard deviation of split frequencies: 0.007926
455500 -- (-1002.605) (-1013.256) (-1007.459) [-1009.646] * (-1005.819) (-1005.581) [-1009.050] (-1005.926) -- 0:01:51
456000 -- [-1008.415] (-1002.800) (-1002.574) (-1002.509) * (-1005.805) (-1012.723) (-1005.878) [-1004.914] -- 0:01:50
456500 -- (-1001.683) (-1003.450) [-1002.528] (-1015.236) * (-1012.097) (-1007.168) (-1012.623) [-1008.031] -- 0:01:50
457000 -- [-1005.584] (-1001.984) (-1003.744) (-1009.692) * [-1007.666] (-1005.185) (-1002.217) (-1006.903) -- 0:01:50
457500 -- [-1004.265] (-1003.710) (-1007.083) (-1002.265) * (-1009.898) (-1018.705) [-1004.252] (-1008.851) -- 0:01:50
458000 -- (-1005.303) [-1006.283] (-1009.066) (-1008.559) * (-1005.617) (-1007.895) [-1007.453] (-1008.049) -- 0:01:50
458500 -- (-1009.975) [-1003.119] (-1007.467) (-1006.391) * [-1008.665] (-1007.772) (-1008.150) (-1007.683) -- 0:01:49
459000 -- [-1011.713] (-1004.602) (-1009.935) (-1007.654) * (-1002.273) (-1006.534) [-1004.107] (-1014.191) -- 0:01:50
459500 -- (-1001.495) (-1012.478) (-1013.519) [-1009.060] * (-1010.904) (-1007.775) [-1008.142] (-1012.417) -- 0:01:50
460000 -- (-1007.771) (-1008.341) [-1007.900] (-1008.299) * (-1007.464) (-1011.093) [-1006.622] (-1008.793) -- 0:01:50
Average standard deviation of split frequencies: 0.007845
460500 -- (-1005.409) (-1008.780) [-1003.876] (-1006.307) * (-1007.444) (-1011.179) [-1004.972] (-1009.991) -- 0:01:50
461000 -- [-1008.042] (-1005.212) (-1011.328) (-1007.652) * [-1004.517] (-1010.404) (-1009.275) (-1008.347) -- 0:01:49
461500 -- [-1008.353] (-1008.653) (-1012.352) (-1011.586) * (-1007.218) (-1009.993) [-1017.036] (-1010.804) -- 0:01:49
462000 -- [-1002.354] (-1004.929) (-1016.069) (-1013.942) * [-1005.801] (-1019.630) (-1016.360) (-1006.340) -- 0:01:49
462500 -- (-1005.885) (-1006.333) [-1007.471] (-1008.471) * [-1016.192] (-1017.822) (-1008.414) (-1011.780) -- 0:01:49
463000 -- (-1013.301) [-1004.539] (-1005.655) (-1004.909) * (-1010.916) (-1010.330) (-1005.598) [-1006.992] -- 0:01:49
463500 -- [-1008.403] (-1005.156) (-1006.752) (-1014.840) * (-1008.968) (-1013.827) (-1010.897) [-1004.674] -- 0:01:48
464000 -- (-1008.301) (-1012.443) [-1003.057] (-1009.549) * [-1014.188] (-1002.689) (-1005.739) (-1002.103) -- 0:01:49
464500 -- (-1010.011) (-1017.426) [-1005.644] (-1003.519) * (-1007.509) (-1008.878) [-1007.308] (-1010.932) -- 0:01:49
465000 -- [-1005.497] (-1006.175) (-1012.160) (-1008.977) * (-1012.769) [-1003.638] (-1007.250) (-1004.802) -- 0:01:49
Average standard deviation of split frequencies: 0.008767
465500 -- (-1005.389) (-1009.789) [-1000.438] (-1008.492) * (-1010.313) [-1003.381] (-1009.302) (-1009.455) -- 0:01:49
466000 -- [-1003.504] (-1002.291) (-1003.327) (-1010.822) * (-1010.872) (-1005.740) [-1011.700] (-1009.119) -- 0:01:48
466500 -- [-1006.742] (-1007.795) (-1010.999) (-1003.106) * (-1019.551) (-1004.136) (-1008.700) [-1010.780] -- 0:01:48
467000 -- (-1006.805) (-1015.381) [-1003.240] (-1006.093) * (-1009.211) [-1005.955] (-1011.328) (-1014.769) -- 0:01:48
467500 -- [-1002.897] (-1011.514) (-1018.132) (-1007.220) * (-1005.160) (-1008.589) [-1005.402] (-1016.488) -- 0:01:48
468000 -- (-1005.871) (-1009.034) (-1004.309) [-1002.754] * (-1009.924) (-1007.682) [-1010.485] (-1013.868) -- 0:01:47
468500 -- (-1008.508) (-1005.938) [-1007.130] (-1002.157) * (-1018.056) [-1007.954] (-1002.299) (-1011.420) -- 0:01:47
469000 -- (-1004.259) (-1014.038) [-1007.803] (-1007.369) * (-1002.920) [-1005.797] (-1008.322) (-1015.871) -- 0:01:48
469500 -- (-1008.577) (-1005.115) (-1012.828) [-1003.552] * (-1003.321) [-1010.310] (-1006.880) (-1008.878) -- 0:01:48
470000 -- (-1009.277) [-1007.123] (-1005.489) (-1012.036) * (-1015.123) (-1010.449) (-1005.869) [-1008.856] -- 0:01:48
Average standard deviation of split frequencies: 0.008680
470500 -- (-1013.630) (-1016.650) [-1009.854] (-1005.072) * (-1010.916) (-1011.886) (-1006.058) [-1008.941] -- 0:01:48
471000 -- (-1010.558) [-1004.555] (-1022.620) (-1010.914) * [-1009.815] (-1006.186) (-1005.527) (-1017.188) -- 0:01:47
471500 -- (-1009.486) (-1007.687) [-1006.360] (-1012.369) * (-1009.515) (-1006.136) (-1010.879) [-1008.026] -- 0:01:47
472000 -- (-1012.326) (-1009.429) [-1008.260] (-1007.074) * [-1008.884] (-1014.593) (-1009.684) (-1016.199) -- 0:01:47
472500 -- (-1001.771) (-1011.486) [-1011.459] (-1005.934) * [-1013.521] (-1017.456) (-1011.260) (-1014.991) -- 0:01:47
473000 -- [-1009.292] (-1009.768) (-1005.027) (-1005.951) * [-1017.117] (-1008.273) (-1007.943) (-1010.480) -- 0:01:46
473500 -- (-1003.483) [-1009.182] (-1004.530) (-1003.473) * (-1005.844) (-1007.518) [-1007.280] (-1004.254) -- 0:01:46
474000 -- [-1004.424] (-1003.272) (-1009.095) (-1002.911) * (-1015.495) (-1006.275) [-1001.566] (-1014.130) -- 0:01:46
474500 -- (-1011.162) (-1006.264) [-1005.791] (-1012.593) * [-1008.633] (-1010.080) (-1006.113) (-1005.646) -- 0:01:47
475000 -- [-1011.199] (-1007.649) (-1025.761) (-1004.093) * (-1012.643) (-1003.817) (-1015.929) [-1004.682] -- 0:01:47
Average standard deviation of split frequencies: 0.008253
475500 -- (-1019.785) (-1009.877) (-1015.172) [-1006.140] * (-1003.213) (-1011.915) (-1009.889) [-1008.792] -- 0:01:46
476000 -- (-1011.940) (-1010.290) [-1007.690] (-1005.849) * [-1007.065] (-1007.694) (-1006.354) (-1008.067) -- 0:01:46
476500 -- (-1001.552) [-1014.488] (-1006.909) (-1013.072) * [-1007.021] (-1004.055) (-1006.550) (-1019.836) -- 0:01:46
477000 -- [-1009.137] (-1013.131) (-1006.818) (-1007.480) * (-1013.508) (-1008.663) [-1004.467] (-1008.837) -- 0:01:46
477500 -- (-1002.035) (-1010.149) (-1010.944) [-1007.047] * [-1008.454] (-1010.273) (-1011.622) (-1011.331) -- 0:01:46
478000 -- (-1008.665) [-1008.649] (-1009.700) (-1011.760) * [-1010.600] (-1017.044) (-1005.251) (-1007.994) -- 0:01:45
478500 -- (-1008.773) (-1005.921) [-1009.574] (-1009.707) * [-1005.511] (-1006.143) (-1008.524) (-1007.816) -- 0:01:45
479000 -- (-1010.910) (-1005.847) [-1005.905] (-1003.147) * (-1010.526) (-1013.643) (-1014.269) [-1013.492] -- 0:01:46
479500 -- (-1016.121) (-1009.533) (-1007.668) [-1008.178] * (-1009.790) [-1009.817] (-1005.723) (-1019.561) -- 0:01:46
480000 -- (-1003.854) (-1005.369) (-1012.699) [-1006.068] * (-1016.426) (-1004.904) [-1007.241] (-1008.375) -- 0:01:46
Average standard deviation of split frequencies: 0.007519
480500 -- (-1007.294) (-1014.827) (-1014.146) [-1007.769] * (-1009.636) [-1005.373] (-1007.641) (-1005.788) -- 0:01:45
481000 -- [-1004.383] (-1011.563) (-1005.337) (-1006.600) * (-1007.675) [-1005.666] (-1007.830) (-1010.835) -- 0:01:45
481500 -- (-1006.345) (-1019.094) (-1012.752) [-1004.038] * (-1008.930) (-1008.007) (-1005.072) [-1005.470] -- 0:01:45
482000 -- [-1010.370] (-1002.489) (-1005.841) (-1013.560) * [-1004.090] (-1010.987) (-1010.380) (-1012.619) -- 0:01:45
482500 -- [-1010.348] (-1012.132) (-1008.317) (-1011.667) * [-1013.313] (-1010.044) (-1003.590) (-1002.959) -- 0:01:45
483000 -- [-1007.657] (-1008.822) (-1008.608) (-1011.062) * (-1008.541) [-1004.441] (-1011.903) (-1004.727) -- 0:01:44
483500 -- [-1006.322] (-1011.109) (-1007.888) (-1003.230) * [-1010.092] (-1008.158) (-1007.269) (-1005.102) -- 0:01:44
484000 -- (-1008.016) (-1014.432) (-1014.394) [-1005.107] * (-1007.055) (-1007.471) (-1005.317) [-1005.434] -- 0:01:44
484500 -- (-1009.282) (-1009.256) (-1013.628) [-1008.970] * (-1011.100) (-1006.176) [-1006.479] (-1011.641) -- 0:01:45
485000 -- (-1004.656) (-1005.217) [-1006.103] (-1005.738) * (-1014.148) (-1004.880) (-1006.573) [-1003.358] -- 0:01:45
Average standard deviation of split frequencies: 0.006790
485500 -- [-1008.860] (-1011.740) (-1011.118) (-1016.292) * (-1014.160) (-1014.322) [-1007.236] (-1010.245) -- 0:01:44
486000 -- (-1010.508) [-1006.533] (-1009.388) (-1013.977) * (-1006.291) (-1005.723) (-1005.529) [-1006.829] -- 0:01:44
486500 -- (-1010.632) (-1009.388) [-1009.019] (-1006.798) * (-1002.358) (-1007.657) [-1012.447] (-1012.090) -- 0:01:44
487000 -- (-1022.508) [-1006.744] (-1005.762) (-1008.748) * (-1005.184) (-1007.879) (-1010.942) [-1010.332] -- 0:01:44
487500 -- (-1011.695) [-1009.984] (-1007.540) (-1009.008) * (-1009.887) (-1010.919) [-1001.753] (-1008.773) -- 0:01:44
488000 -- (-1010.358) (-1008.110) (-1011.132) [-1008.865] * (-1004.745) (-1004.754) [-1006.732] (-1016.629) -- 0:01:43
488500 -- (-1010.326) [-1001.349] (-1003.846) (-1007.702) * (-1009.398) (-1007.843) [-1005.055] (-1011.435) -- 0:01:43
489000 -- [-1008.378] (-1009.728) (-1007.928) (-1006.546) * (-1016.857) (-1013.817) [-1015.046] (-1010.864) -- 0:01:43
489500 -- [-1007.102] (-1019.142) (-1010.081) (-1003.327) * (-1008.414) (-1006.334) [-1010.747] (-1008.214) -- 0:01:44
490000 -- (-1009.606) (-1011.154) [-1007.497] (-1005.434) * [-1005.524] (-1007.888) (-1006.183) (-1011.315) -- 0:01:44
Average standard deviation of split frequencies: 0.007045
490500 -- (-1006.879) (-1005.285) [-1007.034] (-1010.943) * (-1010.131) [-1007.466] (-1007.608) (-1002.537) -- 0:01:43
491000 -- (-1006.345) (-1013.316) (-1010.607) [-1006.366] * (-1011.066) (-1006.868) [-1005.129] (-1006.845) -- 0:01:43
491500 -- (-1004.814) [-1009.023] (-1009.121) (-1004.930) * (-1002.253) [-1007.394] (-1009.606) (-1011.731) -- 0:01:43
492000 -- [-1008.187] (-1012.607) (-1006.273) (-1004.775) * [-1003.660] (-1012.093) (-1007.615) (-1009.962) -- 0:01:43
492500 -- (-1005.614) (-1009.330) (-1010.447) [-1012.472] * (-1004.005) (-1006.967) (-1006.456) [-1003.473] -- 0:01:43
493000 -- (-1007.303) (-1013.766) (-1011.261) [-1004.626] * (-1005.145) (-1008.245) (-1012.542) [-1005.263] -- 0:01:42
493500 -- (-1013.672) [-1002.424] (-1012.472) (-1004.991) * [-1009.326] (-1007.745) (-1014.440) (-1006.909) -- 0:01:42
494000 -- (-1005.235) [-1007.366] (-1005.776) (-1009.031) * [-1003.707] (-1009.228) (-1023.968) (-1009.465) -- 0:01:42
494500 -- (-1005.717) (-1009.840) [-1010.338] (-1012.293) * (-1003.094) (-1005.464) (-1002.933) [-1004.003] -- 0:01:43
495000 -- (-1009.813) (-1008.282) (-1020.749) [-1012.111] * [-1004.065] (-1004.089) (-1009.508) (-1008.832) -- 0:01:43
Average standard deviation of split frequencies: 0.006653
495500 -- (-1007.632) [-1008.531] (-1002.974) (-1012.605) * (-1007.263) [-1008.609] (-1002.021) (-1003.751) -- 0:01:42
496000 -- (-1004.171) (-1010.083) (-1007.644) [-1005.388] * (-1007.923) [-1000.951] (-1006.853) (-1001.095) -- 0:01:42
496500 -- (-1008.467) [-1002.576] (-1010.783) (-1010.060) * (-1011.253) [-1002.720] (-1007.228) (-1008.570) -- 0:01:42
497000 -- (-1008.887) [-1005.772] (-1008.711) (-1009.768) * [-1004.457] (-1002.803) (-1001.901) (-1010.125) -- 0:01:42
497500 -- (-1010.572) [-1006.686] (-1004.040) (-1013.718) * [-1001.441] (-1010.120) (-1006.781) (-1007.974) -- 0:01:42
498000 -- [-1000.245] (-1006.413) (-1009.603) (-1011.281) * [-1005.010] (-1008.851) (-1003.126) (-1007.205) -- 0:01:41
498500 -- (-1009.253) [-1006.188] (-1010.730) (-1005.920) * (-1006.097) (-1011.886) [-1004.612] (-1006.045) -- 0:01:41
499000 -- (-1012.431) [-1004.197] (-1008.974) (-1008.216) * (-1006.984) (-1010.104) [-1006.349] (-1014.420) -- 0:01:41
499500 -- [-1008.313] (-1006.635) (-1006.437) (-1007.326) * (-1002.731) [-1006.442] (-1007.985) (-1015.007) -- 0:01:42
500000 -- (-1009.310) (-1005.753) [-1006.321] (-1006.491) * (-1003.817) (-1007.053) (-1010.515) [-1017.499] -- 0:01:42
Average standard deviation of split frequencies: 0.005963
500500 -- (-1007.192) (-1005.607) (-1003.545) [-1010.736] * (-1004.486) (-1004.125) (-1010.529) [-1004.688] -- 0:01:41
501000 -- (-1012.430) [-1000.654] (-1000.934) (-1006.466) * (-1008.602) [-1004.944] (-1015.100) (-1002.626) -- 0:01:41
501500 -- [-1006.255] (-1005.575) (-1015.218) (-1010.630) * [-1007.837] (-1008.822) (-1004.960) (-1010.627) -- 0:01:41
502000 -- [-1003.383] (-1007.960) (-1013.024) (-1007.333) * (-1005.193) [-1002.843] (-1006.285) (-1011.158) -- 0:01:41
502500 -- (-1007.899) [-1014.619] (-1007.079) (-1008.563) * (-1013.963) [-1004.418] (-1006.542) (-1011.712) -- 0:01:40
503000 -- (-1005.990) (-1004.350) (-1007.009) [-1001.377] * (-1008.488) (-1002.972) (-1012.247) [-1011.883] -- 0:01:40
503500 -- (-1008.866) [-1005.500] (-1006.923) (-1010.483) * (-1009.984) [-1004.075] (-1010.694) (-1012.836) -- 0:01:40
504000 -- (-1016.100) (-1008.145) [-1008.521] (-1005.232) * (-1007.408) (-1010.810) [-1003.664] (-1011.755) -- 0:01:40
504500 -- (-1009.512) (-1003.380) (-1010.352) [-1005.502] * (-1013.889) [-1009.422] (-1005.689) (-1011.909) -- 0:01:41
505000 -- (-1018.692) (-1006.425) (-1005.208) [-1001.306] * (-1010.305) [-1007.317] (-1011.205) (-1004.545) -- 0:01:40
Average standard deviation of split frequencies: 0.006521
505500 -- (-1016.039) (-1005.068) [-1000.063] (-1013.189) * (-1003.011) (-1013.750) [-1016.015] (-1004.256) -- 0:01:40
506000 -- (-1007.210) (-1016.637) (-1003.712) [-1002.091] * (-1004.005) (-1005.292) (-1017.156) [-1008.240] -- 0:01:40
506500 -- [-1007.999] (-1004.494) (-1006.692) (-1005.154) * (-1006.946) (-1011.591) (-1017.764) [-1006.498] -- 0:01:40
507000 -- [-1007.716] (-1003.137) (-1010.417) (-1012.871) * (-1003.829) [-1010.107] (-1014.701) (-1012.873) -- 0:01:40
507500 -- (-1004.143) [-1003.501] (-1014.075) (-1009.403) * [-1003.509] (-1004.803) (-1008.182) (-1010.552) -- 0:01:39
508000 -- [-1010.064] (-1004.784) (-1003.411) (-1004.551) * (-1002.577) (-1010.248) (-1006.887) [-1006.652] -- 0:01:39
508500 -- (-1007.766) (-1009.901) [-1007.280] (-1007.469) * (-1008.459) [-1005.604] (-1009.304) (-1003.280) -- 0:01:39
509000 -- (-1004.024) [-1006.163] (-1004.226) (-1011.844) * (-1002.944) (-1009.926) (-1008.299) [-1004.954] -- 0:01:39
509500 -- (-1007.641) (-1014.088) [-1014.255] (-1010.520) * (-1004.425) (-1007.387) [-1002.663] (-1004.575) -- 0:01:40
510000 -- [-1012.518] (-1006.999) (-1019.024) (-1012.033) * (-1002.491) [-1003.800] (-1010.938) (-1009.805) -- 0:01:39
Average standard deviation of split frequencies: 0.006770
510500 -- [-1010.123] (-1015.640) (-1011.396) (-1015.614) * (-1010.754) (-1011.313) (-1008.527) [-1005.219] -- 0:01:39
511000 -- (-1005.651) (-1011.487) (-1015.654) [-1005.485] * (-1007.535) [-1011.663] (-1016.844) (-1004.508) -- 0:01:39
511500 -- [-1007.122] (-1017.787) (-1013.633) (-1007.490) * [-1011.240] (-1009.955) (-1008.906) (-1004.552) -- 0:01:39
512000 -- (-1003.699) (-1007.219) [-1005.621] (-1005.612) * (-1002.727) [-1008.016] (-1009.152) (-1016.373) -- 0:01:39
512500 -- (-1002.218) (-1002.007) [-1007.900] (-1020.074) * (-1005.556) (-1011.807) (-1004.176) [-1004.572] -- 0:01:38
513000 -- (-1006.854) (-1006.489) (-1007.441) [-1009.470] * (-1008.853) [-1006.838] (-1007.709) (-1008.113) -- 0:01:38
513500 -- (-1004.452) [-1012.097] (-1009.839) (-1018.903) * (-1013.178) (-1007.917) [-1005.539] (-1005.481) -- 0:01:38
514000 -- (-1005.305) (-1007.187) [-1003.779] (-1011.628) * [-1003.596] (-1009.420) (-1004.890) (-1014.171) -- 0:01:38
514500 -- [-1005.004] (-1007.880) (-1001.340) (-1008.141) * (-1000.157) (-1008.966) [-1004.954] (-1003.029) -- 0:01:39
515000 -- (-1006.479) (-1008.629) [-1008.538] (-1014.369) * (-1009.606) [-1006.595] (-1013.039) (-1004.907) -- 0:01:38
Average standard deviation of split frequencies: 0.007613
515500 -- (-1012.354) (-1016.830) [-1004.864] (-1010.098) * (-1006.863) (-1003.089) (-1002.831) [-1009.475] -- 0:01:38
516000 -- (-1011.578) (-1008.112) [-1002.514] (-1016.110) * (-1006.804) (-1007.974) (-1005.255) [-1009.718] -- 0:01:38
516500 -- (-1010.851) (-1010.111) (-1008.428) [-1012.427] * (-1005.375) (-1010.016) (-1004.747) [-1007.466] -- 0:01:38
517000 -- (-1021.384) (-1008.394) (-1008.038) [-1010.662] * (-1008.525) (-1009.679) [-1004.423] (-1008.648) -- 0:01:38
517500 -- (-1021.993) [-1006.038] (-1010.296) (-1010.079) * (-1010.929) (-1015.126) [-1005.045] (-1004.248) -- 0:01:37
518000 -- (-1019.670) [-1007.348] (-1003.811) (-1004.573) * (-1007.756) (-1019.088) (-1004.266) [-1003.130] -- 0:01:37
518500 -- (-1005.900) (-1005.694) [-1002.169] (-1008.127) * (-1007.694) (-1012.802) (-1009.007) [-1003.817] -- 0:01:37
519000 -- (-1007.627) (-1011.731) [-1005.210] (-1012.086) * (-1005.521) (-1014.591) [-1005.792] (-1001.712) -- 0:01:37
519500 -- (-1009.398) [-1001.949] (-1009.192) (-1003.884) * (-1007.613) (-1009.332) (-1007.134) [-1009.868] -- 0:01:38
520000 -- (-1012.059) (-1011.892) (-1005.506) [-1013.079] * (-1009.565) (-1016.171) [-1003.508] (-1010.787) -- 0:01:37
Average standard deviation of split frequencies: 0.007545
520500 -- (-1005.493) [-1008.230] (-1004.886) (-1007.408) * [-1013.756] (-1013.562) (-1003.291) (-1014.535) -- 0:01:37
521000 -- (-1006.526) [-1006.171] (-1013.383) (-1002.331) * (-1010.476) (-1015.018) (-1008.390) [-1006.115] -- 0:01:37
521500 -- [-1008.459] (-1023.088) (-1006.259) (-1011.052) * [-1009.669] (-1017.941) (-1010.923) (-1007.062) -- 0:01:37
522000 -- (-1006.521) (-1008.684) [-1006.980] (-1007.633) * (-1011.743) (-1016.035) [-1009.249] (-1004.127) -- 0:01:37
522500 -- (-1013.549) (-1003.630) (-1011.567) [-1001.086] * [-1007.345] (-1008.773) (-1009.185) (-1010.430) -- 0:01:36
523000 -- [-1002.395] (-1006.800) (-1002.856) (-1012.702) * (-1006.451) (-1015.077) [-1003.767] (-1004.440) -- 0:01:36
523500 -- (-1009.963) (-1007.480) (-1006.363) [-1006.712] * [-1007.327] (-1009.986) (-1008.210) (-1007.838) -- 0:01:36
524000 -- [-1011.569] (-1010.690) (-1008.222) (-1009.381) * (-1009.957) [-1007.751] (-1010.252) (-1012.931) -- 0:01:36
524500 -- (-1017.105) (-1006.437) [-1007.132] (-1006.453) * (-1006.720) (-1006.301) (-1005.748) [-1006.770] -- 0:01:37
525000 -- [-1005.216] (-1002.335) (-1004.935) (-1006.731) * (-1007.485) [-1006.181] (-1005.288) (-1011.816) -- 0:01:36
Average standard deviation of split frequencies: 0.008066
525500 -- (-1007.931) (-1008.028) (-1007.322) [-1004.881] * (-1007.016) [-1007.759] (-1003.995) (-1015.726) -- 0:01:36
526000 -- (-1007.946) (-1009.337) [-1003.826] (-1010.315) * (-1003.416) (-1009.579) (-1002.013) [-1004.504] -- 0:01:36
526500 -- (-1014.592) (-1001.994) (-1009.753) [-1006.784] * (-1003.295) (-1006.720) [-1002.533] (-1007.307) -- 0:01:36
527000 -- (-1006.823) [-1007.468] (-1007.481) (-1007.046) * (-1014.663) [-1001.648] (-1008.143) (-1004.138) -- 0:01:36
527500 -- [-1006.680] (-1008.927) (-1011.553) (-1013.817) * [-1004.030] (-1007.641) (-1003.119) (-1010.129) -- 0:01:35
528000 -- (-1006.706) (-1006.167) (-1013.324) [-1005.330] * (-1004.454) (-1008.102) [-1002.322] (-1010.898) -- 0:01:35
528500 -- (-1005.269) (-1005.976) (-1001.837) [-1009.992] * [-1010.925] (-1008.515) (-1005.990) (-1007.447) -- 0:01:35
529000 -- (-1012.153) [-1013.808] (-1008.518) (-1007.559) * [-1011.425] (-1004.860) (-1015.567) (-1011.925) -- 0:01:35
529500 -- [-1004.283] (-1007.339) (-1013.674) (-1010.077) * (-1004.628) [-1003.833] (-1001.702) (-1010.649) -- 0:01:35
530000 -- (-1011.056) (-1015.244) [-1009.664] (-1009.305) * (-1003.604) [-1005.355] (-1013.430) (-1014.109) -- 0:01:35
Average standard deviation of split frequencies: 0.008587
530500 -- (-1003.507) (-1010.979) [-1006.209] (-1009.664) * [-1004.924] (-1002.400) (-1015.971) (-1012.189) -- 0:01:35
531000 -- (-1006.108) (-1011.386) (-1009.915) [-1007.653] * (-1011.130) (-1003.562) (-1013.207) [-1004.044] -- 0:01:35
531500 -- (-1007.523) (-1009.032) [-1009.316] (-1006.325) * (-1008.964) (-1008.995) [-1012.726] (-1005.598) -- 0:01:35
532000 -- (-1011.339) (-1010.530) (-1016.325) [-1008.320] * [-1006.501] (-1008.483) (-1002.206) (-1007.131) -- 0:01:35
532500 -- [-1010.572] (-1011.771) (-1021.306) (-1009.376) * (-1007.292) (-1004.652) (-1005.584) [-1006.845] -- 0:01:34
533000 -- (-1003.275) (-1007.572) (-1011.287) [-1010.551] * [-1003.987] (-1009.737) (-1004.484) (-1005.742) -- 0:01:34
533500 -- (-1014.321) (-1004.793) [-1009.806] (-1013.230) * (-1011.918) (-1008.573) [-1012.454] (-1002.293) -- 0:01:34
534000 -- (-1009.777) (-1007.218) (-1018.612) [-1007.243] * (-1010.784) (-1017.081) [-1009.048] (-1012.025) -- 0:01:34
534500 -- [-1009.583] (-1006.035) (-1013.696) (-1008.139) * (-1008.536) (-1013.366) [-1007.127] (-1003.382) -- 0:01:34
535000 -- (-1013.348) [-1004.304] (-1005.256) (-1008.953) * (-1010.139) [-1008.336] (-1005.748) (-1012.541) -- 0:01:34
Average standard deviation of split frequencies: 0.009381
535500 -- (-1005.579) (-1012.544) [-1002.862] (-1014.326) * (-1005.740) (-1010.327) [-1013.544] (-1013.066) -- 0:01:34
536000 -- (-1013.247) [-1012.532] (-1004.616) (-1003.380) * (-1017.523) (-1007.844) (-1014.630) [-1008.370] -- 0:01:34
536500 -- [-1008.615] (-1008.706) (-1007.200) (-1013.052) * (-1011.375) (-1013.470) (-1006.789) [-1006.400] -- 0:01:34
537000 -- (-1012.219) [-1004.813] (-1007.566) (-1013.080) * (-1011.820) (-1008.908) [-1005.271] (-1006.596) -- 0:01:33
537500 -- (-1003.729) [-1010.013] (-1002.537) (-1009.643) * (-1009.522) (-1009.788) [-1003.794] (-1005.905) -- 0:01:33
538000 -- (-1012.014) [-1011.357] (-1004.305) (-1014.422) * (-1004.394) (-1015.158) [-1007.016] (-1005.260) -- 0:01:33
538500 -- [-1004.646] (-1010.355) (-1004.262) (-1008.789) * [-1008.695] (-1018.321) (-1008.834) (-1009.451) -- 0:01:33
539000 -- (-1007.442) [-1005.402] (-1002.662) (-1008.138) * (-1013.938) [-1010.538] (-1008.016) (-1009.850) -- 0:01:33
539500 -- (-1004.730) (-1003.221) (-1003.723) [-1004.804] * (-1012.895) (-1007.971) [-1006.502] (-1008.721) -- 0:01:33
540000 -- (-1004.268) (-1008.399) [-1006.174] (-1008.099) * (-1013.432) [-1011.391] (-1001.095) (-1005.200) -- 0:01:33
Average standard deviation of split frequencies: 0.009881
540500 -- [-1003.009] (-1005.568) (-1012.189) (-1018.127) * (-1011.846) [-1005.306] (-1009.094) (-1008.239) -- 0:01:33
541000 -- (-1007.883) (-1007.580) (-1005.690) [-1008.979] * (-1012.535) [-1005.323] (-1002.792) (-1004.210) -- 0:01:33
541500 -- (-1007.711) (-1006.656) (-1005.760) [-1008.937] * (-1003.213) [-1011.345] (-1016.978) (-1001.131) -- 0:01:33
542000 -- (-1006.689) [-1003.138] (-1005.129) (-1010.645) * (-1014.622) [-1004.748] (-1008.847) (-1008.392) -- 0:01:32
542500 -- [-1005.912] (-1002.960) (-1011.305) (-1010.484) * (-1013.623) (-1006.360) [-1005.495] (-1016.401) -- 0:01:32
543000 -- [-1005.029] (-1004.492) (-1007.391) (-1012.141) * (-1003.546) (-1008.020) [-1006.298] (-1007.863) -- 0:01:32
543500 -- (-1002.028) [-1010.406] (-1013.025) (-1005.417) * (-1006.548) (-1009.120) (-1012.520) [-1008.822] -- 0:01:32
544000 -- [-1010.655] (-1014.139) (-1010.041) (-1011.371) * [-1002.494] (-1011.933) (-1013.185) (-1008.765) -- 0:01:32
544500 -- [-1009.359] (-1010.442) (-1008.201) (-1007.779) * (-1010.207) (-1003.498) (-1016.498) [-1006.293] -- 0:01:32
545000 -- [-1001.176] (-1014.353) (-1007.275) (-1003.844) * (-1005.585) [-1004.496] (-1009.966) (-1004.222) -- 0:01:32
Average standard deviation of split frequencies: 0.009497
545500 -- (-1008.808) (-1005.537) (-1013.136) [-1006.480] * [-1008.250] (-1007.262) (-1014.060) (-1009.855) -- 0:01:32
546000 -- [-1007.923] (-1013.468) (-1004.614) (-1010.546) * (-1010.570) (-1007.236) (-1012.475) [-1002.700] -- 0:01:32
546500 -- (-1010.607) (-1004.756) (-1013.341) [-1009.305] * (-1014.663) (-1014.948) (-1005.700) [-1007.310] -- 0:01:32
547000 -- (-1012.490) [-1004.490] (-1021.195) (-1005.244) * (-1008.622) (-1015.068) [-1010.490] (-1019.073) -- 0:01:31
547500 -- (-1015.330) (-1004.842) [-1011.496] (-1008.014) * (-1005.343) (-1004.011) [-1009.614] (-1010.878) -- 0:01:31
548000 -- (-1017.060) (-1006.277) (-1007.404) [-1004.781] * (-1005.037) (-1014.721) [-1009.996] (-1005.554) -- 0:01:31
548500 -- (-1019.425) (-1009.730) (-1007.258) [-1006.940] * [-1006.984] (-1006.293) (-1015.456) (-1003.319) -- 0:01:31
549000 -- (-1012.384) [-1008.679] (-1012.251) (-1013.153) * (-1009.376) (-1007.332) (-1010.608) [-1005.075] -- 0:01:31
549500 -- (-1010.556) (-1005.507) (-1012.622) [-1006.007] * (-1008.390) (-1014.777) [-1012.626] (-1004.516) -- 0:01:31
550000 -- [-1003.319] (-1002.976) (-1016.796) (-1011.722) * (-1005.849) [-1005.489] (-1014.004) (-1009.527) -- 0:01:31
Average standard deviation of split frequencies: 0.009131
550500 -- (-1010.224) (-1012.059) [-1012.327] (-1011.423) * (-1009.284) [-1008.370] (-1016.886) (-1008.859) -- 0:01:31
551000 -- (-1011.930) [-1005.677] (-1010.896) (-1014.533) * (-1009.092) [-1004.918] (-1015.923) (-1009.064) -- 0:01:31
551500 -- [-1001.536] (-1004.493) (-1012.111) (-1010.660) * (-1007.289) (-1008.601) (-1011.549) [-1004.136] -- 0:01:31
552000 -- (-1006.879) (-1019.427) [-1002.408] (-1008.905) * (-1011.043) (-1009.836) (-1007.534) [-1004.352] -- 0:01:30
552500 -- (-1005.123) (-1006.401) (-1007.404) [-1004.055] * (-1007.177) (-1004.057) [-1006.059] (-1004.184) -- 0:01:30
553000 -- (-1010.551) [-1006.065] (-1003.592) (-1005.701) * (-1005.544) [-1006.730] (-1004.744) (-1008.252) -- 0:01:30
553500 -- [-1011.588] (-1004.508) (-1004.865) (-1006.489) * (-1008.512) (-1012.041) (-1009.710) [-1004.671] -- 0:01:30
554000 -- (-1015.624) (-1009.893) (-1007.765) [-1002.491] * (-1009.042) (-1013.120) (-1012.313) [-1008.623] -- 0:01:30
554500 -- (-1012.344) [-1008.158] (-1008.307) (-1002.021) * (-1008.135) (-1010.110) (-1003.697) [-1006.161] -- 0:01:29
555000 -- (-1013.259) [-1003.665] (-1004.424) (-1007.242) * (-1021.566) (-1008.660) [-1006.915] (-1011.898) -- 0:01:30
Average standard deviation of split frequencies: 0.009044
555500 -- [-1013.269] (-1011.624) (-1003.346) (-1004.351) * (-1014.075) (-1004.578) [-1006.040] (-1014.449) -- 0:01:30
556000 -- (-1009.608) (-1011.124) [-1005.690] (-1005.534) * [-1009.629] (-1008.102) (-1005.360) (-1002.771) -- 0:01:30
556500 -- (-1007.312) (-1008.813) (-1009.322) [-1004.220] * (-1008.173) (-1007.242) [-1007.977] (-1003.289) -- 0:01:30
557000 -- (-1014.474) [-1006.728] (-1001.632) (-1006.345) * (-1010.526) (-1009.304) [-1009.252] (-1009.739) -- 0:01:29
557500 -- (-1008.518) (-1005.989) (-1006.206) [-1009.566] * (-1006.187) (-1004.536) [-1006.415] (-1010.100) -- 0:01:29
558000 -- [-1014.695] (-1001.103) (-1007.467) (-1004.760) * (-1005.310) (-1014.153) (-1010.727) [-1013.806] -- 0:01:29
558500 -- (-1017.296) (-1003.827) [-1006.161] (-1010.250) * (-1006.228) (-1009.438) [-1008.432] (-1014.566) -- 0:01:29
559000 -- [-1009.152] (-1008.621) (-1003.331) (-1008.701) * (-1016.516) (-1012.059) [-1005.019] (-1008.855) -- 0:01:29
559500 -- (-1005.056) (-1006.318) (-1009.784) [-1007.017] * [-1004.275] (-1006.438) (-1006.260) (-1006.288) -- 0:01:29
560000 -- [-1012.990] (-1009.549) (-1008.912) (-1014.120) * [-1007.467] (-1003.790) (-1003.448) (-1003.754) -- 0:01:29
Average standard deviation of split frequencies: 0.008688
560500 -- (-1007.976) (-1005.486) (-1009.417) [-1005.168] * (-1016.054) (-1003.383) (-1001.242) [-1009.752] -- 0:01:29
561000 -- [-1002.259] (-1002.312) (-1011.931) (-999.670) * (-1004.642) (-1009.712) [-1013.778] (-1009.461) -- 0:01:29
561500 -- (-1009.453) (-1006.808) [-1011.328] (-1004.364) * (-1006.631) (-1011.548) [-1013.499] (-1007.569) -- 0:01:29
562000 -- [-1005.564] (-1010.967) (-1015.650) (-1004.781) * [-1004.759] (-1012.402) (-1014.262) (-1009.395) -- 0:01:28
562500 -- (-1004.125) [-1006.388] (-1009.737) (-1009.809) * [-1013.244] (-1006.126) (-1005.781) (-1010.133) -- 0:01:28
563000 -- (-1007.369) (-1012.619) (-1011.105) [-1007.131] * (-1013.913) (-1002.906) (-1005.658) [-1005.978] -- 0:01:28
563500 -- (-1004.169) [-1006.140] (-1020.382) (-1006.043) * (-1015.116) (-999.827) (-1004.382) [-1013.949] -- 0:01:28
564000 -- (-1011.852) (-1012.294) (-1024.095) [-1010.358] * [-1012.032] (-1002.868) (-1005.350) (-1008.443) -- 0:01:28
564500 -- (-1010.453) [-1007.100] (-1015.068) (-1008.293) * (-1013.045) (-1003.758) [-1006.242] (-1006.004) -- 0:01:28
565000 -- (-1005.942) (-1005.983) [-1008.754] (-1012.770) * (-1016.463) (-1009.606) [-1002.417] (-1006.867) -- 0:01:28
Average standard deviation of split frequencies: 0.009439
565500 -- [-1002.857] (-1008.504) (-1006.061) (-1001.011) * (-1013.253) (-1004.653) (-1022.561) [-1006.221] -- 0:01:28
566000 -- (-1011.306) [-1004.545] (-1012.028) (-1021.634) * (-1011.852) (-1010.333) [-1008.853] (-1008.264) -- 0:01:28
566500 -- (-1004.113) (-1003.881) [-1004.744] (-1014.197) * (-1011.235) (-1014.763) [-1005.261] (-1009.012) -- 0:01:28
567000 -- [-1007.359] (-1006.083) (-1005.741) (-1011.760) * [-1008.231] (-1009.075) (-1005.900) (-1007.101) -- 0:01:27
567500 -- (-1005.386) [-1004.413] (-1006.600) (-1010.412) * (-1008.502) [-1005.469] (-1009.524) (-1007.097) -- 0:01:27
568000 -- [-1005.060] (-1005.325) (-1004.904) (-1005.577) * (-1009.070) (-1005.270) [-1001.543] (-1010.405) -- 0:01:27
568500 -- (-1008.620) (-1007.430) [-1007.795] (-1009.355) * [-1011.768] (-1007.929) (-1002.288) (-1005.729) -- 0:01:27
569000 -- (-1012.077) [-1009.047] (-1008.173) (-1008.443) * [-1006.288] (-1012.400) (-1008.262) (-1011.050) -- 0:01:27
569500 -- (-1012.303) (-1019.228) (-1011.914) [-1004.978] * [-1013.993] (-1006.829) (-1004.817) (-1007.277) -- 0:01:27
570000 -- [-1006.627] (-1003.780) (-1004.337) (-1006.380) * (-1003.355) [-1008.260] (-1001.493) (-1011.351) -- 0:01:27
Average standard deviation of split frequencies: 0.009087
570500 -- (-1006.198) (-1012.001) [-1002.204] (-1005.980) * (-1007.355) (-1011.746) [-1007.209] (-1005.687) -- 0:01:27
571000 -- (-1003.893) (-1010.838) [-1004.161] (-1005.792) * (-1019.316) [-1007.235] (-1010.380) (-1010.267) -- 0:01:27
571500 -- (-1000.555) [-1003.355] (-1008.434) (-1008.187) * (-1014.620) (-1003.059) (-1005.278) [-1006.786] -- 0:01:26
572000 -- [-1006.029] (-1006.918) (-1011.530) (-1003.808) * (-1005.051) (-1004.413) (-1011.266) [-1007.284] -- 0:01:26
572500 -- [-1002.270] (-1011.022) (-1014.347) (-1011.082) * (-1007.714) (-1010.797) [-1005.873] (-1008.739) -- 0:01:26
573000 -- [-1008.851] (-1003.891) (-1024.983) (-1008.303) * (-1009.084) (-1011.149) [-1008.360] (-1008.161) -- 0:01:26
573500 -- [-1004.488] (-1002.154) (-1009.273) (-1013.672) * [-1010.217] (-1010.948) (-1011.555) (-1012.798) -- 0:01:26
574000 -- [-1005.565] (-1004.294) (-1006.303) (-1006.402) * [-1007.143] (-1017.078) (-1008.475) (-1014.736) -- 0:01:26
574500 -- (-1003.089) (-1015.177) (-1010.686) [-1006.704] * [-1005.689] (-1014.260) (-1003.835) (-1003.803) -- 0:01:26
575000 -- (-1015.331) [-1007.942] (-1006.192) (-1008.978) * (-1008.262) [-1007.634] (-1002.486) (-1007.566) -- 0:01:26
Average standard deviation of split frequencies: 0.009275
575500 -- (-1019.655) (-1005.480) [-1006.114] (-1001.881) * (-1009.570) (-1006.056) [-1006.158] (-1009.566) -- 0:01:26
576000 -- [-1004.071] (-1011.833) (-1013.581) (-1015.168) * (-1010.427) (-1012.656) (-1005.703) [-1006.681] -- 0:01:26
576500 -- [-1007.246] (-1013.607) (-1005.850) (-1007.890) * (-1008.640) [-1003.984] (-1009.816) (-1006.881) -- 0:01:25
577000 -- (-1006.544) [-1006.141] (-1007.937) (-1005.405) * [-1004.938] (-1002.974) (-1018.618) (-1007.839) -- 0:01:25
577500 -- (-1011.316) (-1007.523) [-1005.195] (-1015.644) * (-1008.881) [-1002.826] (-1014.114) (-1011.012) -- 0:01:25
578000 -- (-1010.712) [-1004.546] (-1005.793) (-1017.972) * (-1008.375) (-1004.489) (-1016.523) [-1006.818] -- 0:01:25
578500 -- [-1005.257] (-1011.649) (-1004.310) (-1011.218) * (-1009.589) (-1012.058) (-1010.293) [-1004.275] -- 0:01:25
579000 -- (-1004.375) (-1014.161) [-1006.533] (-1016.720) * (-1013.297) (-1005.953) [-1016.619] (-1013.141) -- 0:01:25
579500 -- (-1005.957) [-1006.998] (-1005.730) (-1010.661) * (-1010.136) [-1003.947] (-1024.512) (-1001.873) -- 0:01:25
580000 -- (-1008.829) (-1004.571) [-1008.371] (-1004.815) * (-1011.088) (-1005.381) (-1011.965) [-1003.484] -- 0:01:25
Average standard deviation of split frequencies: 0.008930
580500 -- (-1010.321) (-1005.821) [-1010.427] (-1006.582) * (-1009.551) [-1006.604] (-1012.357) (-1007.162) -- 0:01:25
581000 -- [-1009.963] (-1008.164) (-1011.922) (-1011.021) * (-1012.842) [-1007.973] (-1008.457) (-1007.555) -- 0:01:25
581500 -- [-1005.531] (-1018.206) (-1012.106) (-1006.223) * (-1002.469) [-1009.946] (-1011.422) (-1014.844) -- 0:01:24
582000 -- [-1006.771] (-1010.740) (-1006.526) (-1003.157) * [-1006.026] (-1009.042) (-1009.939) (-1009.250) -- 0:01:24
582500 -- [-1002.012] (-1012.407) (-1003.862) (-1013.738) * (-1005.888) [-1008.863] (-1004.251) (-1007.013) -- 0:01:24
583000 -- [-1004.743] (-1007.980) (-1003.188) (-1007.407) * (-1010.014) (-1013.119) (-1014.856) [-1007.870] -- 0:01:24
583500 -- (-1004.469) (-1007.875) [-1002.295] (-1007.189) * [-1003.415] (-1004.452) (-1018.080) (-1010.639) -- 0:01:24
584000 -- [-1003.151] (-1000.080) (-1011.969) (-1011.148) * [-1002.255] (-1011.309) (-1014.156) (-1005.316) -- 0:01:24
584500 -- (-1007.866) (-1007.816) (-1007.450) [-1001.628] * [-1005.899] (-1005.929) (-1014.131) (-1005.980) -- 0:01:23
585000 -- [-1005.924] (-1007.013) (-1006.966) (-1016.785) * [-1005.699] (-1006.723) (-1011.332) (-1009.023) -- 0:01:24
Average standard deviation of split frequencies: 0.008849
585500 -- (-1005.492) [-1004.740] (-1009.691) (-1008.201) * (-1009.596) (-1003.391) [-1012.528] (-1007.507) -- 0:01:24
586000 -- (-1008.165) [-1001.896] (-1003.650) (-1008.667) * [-1008.931] (-1011.286) (-1013.898) (-1003.084) -- 0:01:24
586500 -- [-1004.110] (-1006.726) (-1004.777) (-1004.814) * [-1002.332] (-1016.110) (-1013.472) (-1018.452) -- 0:01:23
587000 -- [-1005.503] (-1004.002) (-1009.863) (-1007.942) * (-1003.460) (-1004.330) [-1006.458] (-1002.598) -- 0:01:23
587500 -- [-1007.129] (-1000.540) (-1007.954) (-1001.474) * [-1003.051] (-1007.490) (-1010.723) (-1006.785) -- 0:01:23
588000 -- (-1008.731) [-1004.525] (-1009.899) (-1004.856) * (-1009.332) (-1005.603) (-1004.051) [-1006.125] -- 0:01:23
588500 -- (-1011.166) (-998.669) [-1008.178] (-1008.432) * (-1012.251) (-1004.372) (-1010.255) [-1005.639] -- 0:01:23
589000 -- [-1004.389] (-1005.327) (-1007.217) (-1011.119) * (-1007.406) (-1011.337) (-1007.545) [-1008.212] -- 0:01:23
589500 -- (-1004.847) [-1005.002] (-1014.446) (-1012.486) * (-1010.234) (-1006.371) (-1007.542) [-1007.379] -- 0:01:22
590000 -- [-1009.241] (-1002.486) (-1005.531) (-1009.087) * [-1004.327] (-1016.901) (-1005.647) (-1004.588) -- 0:01:23
Average standard deviation of split frequencies: 0.009311
590500 -- (-1005.126) (-1005.771) (-1000.566) [-1007.652] * (-1007.098) [-1004.036] (-1003.252) (-1004.816) -- 0:01:23
591000 -- (-1007.272) [-1010.925] (-1005.035) (-1006.789) * (-1005.222) (-1011.099) [-1003.406] (-1007.070) -- 0:01:23
591500 -- (-1003.696) (-1010.944) [-1005.388] (-1005.193) * (-1001.781) [-1002.983] (-1009.187) (-1009.193) -- 0:01:22
592000 -- (-1003.911) [-1006.009] (-1006.328) (-1002.170) * (-1003.545) (-1006.168) [-1007.316] (-1012.289) -- 0:01:22
592500 -- (-1008.295) (-1007.313) (-1011.081) [-1001.580] * (-1005.392) (-1008.700) (-1008.243) [-1006.295] -- 0:01:22
593000 -- (-1006.073) (-1013.047) (-1004.771) [-1001.825] * (-1013.686) (-1008.863) (-1010.067) [-1005.447] -- 0:01:22
593500 -- (-1009.528) (-1005.996) (-1004.743) [-1006.586] * (-1020.502) (-1008.929) (-1006.674) [-1005.484] -- 0:01:22
594000 -- (-1018.967) (-1006.792) [-1006.559] (-1007.525) * (-1012.745) (-1008.599) [-1005.473] (-1007.364) -- 0:01:22
594500 -- [-1010.552] (-1007.594) (-1009.047) (-1015.239) * [-1012.690] (-1004.080) (-1006.842) (-1007.983) -- 0:01:21
595000 -- (-1010.412) (-1002.075) (-1012.013) [-1003.640] * (-1008.365) [-1005.263] (-1006.241) (-1002.632) -- 0:01:22
Average standard deviation of split frequencies: 0.008964
595500 -- (-1013.119) (-1005.694) [-1001.395] (-1001.539) * [-1003.227] (-1013.907) (-1009.151) (-1005.558) -- 0:01:22
596000 -- (-1005.410) (-1006.353) [-1005.491] (-1004.019) * [-1007.282] (-1006.621) (-1007.681) (-1005.385) -- 0:01:22
596500 -- (-1009.347) (-1006.575) (-1007.074) [-1007.620] * (-1004.983) (-1005.468) (-1009.321) [-1008.669] -- 0:01:21
597000 -- (-1011.269) (-1008.514) (-1007.000) [-1009.978] * (-1006.720) [-1005.718] (-1010.600) (-1008.873) -- 0:01:21
597500 -- (-1008.001) [-1005.134] (-1003.598) (-1012.905) * (-1009.886) (-1009.046) (-1007.159) [-1004.237] -- 0:01:21
598000 -- (-1002.639) [-1007.715] (-1007.844) (-1009.792) * (-1005.482) [-1005.379] (-1007.152) (-1013.827) -- 0:01:21
598500 -- (-1005.765) (-1005.960) (-1017.162) [-1007.103] * (-1004.071) [-1005.788] (-1005.505) (-1002.339) -- 0:01:21
599000 -- (-1012.119) (-1008.770) [-1008.165] (-1010.257) * (-1013.363) [-1008.598] (-1011.367) (-1004.476) -- 0:01:21
599500 -- (-1004.697) (-1015.345) [-1009.612] (-1010.550) * (-1009.873) (-1012.255) (-1008.419) [-1007.151] -- 0:01:20
600000 -- [-1006.831] (-1007.048) (-1007.521) (-1009.188) * (-1011.112) (-1010.287) [-1004.299] (-1011.569) -- 0:01:21
Average standard deviation of split frequencies: 0.007848
600500 -- [-1004.912] (-1010.516) (-1008.059) (-1004.729) * (-1004.729) (-1010.600) [-1005.996] (-1014.856) -- 0:01:21
601000 -- (-1006.087) (-1008.353) (-1016.289) [-1009.215] * (-1010.280) (-1013.083) [-1005.757] (-1010.568) -- 0:01:20
601500 -- (-1008.352) (-1013.181) [-1007.887] (-1005.537) * (-1008.033) [-1013.746] (-1009.301) (-1014.279) -- 0:01:20
602000 -- (-1010.771) (-1015.278) (-1006.906) [-1004.406] * (-1010.854) (-1005.672) [-1004.483] (-1012.108) -- 0:01:20
602500 -- (-1003.049) [-1005.698] (-1002.365) (-1004.055) * (-1008.852) (-1009.097) (-1010.398) [-1008.441] -- 0:01:20
603000 -- (-1007.484) (-1013.472) (-1009.798) [-1008.346] * [-1010.124] (-1011.465) (-1006.873) (-1012.887) -- 0:01:20
603500 -- (-1004.807) (-1016.795) (-1005.243) [-1005.183] * (-1006.924) (-1008.020) [-1005.697] (-1005.856) -- 0:01:20
604000 -- (-1008.152) (-1011.169) [-1007.675] (-1011.270) * (-1008.999) (-1008.041) (-1007.312) [-1013.067] -- 0:01:19
604500 -- (-1009.493) (-1011.835) [-1003.212] (-1013.471) * [-1006.966] (-1003.376) (-1017.530) (-1007.067) -- 0:01:19
605000 -- (-1014.241) (-1015.431) [-1005.465] (-1015.772) * (-1006.649) [-1004.291] (-1016.140) (-1003.283) -- 0:01:20
Average standard deviation of split frequencies: 0.008038
605500 -- (-1007.589) (-1002.937) [-1003.221] (-1005.432) * (-1005.577) (-1005.066) [-1016.046] (-1008.294) -- 0:01:20
606000 -- (-1006.171) (-1004.302) (-1007.608) [-1009.160] * (-1009.354) (-1006.079) (-1024.575) [-1005.509] -- 0:01:19
606500 -- (-1012.455) (-1011.692) (-1006.355) [-1004.333] * (-1015.837) (-1008.067) (-1020.023) [-1003.671] -- 0:01:19
607000 -- (-1010.683) (-1016.947) (-1005.818) [-1009.187] * (-1015.903) (-1004.897) (-1013.295) [-1005.889] -- 0:01:19
607500 -- (-1012.235) (-1012.223) (-1005.461) [-1005.121] * [-1010.328] (-1008.604) (-1011.966) (-1003.997) -- 0:01:19
608000 -- (-1013.185) [-1007.276] (-1009.528) (-1008.791) * (-1008.596) [-1003.951] (-1012.542) (-1002.634) -- 0:01:19
608500 -- (-1009.220) [-1006.361] (-1012.761) (-1007.954) * (-1007.108) [-1006.794] (-1009.916) (-1007.313) -- 0:01:19
609000 -- (-1005.342) (-1012.191) [-1004.775] (-1004.984) * (-1005.390) (-1011.459) (-1008.407) [-1005.278] -- 0:01:18
609500 -- (-1012.361) [-1005.716] (-1006.017) (-1006.165) * (-1005.857) [-1007.282] (-1009.239) (-1008.565) -- 0:01:18
610000 -- (-1011.917) (-1005.665) [-1007.404] (-1002.496) * (-1009.405) [-1007.047] (-1007.613) (-1014.350) -- 0:01:19
Average standard deviation of split frequencies: 0.007977
610500 -- (-1010.485) (-1014.054) [-1009.602] (-1006.481) * [-1008.791] (-1012.987) (-1008.343) (-1009.552) -- 0:01:19
611000 -- (-1013.599) (-1009.767) [-1011.693] (-1002.863) * (-1016.455) [-1005.442] (-1007.197) (-1013.075) -- 0:01:18
611500 -- (-1006.949) (-1005.696) [-1017.369] (-1008.362) * (-1016.452) (-1010.624) [-1005.503] (-1011.861) -- 0:01:18
612000 -- (-1011.695) (-1007.630) (-1018.568) [-1010.063] * [-1008.740] (-1007.157) (-1004.630) (-1018.697) -- 0:01:18
612500 -- (-1006.469) (-1007.114) (-1007.124) [-1011.075] * (-1005.249) (-1011.189) [-1005.064] (-1009.138) -- 0:01:18
613000 -- (-1006.291) [-1007.482] (-1007.279) (-1004.040) * [-1005.342] (-1008.133) (-1013.276) (-1008.303) -- 0:01:18
613500 -- (-1005.016) (-1005.319) [-1004.879] (-1015.629) * (-1009.665) [-1011.224] (-1010.474) (-1011.116) -- 0:01:18
614000 -- (-1004.748) (-1009.334) [-1005.550] (-1014.401) * [-1004.535] (-1005.620) (-1007.132) (-1009.461) -- 0:01:17
614500 -- (-1003.281) (-1013.160) [-1006.389] (-1006.762) * (-1006.560) (-1010.165) [-1005.381] (-1006.227) -- 0:01:17
615000 -- (-1009.809) (-1013.321) [-1011.172] (-1004.516) * (-1012.029) (-1007.972) (-1007.059) [-1006.257] -- 0:01:18
Average standard deviation of split frequencies: 0.007398
615500 -- (-1008.118) (-1002.043) (-1003.512) [-1007.168] * (-1006.371) [-1008.329] (-1010.568) (-1001.869) -- 0:01:18
616000 -- (-1006.512) (-1019.825) (-1004.426) [-1009.896] * (-1003.938) (-1011.905) (-1010.548) [-1005.875] -- 0:01:17
616500 -- (-1009.179) (-1012.169) [-1008.190] (-1009.652) * (-1006.749) (-1011.239) [-1005.516] (-1017.531) -- 0:01:17
617000 -- (-1008.686) (-1005.042) (-1011.072) [-1010.135] * (-1006.384) (-1007.799) (-1013.523) [-1011.210] -- 0:01:17
617500 -- (-1006.990) (-1006.286) [-1012.269] (-1012.684) * (-1006.532) (-1013.028) [-1012.151] (-1011.034) -- 0:01:17
618000 -- (-1005.810) (-1010.307) [-1003.298] (-1006.879) * [-1010.609] (-1008.897) (-1011.636) (-1007.859) -- 0:01:17
618500 -- (-1012.789) (-1007.385) [-1004.019] (-1011.668) * (-1011.448) (-1010.158) (-1011.130) [-1007.371] -- 0:01:17
619000 -- (-1009.961) (-1006.978) [-1008.587] (-1012.480) * (-1009.395) (-1012.256) (-1007.217) [-1007.709] -- 0:01:16
619500 -- (-1018.691) (-1008.242) (-1009.698) [-1004.001] * (-1009.528) (-1009.298) (-1013.525) [-1007.865] -- 0:01:16
620000 -- (-1011.794) (-1006.180) (-1015.781) [-1003.072] * [-1006.949] (-1013.787) (-1014.337) (-1005.939) -- 0:01:17
Average standard deviation of split frequencies: 0.007089
620500 -- (-1007.836) [-1012.811] (-1005.626) (-1007.541) * (-1002.832) (-1015.197) [-1007.433] (-1013.846) -- 0:01:17
621000 -- [-1004.877] (-1012.313) (-1005.468) (-1015.296) * [-1000.437] (-1010.606) (-1015.759) (-1012.135) -- 0:01:16
621500 -- [-1004.073] (-1011.091) (-1008.863) (-1002.644) * (-1010.279) [-1008.741] (-1009.741) (-1006.332) -- 0:01:16
622000 -- (-1006.652) (-1017.306) (-1011.126) [-1003.395] * [-1005.676] (-1010.271) (-1008.532) (-1011.670) -- 0:01:16
622500 -- (-1011.880) (-1009.734) (-1007.280) [-1005.563] * (-1005.671) [-1005.821] (-1015.458) (-1015.636) -- 0:01:16
623000 -- [-1010.007] (-1013.371) (-1008.751) (-1006.558) * (-1009.443) [-1005.320] (-1013.534) (-1001.916) -- 0:01:16
623500 -- [-1006.781] (-1008.750) (-1014.492) (-1009.380) * (-1021.905) [-1006.212] (-1012.792) (-1004.097) -- 0:01:16
624000 -- (-1004.692) (-1014.761) (-1010.014) [-1004.489] * (-1017.440) [-1007.267] (-1008.036) (-1007.623) -- 0:01:15
624500 -- (-1007.290) (-1006.796) [-1007.646] (-1009.109) * (-1019.611) (-1007.914) (-1005.633) [-1011.032] -- 0:01:15
625000 -- (-1008.439) [-1005.891] (-1006.277) (-1004.431) * (-1014.415) (-1013.311) (-1007.605) [-1004.041] -- 0:01:16
Average standard deviation of split frequencies: 0.007781
625500 -- (-1004.641) [-1007.957] (-1013.460) (-1009.353) * (-1008.951) [-1005.947] (-1010.116) (-1005.996) -- 0:01:16
626000 -- (-1020.684) (-1002.987) [-1006.946] (-1010.633) * (-1011.391) (-1005.943) [-1011.533] (-1013.956) -- 0:01:15
626500 -- (-1011.027) [-1003.701] (-1007.512) (-1006.778) * (-1013.495) (-1006.849) (-1007.948) [-1005.730] -- 0:01:15
627000 -- (-1003.604) (-1006.679) (-1012.180) [-1007.743] * (-1014.172) [-1011.215] (-1006.249) (-1008.073) -- 0:01:15
627500 -- (-1004.512) (-1004.405) (-1004.652) [-1004.452] * [-1009.392] (-1007.237) (-1008.293) (-1006.740) -- 0:01:15
628000 -- [-1005.590] (-1008.355) (-1008.733) (-1010.992) * (-1004.983) (-1004.473) [-1012.292] (-1007.006) -- 0:01:15
628500 -- (-1012.953) (-1005.628) [-1005.478] (-1009.014) * [-1009.927] (-1006.591) (-1010.514) (-1009.830) -- 0:01:15
629000 -- (-1007.684) (-1006.094) (-1001.823) [-1006.841] * (-1019.833) (-1010.685) (-1012.992) [-1004.183] -- 0:01:14
629500 -- (-1006.011) [-1003.926] (-1010.716) (-1008.315) * (-1010.526) [-1015.004] (-1008.310) (-1008.809) -- 0:01:14
630000 -- [-1006.500] (-1002.438) (-1007.132) (-1008.593) * [-1005.035] (-1009.874) (-1009.641) (-1013.448) -- 0:01:15
Average standard deviation of split frequencies: 0.009219
630500 -- (-1009.561) (-1012.564) (-1010.944) [-1008.446] * [-1009.522] (-1011.027) (-1004.689) (-1014.824) -- 0:01:15
631000 -- (-1003.490) [-1008.225] (-1008.694) (-1008.783) * (-1007.826) (-1010.593) [-1008.737] (-1015.204) -- 0:01:14
631500 -- (-1000.874) [-1008.492] (-1005.402) (-1012.654) * (-1009.998) (-1010.723) [-1001.945] (-1010.457) -- 0:01:14
632000 -- [-1001.721] (-1014.706) (-1009.316) (-1004.465) * (-1005.849) (-1011.728) (-1002.589) [-1007.962] -- 0:01:14
632500 -- [-1008.565] (-1011.439) (-1013.340) (-1008.049) * [-1009.474] (-1006.263) (-1019.137) (-1011.685) -- 0:01:14
633000 -- [-1009.814] (-1008.000) (-1012.672) (-1012.894) * (-1004.321) (-1002.706) (-1004.081) [-1008.099] -- 0:01:14
633500 -- (-1011.443) (-1006.678) (-1006.535) [-1003.580] * (-1017.386) (-1003.122) [-1005.735] (-1010.560) -- 0:01:14
634000 -- (-1006.292) (-1009.471) (-1013.358) [-1005.875] * (-1007.213) (-1016.281) [-1000.967] (-1005.960) -- 0:01:13
634500 -- (-1001.297) (-1009.304) [-1008.049] (-1011.585) * (-1007.631) (-1012.209) [-1005.706] (-1008.675) -- 0:01:13
635000 -- (-1007.962) [-1005.925] (-1012.423) (-1020.392) * (-1004.334) [-1020.011] (-1003.028) (-1005.216) -- 0:01:14
Average standard deviation of split frequencies: 0.009141
635500 -- (-1010.887) [-999.696] (-1012.813) (-1003.345) * (-1007.863) [-1003.994] (-1011.198) (-1011.049) -- 0:01:13
636000 -- (-1011.524) (-1007.134) (-1013.324) [-1006.292] * [-1005.136] (-1009.880) (-1010.875) (-1005.761) -- 0:01:13
636500 -- (-1008.157) [-1005.072] (-1012.946) (-1010.459) * (-1002.229) (-1004.443) (-1009.452) [-1006.271] -- 0:01:13
637000 -- (-1012.682) [-1012.297] (-1004.258) (-1003.772) * (-1006.597) [-1008.440] (-1019.138) (-1001.254) -- 0:01:13
637500 -- (-1009.715) (-1003.029) (-1008.114) [-1006.473] * [-1007.449] (-1012.539) (-1006.119) (-1013.283) -- 0:01:13
638000 -- (-1004.314) (-1012.652) (-1008.131) [-1010.040] * (-1003.643) (-1013.098) [-1004.380] (-1011.631) -- 0:01:13
638500 -- (-1004.650) (-1014.534) (-1015.054) [-1011.105] * (-1005.571) (-1010.850) (-1015.285) [-1008.079] -- 0:01:13
639000 -- [-1002.752] (-1010.854) (-1009.835) (-1008.299) * (-1011.047) (-1007.525) (-1007.803) [-1002.797] -- 0:01:12
639500 -- (-1006.602) [-1010.705] (-1013.022) (-1004.546) * (-1008.437) (-1006.421) [-1008.157] (-1012.079) -- 0:01:12
640000 -- [-1006.067] (-1013.225) (-1001.579) (-1012.154) * (-1006.353) (-1006.020) [-1010.123] (-1004.191) -- 0:01:12
Average standard deviation of split frequencies: 0.009075
640500 -- (-1008.226) (-1016.609) (-1009.170) [-1007.396] * (-1003.646) (-1006.485) [-1001.064] (-1014.061) -- 0:01:12
641000 -- (-1006.512) (-1015.590) [-1010.083] (-1018.966) * (-1010.293) (-1006.709) (-1012.593) [-1005.455] -- 0:01:12
641500 -- (-1007.097) (-1016.517) (-1015.031) [-1000.020] * (-1019.489) [-1013.888] (-1001.373) (-1008.234) -- 0:01:12
642000 -- (-1002.634) [-1008.182] (-1017.379) (-1006.648) * (-1009.567) (-1012.281) (-1009.877) [-1008.192] -- 0:01:12
642500 -- (-1003.591) (-1001.239) (-1014.288) [-1009.880] * (-1006.563) (-1008.721) (-1009.303) [-1002.535] -- 0:01:12
643000 -- (-1009.997) (-1007.400) (-1009.866) [-1002.520] * [-1002.987] (-1007.542) (-1010.137) (-1006.460) -- 0:01:12
643500 -- (-1006.584) (-1004.559) (-1005.218) [-1007.472] * [-1004.528] (-1002.571) (-1010.120) (-1015.173) -- 0:01:12
644000 -- (-1013.728) [-1007.165] (-1011.833) (-1008.340) * [-1008.363] (-1013.150) (-1010.587) (-1022.295) -- 0:01:11
644500 -- (-1005.002) (-1004.162) (-1007.873) [-1008.373] * [-1003.640] (-1008.688) (-1011.503) (-1011.558) -- 0:01:11
645000 -- (-1004.989) [-1005.600] (-1010.698) (-1008.457) * (-1008.127) (-1010.717) [-1005.352] (-1008.529) -- 0:01:11
Average standard deviation of split frequencies: 0.008757
645500 -- (-1014.806) (-1005.782) (-1005.204) [-1005.906] * [-1009.885] (-1008.544) (-1007.008) (-1013.166) -- 0:01:11
646000 -- (-1011.085) (-1008.763) (-1005.116) [-1006.162] * [-1011.722] (-1011.884) (-1009.159) (-1008.642) -- 0:01:11
646500 -- (-1012.241) [-1005.484] (-1006.390) (-1008.328) * (-1010.315) [-1009.984] (-1004.817) (-1004.556) -- 0:01:11
647000 -- (-1009.724) (-1014.341) (-1011.386) [-1006.148] * (-1009.125) (-1009.316) (-1007.075) [-1002.331] -- 0:01:11
647500 -- (-1004.698) [-1003.510] (-1011.979) (-1014.634) * (-1014.398) (-1011.041) (-1007.507) [-1005.852] -- 0:01:11
648000 -- (-1017.696) (-1007.348) [-1018.197] (-1006.012) * (-1005.262) (-1013.620) [-1001.186] (-1010.467) -- 0:01:11
648500 -- (-1010.215) [-1014.270] (-1007.841) (-1010.871) * (-1004.000) (-1014.239) (-1006.190) [-1004.668] -- 0:01:11
649000 -- (-1019.892) (-1012.212) [-1010.808] (-1010.404) * (-1011.900) [-1008.976] (-1008.822) (-1002.813) -- 0:01:10
649500 -- (-1002.868) [-1005.380] (-1006.583) (-1005.522) * [-1006.981] (-1012.700) (-1009.298) (-1006.574) -- 0:01:10
650000 -- [-1008.066] (-1006.280) (-1014.174) (-1013.896) * (-1008.098) (-1017.417) [-1010.125] (-1005.463) -- 0:01:10
Average standard deviation of split frequencies: 0.007969
650500 -- (-1008.589) [-1003.459] (-1007.135) (-1009.590) * (-1003.286) [-1007.477] (-1004.600) (-1008.918) -- 0:01:10
651000 -- (-1006.186) [-1008.246] (-1013.485) (-1013.134) * [-1001.361] (-1009.742) (-1006.969) (-1009.634) -- 0:01:10
651500 -- (-1008.190) (-1016.703) [-1007.844] (-1009.105) * (-1004.738) (-1008.001) (-1010.805) [-1007.715] -- 0:01:10
652000 -- (-1011.407) (-1010.418) [-1010.105] (-1007.703) * (-1009.381) (-1008.310) (-1005.109) [-1008.312] -- 0:01:10
652500 -- [-1003.629] (-1013.709) (-1009.103) (-1010.454) * (-1004.534) [-1000.531] (-1014.194) (-1001.754) -- 0:01:10
653000 -- [-1005.832] (-1007.112) (-1006.335) (-1004.488) * [-1006.780] (-1004.105) (-1018.550) (-1004.425) -- 0:01:10
653500 -- [-1005.329] (-1004.659) (-1013.654) (-1005.409) * (-1007.080) [-1006.967] (-1008.132) (-1009.049) -- 0:01:09
654000 -- (-1004.302) (-1003.828) (-1011.338) [-1014.571] * (-1005.265) (-1008.286) (-1003.244) [-1004.022] -- 0:01:09
654500 -- (-1006.437) (-1011.961) [-1012.433] (-1003.385) * (-1009.682) (-1004.666) [-1006.740] (-1006.984) -- 0:01:09
655000 -- (-1008.506) (-1013.403) (-1009.516) [-1006.774] * (-1018.974) [-1010.217] (-1007.002) (-1004.489) -- 0:01:09
Average standard deviation of split frequencies: 0.006947
655500 -- (-1006.525) [-1004.384] (-1005.023) (-1010.948) * (-1014.028) [-1005.687] (-1011.939) (-1008.394) -- 0:01:09
656000 -- (-1007.057) (-1017.421) (-1007.461) [-1000.691] * (-1005.433) [-1006.497] (-1012.636) (-1002.033) -- 0:01:09
656500 -- (-1010.374) (-1011.516) (-1010.026) [-1004.927] * [-1007.451] (-1005.793) (-1017.621) (-1010.601) -- 0:01:09
657000 -- (-1003.521) [-1002.411] (-1015.488) (-1011.560) * (-1005.178) (-1015.447) (-1020.387) [-1008.739] -- 0:01:09
657500 -- (-1009.888) (-1007.304) [-1004.900] (-1011.326) * (-1003.951) (-1011.408) (-1025.914) [-1004.172] -- 0:01:09
658000 -- [-1007.868] (-1008.953) (-1005.270) (-1009.776) * [-1008.057] (-1005.625) (-1018.848) (-1002.804) -- 0:01:09
658500 -- (-1005.861) (-1011.048) [-1005.309] (-1013.835) * (-1007.838) (-1009.217) (-1013.723) [-1003.211] -- 0:01:08
659000 -- [-1006.682] (-1019.416) (-1003.262) (-1013.012) * (-1007.014) (-1007.813) (-1009.518) [-1003.904] -- 0:01:08
659500 -- (-1010.925) (-1016.186) [-1008.655] (-1008.330) * (-1010.502) [-1002.915] (-1014.258) (-1005.942) -- 0:01:08
660000 -- [-1004.848] (-1023.330) (-1014.298) (-1011.836) * (-1011.909) [-1006.732] (-1011.038) (-1007.838) -- 0:01:08
Average standard deviation of split frequencies: 0.006897
660500 -- (-1011.045) (-1014.232) [-1006.861] (-1003.189) * [-1006.800] (-1010.912) (-1009.137) (-1007.753) -- 0:01:08
661000 -- [-1008.947] (-1004.874) (-1009.155) (-1016.635) * (-1007.227) (-1011.643) [-1009.568] (-1007.098) -- 0:01:08
661500 -- [-1008.155] (-1004.412) (-1006.744) (-1008.847) * [-1007.439] (-1005.451) (-1023.393) (-1004.358) -- 0:01:08
662000 -- [-1011.326] (-1010.362) (-1007.220) (-1007.290) * [-1011.443] (-1015.237) (-1012.061) (-1007.452) -- 0:01:08
662500 -- (-1010.845) (-1014.158) (-1011.850) [-1010.838] * (-1005.498) (-1007.967) [-1010.561] (-1007.647) -- 0:01:08
663000 -- (-1006.038) (-1006.209) [-1009.395] (-1007.784) * (-1010.800) (-1009.911) (-1010.227) [-1009.642] -- 0:01:08
663500 -- (-1005.437) [-1006.398] (-1014.976) (-1010.222) * [-1010.750] (-1018.367) (-1007.226) (-1012.700) -- 0:01:07
664000 -- (-1013.877) (-1005.809) [-1007.651] (-1012.389) * (-1006.521) [-1012.756] (-1004.322) (-1011.621) -- 0:01:07
664500 -- (-1011.105) (-1008.059) (-1008.779) [-1003.993] * [-1008.915] (-1011.812) (-1012.478) (-1014.471) -- 0:01:07
665000 -- (-1015.922) (-1010.854) (-1005.701) [-1013.151] * (-1007.568) (-1011.634) [-1006.240] (-1010.983) -- 0:01:07
Average standard deviation of split frequencies: 0.006606
665500 -- (-1012.180) (-1009.388) [-1006.600] (-1012.416) * (-1003.018) (-1015.405) (-1015.909) [-1004.511] -- 0:01:07
666000 -- (-1008.952) (-1007.829) [-1004.790] (-1013.664) * (-1003.498) (-1010.132) (-1009.497) [-1007.525] -- 0:01:07
666500 -- (-1005.485) (-1009.148) [-1004.695] (-1020.424) * (-1011.409) (-1010.593) (-1007.395) [-1007.049] -- 0:01:07
667000 -- (-1001.428) (-1004.439) [-1002.718] (-1012.919) * [-1008.765] (-1012.791) (-1004.681) (-1004.104) -- 0:01:07
667500 -- (-1004.592) (-1011.047) [-1007.545] (-1017.413) * (-1007.619) (-1007.211) [-1008.486] (-1008.098) -- 0:01:07
668000 -- (-1002.550) (-1016.649) [-1006.940] (-1012.273) * (-1006.717) (-1004.483) [-1007.482] (-1010.479) -- 0:01:07
668500 -- [-1004.837] (-1014.665) (-1006.844) (-1015.158) * [-1004.059] (-1006.686) (-1004.830) (-1013.848) -- 0:01:06
669000 -- (-1006.245) (-1006.797) [-1006.041] (-1008.000) * [-1003.905] (-1005.135) (-1008.209) (-1004.204) -- 0:01:06
669500 -- (-1010.767) [-1005.991] (-1011.412) (-1003.746) * (-1007.348) (-1010.023) (-1006.029) [-1003.405] -- 0:01:06
670000 -- [-1001.194] (-1011.263) (-1009.909) (-1001.302) * (-1010.240) (-1004.836) (-1010.139) [-1002.592] -- 0:01:06
Average standard deviation of split frequencies: 0.006092
670500 -- (-1004.356) (-1009.443) [-1008.394] (-1004.059) * (-1012.954) (-1010.146) (-1003.259) [-1012.381] -- 0:01:06
671000 -- (-1011.592) (-1008.846) (-1008.364) [-1007.682] * (-1007.576) (-1007.098) [-1002.570] (-1005.109) -- 0:01:06
671500 -- [-1008.385] (-1007.321) (-1005.935) (-1005.132) * [-1008.033] (-1013.497) (-1009.464) (-1008.558) -- 0:01:06
672000 -- (-1007.613) (-1009.351) [-1008.392] (-1008.158) * (-1012.890) [-1005.439] (-1009.799) (-1003.260) -- 0:01:06
672500 -- (-1007.932) (-1004.870) (-1010.817) [-1012.243] * (-1015.149) (-1006.112) [-1006.106] (-1010.855) -- 0:01:06
673000 -- [-1006.935] (-1012.213) (-1014.728) (-1011.859) * (-1013.555) (-1008.354) (-1007.427) [-1008.424] -- 0:01:06
673500 -- (-1005.497) (-1008.880) [-1008.442] (-1006.388) * (-1014.574) (-1013.836) (-1007.456) [-1001.709] -- 0:01:05
674000 -- (-1003.128) (-1008.217) (-1011.687) [-1004.659] * (-1015.414) (-1021.297) (-1007.604) [-1004.004] -- 0:01:05
674500 -- [-1002.508] (-1003.301) (-1013.846) (-1014.274) * (-1004.714) [-1016.600] (-1011.572) (-1009.690) -- 0:01:05
675000 -- (-1005.479) (-1009.094) (-1009.266) [-1004.875] * [-1010.209] (-1011.860) (-1006.557) (-1003.311) -- 0:01:05
Average standard deviation of split frequencies: 0.006276
675500 -- (-1010.815) [-1004.727] (-1008.339) (-1008.772) * (-1009.485) (-1008.285) [-1003.801] (-1004.807) -- 0:01:05
676000 -- (-1009.647) [-1001.892] (-1008.083) (-1010.658) * (-1010.691) [-1012.805] (-1007.892) (-1016.147) -- 0:01:05
676500 -- (-1009.597) [-1002.691] (-1003.378) (-1005.560) * (-1009.682) [-1007.999] (-1007.737) (-1009.410) -- 0:01:05
677000 -- [-1009.770] (-1008.985) (-1006.978) (-1005.241) * (-1018.144) [-1001.985] (-1014.232) (-1003.411) -- 0:01:05
677500 -- [-1009.844] (-1020.278) (-1009.297) (-1008.332) * (-1011.076) [-1007.570] (-1008.609) (-1008.419) -- 0:01:05
678000 -- (-1014.314) (-1013.202) [-1005.632] (-1009.721) * (-1016.089) (-1004.356) [-1010.237] (-1004.334) -- 0:01:05
678500 -- (-1004.209) (-1008.085) (-1010.696) [-1002.366] * (-1012.091) [-1002.635] (-1007.654) (-1005.836) -- 0:01:04
679000 -- (-1004.122) (-1011.038) (-1013.632) [-1008.262] * (-1006.007) [-1009.265] (-1009.314) (-1006.996) -- 0:01:04
679500 -- (-1003.079) (-1005.343) [-1010.051] (-1008.583) * (-1009.187) (-1019.919) (-1002.038) [-1006.379] -- 0:01:04
680000 -- (-1006.456) (-1000.559) [-1005.888] (-1003.511) * [-1006.347] (-1007.473) (-1005.486) (-1003.595) -- 0:01:04
Average standard deviation of split frequencies: 0.006695
680500 -- (-1009.471) (-1009.454) (-1008.435) [-1003.183] * [-1004.525] (-1004.000) (-1001.443) (-1006.243) -- 0:01:04
681000 -- [-1008.982] (-1006.552) (-1003.935) (-1002.006) * [-1004.495] (-1005.901) (-1007.269) (-1007.714) -- 0:01:04
681500 -- (-1006.314) (-1009.898) [-1005.847] (-1005.804) * (-1009.167) [-1006.074] (-1010.615) (-1009.452) -- 0:01:04
682000 -- [-1007.656] (-1001.369) (-1011.428) (-1011.371) * (-1007.819) [-1004.119] (-1015.494) (-1011.455) -- 0:01:04
682500 -- (-1009.616) (-1011.173) [-1000.734] (-1012.023) * (-1006.194) (-1004.839) [-1005.640] (-1013.153) -- 0:01:04
683000 -- (-1007.133) (-1009.549) [-1004.889] (-1004.843) * (-1006.332) (-1015.064) (-1014.479) [-1018.502] -- 0:01:04
683500 -- (-1010.200) (-1017.479) [-1005.138] (-1005.147) * (-1005.595) (-1012.220) [-1006.758] (-1016.722) -- 0:01:03
684000 -- (-1006.207) (-1009.647) (-1005.987) [-1005.806] * [-1011.210] (-1010.248) (-1006.059) (-1007.760) -- 0:01:03
684500 -- (-1019.371) (-1016.821) (-1005.553) [-1011.212] * (-1011.313) (-1012.464) [-1001.413] (-1002.730) -- 0:01:03
685000 -- (-1011.507) (-1008.453) [-1011.972] (-1005.989) * (-1006.353) (-1015.471) [-1003.598] (-1004.381) -- 0:01:03
Average standard deviation of split frequencies: 0.006414
685500 -- (-1010.747) [-1008.513] (-1009.059) (-1009.265) * (-1005.511) (-1010.280) (-1010.545) [-1008.904] -- 0:01:03
686000 -- (-1012.597) (-1002.884) (-1006.151) [-1008.195] * (-1005.686) [-1004.209] (-1009.346) (-1011.663) -- 0:01:03
686500 -- [-1006.386] (-1005.280) (-1001.990) (-1007.628) * (-1004.917) (-1007.963) [-1010.387] (-1011.462) -- 0:01:03
687000 -- [-1015.130] (-1009.361) (-1008.737) (-1008.219) * (-1004.718) (-1011.943) [-1010.593] (-1008.837) -- 0:01:03
687500 -- [-1009.527] (-1005.833) (-1005.279) (-1010.234) * (-1010.900) (-1017.184) (-1004.680) [-1010.263] -- 0:01:03
688000 -- [-1003.102] (-1010.031) (-1011.290) (-1011.846) * (-1012.413) (-1010.735) [-1003.981] (-1007.544) -- 0:01:03
688500 -- (-1011.092) (-1006.239) (-1007.910) [-1013.567] * (-1003.941) (-1009.829) (-1002.999) [-1004.209] -- 0:01:02
689000 -- [-1012.086] (-1006.409) (-1006.329) (-1013.211) * [-1003.320] (-1008.125) (-1007.178) (-1004.783) -- 0:01:02
689500 -- (-1009.671) [-1010.526] (-1016.589) (-1009.103) * (-1006.279) (-1010.717) (-1007.240) [-1001.775] -- 0:01:02
690000 -- (-1003.065) (-1005.386) (-1007.702) [-1006.052] * [-1008.467] (-1009.953) (-1007.041) (-1009.361) -- 0:01:02
Average standard deviation of split frequencies: 0.005915
690500 -- (-1006.482) (-1010.641) [-1006.302] (-1008.447) * (-1013.920) (-1014.408) [-1001.888] (-1002.511) -- 0:01:02
691000 -- (-1009.286) (-1002.813) [-1009.864] (-1010.204) * (-1010.480) [-1005.281] (-1005.158) (-1007.570) -- 0:01:02
691500 -- (-1010.889) (-1007.237) (-1012.945) [-1007.065] * (-1015.145) (-1005.541) (-1011.839) [-1007.470] -- 0:01:02
692000 -- (-1016.122) (-1012.980) (-1017.088) [-1007.825] * (-1009.723) (-1011.697) (-1009.638) [-1010.869] -- 0:01:02
692500 -- (-1009.077) (-1011.195) [-1009.988] (-1007.144) * (-1011.037) [-1009.240] (-1009.783) (-1003.952) -- 0:01:02
693000 -- (-1006.076) (-1007.698) (-1012.000) [-1007.189] * (-1014.279) (-1012.004) (-1007.309) [-1003.601] -- 0:01:02
693500 -- (-1019.333) (-1006.890) (-1010.174) [-1004.932] * (-1008.292) [-1005.291] (-1008.442) (-1014.082) -- 0:01:01
694000 -- (-1006.452) (-1011.074) [-1009.485] (-1009.370) * (-1010.429) [-1003.657] (-1011.644) (-1010.747) -- 0:01:01
694500 -- (-1010.666) (-1013.231) [-1005.901] (-1008.309) * (-1008.677) [-1004.247] (-1006.635) (-1008.060) -- 0:01:01
695000 -- (-1012.306) [-1008.697] (-1016.851) (-1005.742) * (-1005.919) [-1005.189] (-1005.935) (-1012.485) -- 0:01:01
Average standard deviation of split frequencies: 0.005644
695500 -- (-1005.348) (-1009.969) [-1008.564] (-1015.271) * (-1012.080) (-1008.625) [-1002.652] (-1000.401) -- 0:01:01
696000 -- [-1004.335] (-1009.832) (-1006.799) (-1014.976) * (-1009.610) (-1009.451) [-1005.066] (-1006.881) -- 0:01:01
696500 -- (-1005.477) (-1007.209) (-1008.528) [-1007.012] * (-1008.402) (-1001.821) [-1007.398] (-1003.300) -- 0:01:01
697000 -- [-1006.213] (-1008.250) (-1010.384) (-1011.055) * (-1013.208) [-1007.475] (-1005.433) (-1005.139) -- 0:01:01
697500 -- (-1009.082) (-1011.644) [-1006.040] (-1015.396) * [-1005.232] (-1003.066) (-1006.441) (-1013.490) -- 0:01:01
698000 -- (-1010.106) (-1005.949) (-1014.785) [-1006.559] * (-1014.960) (-1004.302) [-1001.339] (-1012.779) -- 0:01:01
698500 -- (-1012.777) [-1005.617] (-1005.481) (-1009.890) * (-1012.356) (-1005.986) (-1005.071) [-1009.995] -- 0:01:00
699000 -- [-1007.637] (-1010.137) (-1013.029) (-1013.195) * [-1006.813] (-1012.131) (-1016.984) (-1011.307) -- 0:01:00
699500 -- (-1006.721) (-1010.937) (-1006.938) [-1006.323] * (-1008.682) (-1004.995) [-1008.015] (-1004.600) -- 0:01:00
700000 -- (-1007.187) (-1004.519) [-1008.717] (-1008.335) * [-1006.019] (-1012.075) (-1015.246) (-1006.934) -- 0:01:00
Average standard deviation of split frequencies: 0.005382
700500 -- (-1014.379) (-1009.617) (-1005.269) [-1014.213] * (-1009.970) [-1008.398] (-1007.144) (-1003.378) -- 0:01:00
701000 -- (-1008.768) (-1012.686) (-1003.720) [-1010.169] * (-1016.028) (-1009.392) [-1004.884] (-1011.485) -- 0:01:00
701500 -- (-1008.123) (-1012.690) (-1010.582) [-1005.517] * [-1004.172] (-1013.617) (-1015.852) (-1007.686) -- 0:01:00
702000 -- (-1009.642) (-1012.172) (-1003.869) [-1007.682] * (-1005.489) (-1018.904) (-1007.021) [-1012.242] -- 0:01:00
702500 -- (-1003.754) (-1016.239) [-1008.882] (-1008.159) * (-1004.811) (-1007.819) (-1009.221) [-1005.949] -- 0:01:00
703000 -- (-1002.641) (-1012.594) (-1008.103) [-1011.431] * (-1008.482) (-1013.445) [-1011.162] (-1004.170) -- 0:00:59
703500 -- (-1003.717) (-1007.687) [-1010.564] (-1008.813) * [-1003.859] (-1008.742) (-1007.639) (-1008.664) -- 0:00:59
704000 -- (-1006.318) [-1006.742] (-1005.668) (-1018.606) * (-1005.196) (-1012.586) (-1011.255) [-1006.862] -- 0:00:59
704500 -- (-1008.731) (-1004.830) [-1008.939] (-1011.582) * [-1004.830] (-1011.392) (-1008.881) (-1009.978) -- 0:00:59
705000 -- (-1011.851) [-1004.137] (-1009.817) (-1006.857) * [-1004.638] (-1009.641) (-1011.793) (-1005.183) -- 0:00:59
Average standard deviation of split frequencies: 0.004006
705500 -- (-1007.164) [-1006.183] (-1004.579) (-1008.920) * (-1011.494) (-1011.864) (-1007.921) [-1007.106] -- 0:00:59
706000 -- (-1004.892) [-1007.346] (-1004.037) (-1007.313) * (-1007.002) (-1012.952) [-1010.577] (-1006.116) -- 0:00:59
706500 -- (-1009.398) (-1013.600) [-1004.872] (-1009.958) * [-1008.687] (-1004.818) (-1006.904) (-1008.523) -- 0:00:59
707000 -- (-1012.227) (-1007.914) [-1002.780] (-1013.959) * (-1011.171) (-1009.750) [-1011.375] (-1010.460) -- 0:00:59
707500 -- (-1006.988) [-1006.676] (-1011.721) (-1017.165) * [-1004.198] (-1010.970) (-1006.715) (-1009.619) -- 0:00:59
708000 -- [-1007.364] (-1012.943) (-1009.405) (-1014.280) * (-1010.665) (-1011.801) (-1007.434) [-1009.153] -- 0:00:58
708500 -- (-1013.708) (-1005.946) [-1008.425] (-1009.133) * (-1005.204) [-1013.676] (-1002.847) (-1006.668) -- 0:00:58
709000 -- (-1014.878) [-1004.309] (-1008.652) (-1005.371) * (-1008.565) (-1007.718) (-1005.847) [-1002.479] -- 0:00:58
709500 -- (-1007.362) [-1015.121] (-1016.287) (-1010.753) * (-1006.510) [-1015.358] (-1004.042) (-1011.435) -- 0:00:58
710000 -- (-1007.372) [-1006.963] (-1011.817) (-1011.551) * (-1006.666) (-1008.605) [-1007.946] (-1009.026) -- 0:00:58
Average standard deviation of split frequencies: 0.003980
710500 -- (-1003.564) (-1005.179) [-1010.223] (-1005.881) * (-1004.245) [-1004.624] (-1009.543) (-1004.804) -- 0:00:58
711000 -- (-1012.476) [-1006.165] (-1016.893) (-1004.194) * [-1008.787] (-1008.060) (-1006.320) (-1005.660) -- 0:00:58
711500 -- (-1011.687) (-1009.638) [-1007.128] (-1009.333) * (-1010.740) (-1007.671) (-1005.426) [-1005.430] -- 0:00:58
712000 -- (-1009.595) (-1019.745) (-1005.459) [-1015.530] * [-1006.554] (-1005.387) (-1011.163) (-1010.837) -- 0:00:58
712500 -- [-1006.445] (-1013.829) (-1006.664) (-1011.239) * [-1005.745] (-1010.684) (-1010.272) (-1007.408) -- 0:00:58
713000 -- (-1014.189) [-1010.266] (-1002.244) (-1010.668) * [-1005.313] (-1005.117) (-1011.134) (-1014.271) -- 0:00:57
713500 -- (-1009.804) (-1007.836) [-1003.536] (-1012.253) * (-1007.517) (-1008.978) (-1008.447) [-1005.873] -- 0:00:57
714000 -- (-1007.128) (-1006.894) (-1003.062) [-1001.185] * (-1007.907) (-1007.171) (-1007.244) [-1008.469] -- 0:00:57
714500 -- (-1008.809) (-1013.078) [-1004.062] (-1006.875) * (-1010.228) (-1010.294) [-1004.083] (-1008.053) -- 0:00:57
715000 -- (-1006.013) [-1005.408] (-1008.455) (-1001.796) * (-1009.492) [-1009.839] (-1012.026) (-1007.779) -- 0:00:57
Average standard deviation of split frequencies: 0.004389
715500 -- [-1007.490] (-1008.508) (-1006.443) (-1010.416) * (-1011.675) [-1010.309] (-1006.563) (-1003.217) -- 0:00:57
716000 -- (-1006.349) (-1013.116) (-1005.763) [-1001.048] * (-1025.463) (-1011.031) [-1005.647] (-1007.112) -- 0:00:57
716500 -- [-1005.815] (-1016.065) (-1010.493) (-1007.246) * (-1005.322) (-1009.225) [-1005.001] (-1010.676) -- 0:00:57
717000 -- (-1007.991) (-1010.240) (-1019.840) [-1005.016] * (-1003.722) (-1008.090) (-1007.815) [-1010.840] -- 0:00:57
717500 -- (-1004.454) (-1010.625) [-1012.828] (-1006.163) * (-1006.181) (-1011.975) (-1003.258) [-1006.425] -- 0:00:57
718000 -- (-1018.358) (-1003.616) [-1010.112] (-1012.590) * (-1005.916) (-1005.815) (-1008.713) [-1008.984] -- 0:00:56
718500 -- [-1003.451] (-1005.414) (-1006.970) (-1012.333) * (-1008.760) (-1005.380) (-1010.761) [-1004.082] -- 0:00:56
719000 -- (-1012.253) [-1004.398] (-1008.155) (-1006.900) * (-1011.081) (-1002.112) [-1010.960] (-1004.260) -- 0:00:56
719500 -- (-1013.793) (-1007.331) [-1011.775] (-1003.829) * [-1010.506] (-1010.892) (-1004.130) (-1004.569) -- 0:00:56
720000 -- (-1010.333) (-1012.948) [-1005.331] (-1005.767) * [-1009.969] (-1002.128) (-1005.342) (-1010.234) -- 0:00:56
Average standard deviation of split frequencies: 0.004797
720500 -- [-1009.919] (-1006.290) (-1018.049) (-1005.417) * [-1003.327] (-1008.929) (-1012.516) (-1004.417) -- 0:00:56
721000 -- (-1005.356) (-1017.259) [-1008.172] (-1007.690) * (-1004.688) (-1005.815) [-1004.676] (-1006.550) -- 0:00:56
721500 -- (-1009.369) (-1009.937) [-1006.878] (-1013.420) * (-1010.764) (-1009.585) [-1010.050] (-1006.704) -- 0:00:56
722000 -- [-1006.389] (-1007.895) (-1010.773) (-1005.823) * (-1006.174) [-1011.142] (-1010.831) (-1009.260) -- 0:00:56
722500 -- (-1018.946) [-1007.234] (-1007.767) (-1005.313) * (-1009.039) (-1012.298) (-1010.109) [-1005.751] -- 0:00:56
723000 -- [-1015.587] (-1005.406) (-1011.634) (-1005.255) * (-1009.173) [-1000.754] (-1006.471) (-1005.617) -- 0:00:55
723500 -- (-1014.622) (-1010.942) [-1001.973] (-1012.915) * (-1012.070) (-1010.862) [-1008.276] (-1004.204) -- 0:00:55
724000 -- (-1005.314) (-1011.783) (-1011.366) [-1004.388] * (-1008.256) (-1004.853) (-1013.782) [-1005.587] -- 0:00:55
724500 -- (-1006.946) (-1013.731) (-1006.662) [-1006.747] * [-1008.104] (-1008.863) (-1009.161) (-1003.899) -- 0:00:55
725000 -- (-1012.727) (-1016.308) [-1009.444] (-1008.865) * [-1012.706] (-1003.501) (-1007.008) (-1007.520) -- 0:00:55
Average standard deviation of split frequencies: 0.004545
725500 -- (-1012.093) (-1004.806) [-1009.192] (-1012.569) * (-1003.963) [-1006.352] (-1004.002) (-1007.627) -- 0:00:55
726000 -- (-1026.536) [-1002.551] (-1014.495) (-1007.457) * (-1008.076) (-1009.592) [-1004.815] (-1011.678) -- 0:00:55
726500 -- (-1013.098) (-1003.411) (-1005.011) [-1012.522] * (-1014.478) [-1002.328] (-1011.595) (-1013.301) -- 0:00:55
727000 -- (-1007.324) (-1014.363) [-1005.244] (-1003.153) * (-1008.243) (-999.977) (-1021.565) [-1008.456] -- 0:00:55
727500 -- [-1007.429] (-1014.411) (-1004.609) (-1006.606) * [-1005.131] (-1011.345) (-1009.485) (-1005.886) -- 0:00:55
728000 -- [-1009.433] (-1018.923) (-1010.101) (-1001.740) * (-1006.593) [-1003.059] (-1008.225) (-1010.727) -- 0:00:54
728500 -- (-1011.591) (-1012.944) (-1007.367) [-1006.211] * (-1010.451) (-1005.604) (-1004.365) [-1005.428] -- 0:00:54
729000 -- (-1005.932) (-1014.527) [-1004.907] (-1007.426) * [-1006.183] (-1010.577) (-1001.482) (-1010.108) -- 0:00:54
729500 -- [-1007.192] (-1017.906) (-1003.134) (-1004.498) * (-1007.923) (-1013.711) [-1002.471] (-1005.576) -- 0:00:54
730000 -- (-1014.377) (-1005.256) (-1008.764) [-1004.254] * (-1005.401) (-1010.268) (-1004.456) [-1004.226] -- 0:00:54
Average standard deviation of split frequencies: 0.004516
730500 -- (-1014.515) (-1000.895) (-1003.487) [-1003.272] * (-1006.816) (-1005.659) [-1006.828] (-1011.576) -- 0:00:54
731000 -- (-1004.336) (-1007.433) (-1010.090) [-1008.248] * (-1008.395) [-1007.023] (-1012.215) (-1003.450) -- 0:00:54
731500 -- (-1008.476) (-1008.603) [-1007.432] (-1009.543) * (-1008.270) (-1012.548) (-1014.623) [-1007.211] -- 0:00:54
732000 -- (-1005.527) (-1015.588) [-1009.991] (-1007.461) * (-1004.386) (-1015.574) [-1008.473] (-1009.305) -- 0:00:54
732500 -- (-1006.855) (-1009.911) (-1012.223) [-1005.804] * (-1009.390) (-1015.140) (-1002.644) [-1011.727] -- 0:00:54
733000 -- (-1005.998) (-1006.010) (-1011.992) [-1002.658] * (-1003.389) [-1004.766] (-1002.590) (-1014.346) -- 0:00:53
733500 -- (-1003.710) (-1005.683) [-1026.785] (-1009.410) * (-1010.526) (-1008.995) [-1004.465] (-1008.018) -- 0:00:53
734000 -- (-1009.330) [-1006.633] (-1013.567) (-1017.437) * [-1000.923] (-1011.734) (-1000.784) (-1006.754) -- 0:00:53
734500 -- (-1005.110) (-1011.368) [-1002.124] (-1012.310) * [-1008.665] (-1005.473) (-1005.531) (-1012.360) -- 0:00:53
735000 -- (-1001.845) [-1003.471] (-1007.643) (-1009.141) * [-1004.512] (-1009.901) (-1003.769) (-1011.031) -- 0:00:53
Average standard deviation of split frequencies: 0.004270
735500 -- [-1009.518] (-1011.188) (-1005.138) (-1006.009) * (-1006.617) [-1004.190] (-1007.215) (-1005.593) -- 0:00:53
736000 -- (-1010.110) (-1008.711) [-1007.856] (-1009.382) * (-1015.093) (-1006.683) [-1005.482] (-1008.857) -- 0:00:53
736500 -- (-1011.663) [-1010.762] (-1006.706) (-1011.229) * (-1008.345) [-1006.066] (-1006.736) (-1010.028) -- 0:00:53
737000 -- (-1004.485) (-1010.886) [-1012.458] (-1011.587) * (-1011.601) (-1017.038) [-1003.295] (-1010.567) -- 0:00:53
737500 -- [-1005.944] (-1015.115) (-1005.234) (-1009.405) * [-1011.944] (-1003.383) (-1004.326) (-1007.810) -- 0:00:53
738000 -- (-1002.555) (-1012.520) (-1017.463) [-1004.036] * (-1006.671) (-1020.632) [-1005.156] (-1000.288) -- 0:00:52
738500 -- (-1006.811) [-1005.207] (-1001.921) (-1008.553) * (-1005.979) (-1007.886) (-1004.018) [-1002.046] -- 0:00:52
739000 -- (-1003.793) (-1006.320) (-1004.570) [-1006.849] * (-1008.295) (-1012.833) (-1007.238) [-1004.957] -- 0:00:52
739500 -- (-1007.445) (-1008.942) [-1003.982] (-1010.052) * [-1004.924] (-1011.055) (-1013.567) (-1007.915) -- 0:00:52
740000 -- (-1009.199) (-1008.841) (-1009.759) [-1002.335] * (-1005.989) (-1009.467) [-1003.746] (-1008.567) -- 0:00:52
Average standard deviation of split frequencies: 0.003819
740500 -- (-1009.401) [-1005.198] (-1017.775) (-1008.930) * (-1006.700) [-1009.636] (-1007.722) (-1009.558) -- 0:00:52
741000 -- (-1006.206) [-1011.934] (-1002.668) (-1013.264) * (-1006.927) [-1002.966] (-1006.301) (-1006.830) -- 0:00:52
741500 -- (-1008.228) (-1004.580) [-1003.788] (-1003.594) * [-1006.876] (-1009.849) (-1003.198) (-1003.680) -- 0:00:52
742000 -- [-1003.893] (-1009.175) (-1016.091) (-1003.042) * (-1005.477) (-1007.295) (-1015.479) [-1006.004] -- 0:00:52
742500 -- [-1005.796] (-1010.225) (-1010.653) (-1004.388) * (-1011.810) (-1013.141) (-1014.835) [-1013.292] -- 0:00:52
743000 -- (-1004.187) [-1011.097] (-1007.600) (-1012.829) * (-1002.734) [-1012.829] (-1004.697) (-1014.379) -- 0:00:51
743500 -- (-1008.110) (-1021.249) (-1006.958) [-1007.489] * (-1018.116) [-1003.818] (-1010.978) (-1013.775) -- 0:00:51
744000 -- [-1007.551] (-1013.753) (-1009.980) (-1009.326) * [-1006.241] (-1004.762) (-1008.364) (-1012.350) -- 0:00:51
744500 -- (-1008.639) (-1010.965) [-1008.627] (-1006.446) * (-1006.391) (-1012.755) [-1011.168] (-1014.793) -- 0:00:51
745000 -- (-1007.919) (-1012.331) [-1003.023] (-1009.311) * [-1005.674] (-1006.136) (-1010.721) (-1010.121) -- 0:00:51
Average standard deviation of split frequencies: 0.003160
745500 -- (-1008.234) [-1008.763] (-1002.690) (-1010.434) * [-1011.896] (-1011.647) (-1008.089) (-1005.471) -- 0:00:51
746000 -- (-1011.869) (-1011.556) (-1008.674) [-1005.577] * [-1007.288] (-1003.736) (-1004.364) (-1003.558) -- 0:00:51
746500 -- (-1006.430) (-1010.280) [-1004.624] (-1004.964) * (-1004.987) [-1006.711] (-1014.938) (-1001.968) -- 0:00:51
747000 -- (-1005.576) [-1007.698] (-1005.995) (-1005.856) * (-1008.249) (-1005.752) [-1005.019] (-1008.350) -- 0:00:51
747500 -- (-1013.169) [-1003.027] (-1012.870) (-1010.627) * (-1008.381) [-1005.181] (-1006.854) (-1004.576) -- 0:00:51
748000 -- [-1009.642] (-1007.511) (-1010.506) (-1010.465) * (-1012.671) (-1013.793) (-1012.597) [-1001.528] -- 0:00:50
748500 -- (-1015.271) [-1005.105] (-1011.983) (-1007.389) * (-1005.874) (-1007.036) [-1005.664] (-1006.702) -- 0:00:50
749000 -- (-1014.020) (-1007.777) [-1006.064] (-1008.969) * (-1003.456) [-1007.071] (-1011.045) (-1005.368) -- 0:00:50
749500 -- (-1005.141) (-1004.472) [-1004.764] (-1005.853) * (-1016.168) (-1012.623) (-1013.995) [-1005.162] -- 0:00:50
750000 -- (-1007.663) [-1011.390] (-1016.038) (-1011.545) * [-1003.868] (-1007.078) (-1011.570) (-1006.163) -- 0:00:50
Average standard deviation of split frequencies: 0.002721
750500 -- (-1013.413) [-1008.601] (-1016.302) (-1009.412) * [-1007.381] (-1004.117) (-1008.146) (-1006.544) -- 0:00:50
751000 -- [-1019.063] (-1010.161) (-1006.620) (-1014.124) * (-1008.129) (-1012.989) [-1004.251] (-1018.556) -- 0:00:50
751500 -- (-1010.371) (-1006.328) (-1006.025) [-1006.839] * [-1011.170] (-1010.374) (-1004.003) (-1007.301) -- 0:00:50
752000 -- (-1010.976) [-1006.256] (-1023.053) (-1010.680) * (-1006.284) (-1007.464) (-1007.902) [-1001.773] -- 0:00:50
752500 -- [-1003.903] (-1004.248) (-1009.413) (-1013.171) * (-999.712) [-1004.832] (-1008.600) (-1007.655) -- 0:00:49
753000 -- (-1001.920) (-1006.239) [-1010.082] (-1011.852) * [-1002.181] (-1009.014) (-1010.352) (-1020.519) -- 0:00:49
753500 -- (-1004.907) (-1006.871) (-1012.943) [-1005.664] * [-1012.124] (-1006.409) (-1014.338) (-1021.991) -- 0:00:49
754000 -- (-1010.448) (-1005.243) (-1010.918) [-1005.633] * (-1007.520) [-1007.021] (-1012.863) (-1013.284) -- 0:00:49
754500 -- (-1007.849) [-1004.765] (-1003.435) (-1006.433) * [-1008.338] (-1003.718) (-1010.436) (-1009.287) -- 0:00:49
755000 -- (-1010.745) (-1006.732) (-1009.130) [-1005.282] * [-1007.825] (-1011.954) (-1006.714) (-1010.959) -- 0:00:49
Average standard deviation of split frequencies: 0.002910
755500 -- (-1012.221) (-1006.180) [-1006.326] (-1007.313) * (-1005.756) (-1006.099) [-1005.966] (-1019.029) -- 0:00:49
756000 -- (-1011.086) (-1007.203) (-1004.783) [-1003.402] * [-1005.222] (-1009.316) (-1013.148) (-1007.235) -- 0:00:49
756500 -- (-1010.923) [-1006.772] (-1011.071) (-1011.407) * (-1005.524) (-1006.045) (-1006.156) [-1001.759] -- 0:00:49
757000 -- [-1009.005] (-1012.904) (-1011.424) (-1012.588) * (-1003.440) (-1002.026) (-1012.354) [-1005.648] -- 0:00:49
757500 -- (-1019.943) [-1007.268] (-1002.853) (-1005.335) * [-1005.773] (-1001.814) (-1014.141) (-1007.053) -- 0:00:48
758000 -- (-1013.387) (-1003.506) (-1007.226) [-1012.718] * (-1006.924) [-1009.869] (-1008.604) (-1007.969) -- 0:00:48
758500 -- [-1007.939] (-1011.205) (-1004.917) (-1010.868) * (-1006.036) [-1001.764] (-1014.460) (-1019.480) -- 0:00:48
759000 -- (-1004.757) (-1004.001) (-1012.665) [-1009.671] * [-1006.864] (-1007.492) (-1004.931) (-1012.508) -- 0:00:48
759500 -- [-1003.719] (-1007.241) (-1013.062) (-1010.509) * (-1010.112) (-1007.555) [-1007.169] (-1019.885) -- 0:00:48
760000 -- (-1004.395) (-1003.577) (-1009.502) [-1008.890] * (-1008.535) (-1005.778) [-1007.151] (-1009.774) -- 0:00:48
Average standard deviation of split frequencies: 0.002685
760500 -- (-1006.467) [-1004.385] (-999.557) (-1006.878) * (-1010.455) (-1008.451) (-1010.357) [-1006.649] -- 0:00:48
761000 -- [-1005.262] (-1002.961) (-1008.804) (-1007.958) * [-1004.490] (-1007.598) (-1009.844) (-1006.584) -- 0:00:48
761500 -- [-1011.091] (-1008.623) (-1004.221) (-1007.355) * (-1010.330) (-1018.105) (-1007.148) [-999.112] -- 0:00:48
762000 -- [-1006.923] (-1023.242) (-1008.841) (-1005.420) * [-1007.596] (-1019.524) (-1003.992) (-1004.262) -- 0:00:48
762500 -- (-1004.960) (-1008.279) (-1007.675) [-1008.594] * (-1013.434) (-1005.267) [-1000.885] (-1006.195) -- 0:00:47
763000 -- (-1001.887) [-1004.664] (-1020.305) (-1007.337) * (-1009.003) (-1012.958) [-1003.914] (-1013.339) -- 0:00:47
763500 -- (-1005.648) [-1005.128] (-1010.452) (-1006.763) * [-1005.501] (-1010.396) (-1006.679) (-1013.435) -- 0:00:47
764000 -- (-1013.263) [-1008.539] (-1009.363) (-1005.055) * [-1006.264] (-1003.568) (-1008.335) (-1009.089) -- 0:00:47
764500 -- (-1007.093) [-1013.192] (-1007.738) (-1010.135) * (-1005.613) (-1014.002) (-1015.857) [-1006.021] -- 0:00:47
765000 -- (-1000.175) (-1012.335) (-1003.113) [-1004.710] * (-1008.368) (-1006.301) (-1008.129) [-1003.900] -- 0:00:47
Average standard deviation of split frequencies: 0.003282
765500 -- (-1006.159) [-1014.344] (-1015.671) (-1006.558) * (-1007.771) [-1008.715] (-1008.490) (-1010.369) -- 0:00:47
766000 -- (-999.580) (-1012.507) (-1003.865) [-1004.427] * (-1008.769) [-1008.091] (-1002.687) (-1012.520) -- 0:00:47
766500 -- (-1012.990) (-1006.227) [-1005.707] (-1010.024) * [-1005.143] (-1008.506) (-1008.675) (-1013.088) -- 0:00:47
767000 -- (-1011.435) (-1005.813) (-1006.035) [-1011.135] * (-1002.044) (-1009.547) [-1009.132] (-1006.458) -- 0:00:47
767500 -- (-1011.633) (-1002.448) [-1007.643] (-1008.228) * [-1003.982] (-1011.103) (-1010.143) (-1004.608) -- 0:00:46
768000 -- [-1006.852] (-1007.025) (-1014.166) (-1007.722) * (-1007.802) (-1006.680) [-1006.378] (-1009.347) -- 0:00:46
768500 -- (-1009.851) (-1008.606) [-1008.946] (-1004.054) * (-1008.116) [-1007.070] (-1009.450) (-1007.627) -- 0:00:46
769000 -- (-1005.413) (-1009.214) (-1013.237) [-1012.423] * (-1011.115) [-1002.995] (-1016.765) (-1004.474) -- 0:00:46
769500 -- [-1006.127] (-1007.375) (-1008.664) (-1008.539) * [-1004.498] (-1006.584) (-1011.518) (-1011.069) -- 0:00:46
770000 -- (-1001.016) [-1011.238] (-1010.589) (-1014.240) * [-1003.786] (-1011.773) (-1006.850) (-1006.318) -- 0:00:46
Average standard deviation of split frequencies: 0.003466
770500 -- (-1011.109) (-1009.319) (-1013.892) [-1008.545] * [-1015.249] (-1002.456) (-1009.695) (-1018.780) -- 0:00:46
771000 -- (-1008.378) [-1002.660] (-1008.243) (-1012.786) * (-1009.306) [-1004.820] (-1015.681) (-1005.581) -- 0:00:46
771500 -- (-1009.763) (-1009.182) [-1010.017] (-1001.449) * (-1003.705) [-1003.161] (-1014.571) (-1011.773) -- 0:00:46
772000 -- (-1005.746) (-1007.128) [-1007.697] (-1010.995) * (-1009.721) [-1004.351] (-1007.979) (-1021.986) -- 0:00:46
772500 -- [-1005.332] (-1009.583) (-1012.301) (-1012.016) * (-1010.005) (-1000.099) [-1006.379] (-1011.941) -- 0:00:45
773000 -- [-1013.126] (-1013.817) (-1010.446) (-1008.058) * (-1010.043) [-1007.068] (-1013.197) (-1010.185) -- 0:00:45
773500 -- [-1005.462] (-1008.360) (-1009.537) (-1010.923) * [-1006.140] (-1006.391) (-1009.360) (-1005.331) -- 0:00:45
774000 -- (-1013.908) (-1014.078) [-1010.544] (-1003.802) * [-1007.668] (-1010.193) (-1004.517) (-1014.731) -- 0:00:45
774500 -- (-1011.523) (-1018.891) (-1009.777) [-1003.525] * (-1002.922) [-1003.673] (-1005.528) (-1003.875) -- 0:00:45
775000 -- [-1000.637] (-1007.197) (-1003.766) (-1004.053) * (-1013.673) [-1008.180] (-1007.167) (-1006.181) -- 0:00:45
Average standard deviation of split frequencies: 0.003240
775500 -- (-1007.791) [-1004.460] (-1007.650) (-1011.305) * (-1008.934) [-1000.458] (-1006.881) (-1007.930) -- 0:00:45
776000 -- [-1003.750] (-1015.232) (-1005.146) (-1006.186) * (-1010.021) (-1005.996) [-1004.606] (-1008.937) -- 0:00:45
776500 -- (-1008.252) (-1012.497) [-1006.805] (-1016.616) * (-1009.812) (-1009.174) [-1007.013] (-1006.477) -- 0:00:45
777000 -- (-1007.059) (-1008.148) (-1004.825) [-1012.816] * (-1012.675) (-1006.760) (-1012.296) [-1009.275] -- 0:00:45
777500 -- (-1007.121) (-1005.481) [-1005.810] (-1006.906) * [-1005.834] (-1012.184) (-1011.513) (-1009.505) -- 0:00:44
778000 -- (-1005.346) (-1005.606) [-1006.469] (-1011.131) * (-1008.918) [-1006.660] (-1004.397) (-1007.468) -- 0:00:44
778500 -- (-1008.653) (-1014.396) (-1001.854) [-1000.788] * [-1007.983] (-1010.291) (-1010.070) (-1008.644) -- 0:00:44
779000 -- [-1010.962] (-1008.636) (-1002.597) (-1008.150) * (-1012.124) (-1004.155) [-1005.915] (-1010.045) -- 0:00:44
779500 -- (-1009.693) (-1009.529) (-1003.954) [-1004.195] * [-1011.838] (-1011.263) (-1012.106) (-1013.318) -- 0:00:44
780000 -- (-1016.995) (-1010.674) (-1004.361) [-1004.266] * (-1005.962) (-1006.577) [-1007.847] (-1009.062) -- 0:00:44
Average standard deviation of split frequencies: 0.003824
780500 -- [-1007.223] (-1001.747) (-1012.945) (-1012.492) * [-1006.678] (-1004.802) (-1014.593) (-1010.678) -- 0:00:44
781000 -- (-1012.223) (-1010.114) [-1006.938] (-1006.258) * (-1006.384) (-1012.859) [-1011.247] (-1010.736) -- 0:00:44
781500 -- [-1003.426] (-1005.772) (-1010.838) (-1014.829) * (-1005.485) (-1018.628) [-1007.057] (-1012.956) -- 0:00:44
782000 -- [-1006.255] (-1006.020) (-1004.620) (-1008.750) * (-1013.460) (-1003.968) (-1014.079) [-1020.479] -- 0:00:44
782500 -- (-1013.519) (-1003.958) [-1007.920] (-1008.811) * [-1002.234] (-1007.527) (-1012.226) (-1008.933) -- 0:00:43
783000 -- (-1015.177) (-1009.351) [-1008.640] (-1006.540) * [-1009.537] (-1010.556) (-1007.693) (-1007.977) -- 0:00:43
783500 -- (-1004.269) (-1014.556) (-1005.529) [-1009.376] * (-1008.494) (-1007.779) [-1019.027] (-1011.347) -- 0:00:43
784000 -- [-1004.007] (-1011.584) (-1007.528) (-1003.807) * (-1003.238) (-1004.208) [-1006.059] (-1014.349) -- 0:00:43
784500 -- (-1004.950) (-1005.655) [-1008.492] (-1008.124) * [-1005.448] (-1006.017) (-1016.220) (-1003.494) -- 0:00:43
785000 -- [-1005.499] (-1008.131) (-1014.495) (-1008.852) * (-1011.615) (-1006.861) [-1008.351] (-1020.985) -- 0:00:43
Average standard deviation of split frequencies: 0.003798
785500 -- [-1007.940] (-1003.727) (-1011.319) (-1016.158) * [-1002.074] (-1003.439) (-1004.875) (-1004.798) -- 0:00:43
786000 -- (-1013.883) (-1004.042) [-1005.419] (-1010.633) * (-1008.964) (-1010.993) [-1007.393] (-1010.458) -- 0:00:43
786500 -- (-1008.249) (-1007.664) [-1008.807] (-1005.337) * (-1006.064) (-1006.040) [-1003.863] (-1007.573) -- 0:00:43
787000 -- (-1007.082) [-1003.906] (-1010.447) (-1007.068) * (-1002.662) (-1020.606) [-1005.376] (-1007.202) -- 0:00:43
787500 -- (-1009.905) (-1006.481) [-1008.639] (-1005.337) * [-1003.687] (-1007.624) (-1007.369) (-1014.506) -- 0:00:42
788000 -- [-1007.702] (-1010.166) (-1009.821) (-1009.380) * (-1001.927) (-1014.083) [-1005.390] (-1003.675) -- 0:00:42
788500 -- (-1008.051) (-1002.624) (-1004.922) [-1003.085] * [-1005.132] (-1010.261) (-1005.265) (-1014.477) -- 0:00:42
789000 -- (-1007.646) [-1011.276] (-1006.979) (-1014.815) * [-1012.387] (-1008.604) (-1008.934) (-1013.438) -- 0:00:42
789500 -- (-1016.881) [-1005.279] (-1012.664) (-1014.274) * (-1004.208) [-1007.682] (-1006.750) (-1008.783) -- 0:00:42
790000 -- (-1008.998) [-1007.523] (-1007.195) (-1018.084) * [-1010.231] (-1007.480) (-1004.225) (-1008.677) -- 0:00:42
Average standard deviation of split frequencies: 0.003776
790500 -- (-1007.997) (-1007.312) (-1012.608) [-1011.784] * [-1013.052] (-1005.890) (-1012.522) (-1005.763) -- 0:00:42
791000 -- (-1011.228) [-1002.311] (-1007.060) (-1014.997) * [-1004.974] (-1004.083) (-1011.194) (-1011.224) -- 0:00:42
791500 -- [-1005.557] (-1001.590) (-1003.160) (-1010.306) * (-1006.858) (-1002.869) [-1006.112] (-1005.671) -- 0:00:42
792000 -- (-1005.810) (-1009.159) [-1003.464] (-1003.715) * (-1004.586) (-1004.523) [-1010.193] (-1010.851) -- 0:00:42
792500 -- [-1003.548] (-1010.501) (-1013.471) (-1018.292) * (-1008.588) (-1011.335) [-1009.784] (-1012.902) -- 0:00:41
793000 -- (-1005.517) (-1005.683) [-1006.786] (-1011.434) * (-1005.388) (-1005.967) [-1005.772] (-1008.718) -- 0:00:41
793500 -- (-1014.392) (-1006.370) (-1012.911) [-1004.311] * (-1009.984) (-1007.309) [-1005.988] (-1008.853) -- 0:00:41
794000 -- [-1007.352] (-1012.999) (-1004.298) (-1010.013) * (-1008.911) [-1007.269] (-1018.070) (-1004.062) -- 0:00:41
794500 -- [-1006.780] (-1010.380) (-1008.866) (-1011.053) * (-1011.193) (-1005.360) (-1012.848) [-1003.975] -- 0:00:41
795000 -- (-1002.038) (-1009.505) [-1014.084] (-1014.514) * [-1010.420] (-1006.098) (-1009.502) (-1009.214) -- 0:00:41
Average standard deviation of split frequencies: 0.003553
795500 -- [-1005.140] (-1011.287) (-1010.695) (-1010.321) * (-1012.810) (-1006.211) [-1007.505] (-1008.269) -- 0:00:41
796000 -- (-1010.387) (-1014.275) (-1006.347) [-1007.517] * (-1007.839) (-1009.275) [-1007.058] (-1003.119) -- 0:00:41
796500 -- (-1012.732) (-1007.957) [-1005.271] (-1008.417) * (-1006.048) (-1008.938) (-1007.184) [-1005.500] -- 0:00:41
797000 -- (-1008.502) [-1002.879] (-1001.524) (-1005.551) * (-1009.339) [-1005.775] (-1003.257) (-1004.470) -- 0:00:41
797500 -- (-1007.429) (-1006.022) (-1006.863) [-1007.308] * (-1009.574) (-1015.016) (-1008.960) [-1005.963] -- 0:00:40
798000 -- [-1011.331] (-1007.081) (-1008.958) (-1014.411) * (-1007.813) [-1012.436] (-1007.944) (-1009.611) -- 0:00:40
798500 -- [-1008.829] (-1008.246) (-1013.817) (-1019.239) * (-1009.544) [-1005.396] (-1009.928) (-1014.714) -- 0:00:40
799000 -- (-1006.181) (-1007.827) [-1000.787] (-1011.564) * (-1010.887) (-1007.313) (-1002.929) [-1004.178] -- 0:00:40
799500 -- (-1005.446) (-1011.936) [-1005.954] (-1004.030) * [-1012.019] (-1013.386) (-1011.266) (-1005.615) -- 0:00:40
800000 -- (-1005.111) [-1004.011] (-1006.552) (-1012.962) * (-1014.138) (-1009.637) [-1004.546] (-1006.937) -- 0:00:40
Average standard deviation of split frequencies: 0.003336
800500 -- (-1009.364) [-1006.237] (-1009.190) (-1008.085) * (-1010.377) (-1011.871) (-1009.981) [-1005.235] -- 0:00:40
801000 -- (-1004.358) (-1009.238) [-1012.416] (-1009.728) * (-1013.755) [-1005.337] (-1009.818) (-1001.827) -- 0:00:40
801500 -- (-1014.412) [-1013.257] (-1007.224) (-1007.905) * (-1005.402) (-1009.958) [-1004.222] (-1010.854) -- 0:00:40
802000 -- [-1008.504] (-1006.685) (-1008.771) (-1010.801) * (-1004.130) (-1019.007) (-1010.784) [-1006.300] -- 0:00:39
802500 -- [-1017.810] (-1012.477) (-1007.387) (-1004.670) * (-1004.760) (-1013.634) (-1006.235) [-1008.748] -- 0:00:39
803000 -- (-1012.896) (-1006.697) (-1003.273) [-1011.311] * (-1009.284) [-1007.379] (-1007.357) (-1018.459) -- 0:00:39
803500 -- (-1017.044) (-1011.883) [-1003.183] (-1012.305) * (-1009.263) (-1004.779) (-1011.819) [-1002.869] -- 0:00:39
804000 -- [-1009.802] (-1012.139) (-1015.304) (-1012.588) * (-1010.290) (-1011.614) [-1005.276] (-1007.762) -- 0:00:39
804500 -- [-1004.225] (-1008.300) (-1008.657) (-1009.903) * (-1003.447) (-1009.346) [-1005.947] (-1007.777) -- 0:00:39
805000 -- (-1012.619) [-1012.393] (-1006.198) (-1013.943) * [-1003.274] (-1016.770) (-1012.032) (-1010.253) -- 0:00:39
Average standard deviation of split frequencies: 0.003704
805500 -- (-1007.268) (-1014.864) (-1025.503) [-1006.658] * (-1008.902) [-1002.830] (-1002.467) (-1021.554) -- 0:00:39
806000 -- [-1007.336] (-1010.099) (-1016.266) (-1011.506) * [-1007.054] (-1009.429) (-1003.086) (-1011.545) -- 0:00:39
806500 -- [-1011.422] (-1007.952) (-1014.969) (-1010.518) * (-1006.422) (-1012.202) (-1008.677) [-1010.831] -- 0:00:39
807000 -- (-1005.419) [-1005.631] (-1005.415) (-1002.655) * (-1010.039) (-1016.650) [-1005.482] (-1015.187) -- 0:00:38
807500 -- (-1012.194) (-1004.364) [-1008.835] (-1011.926) * (-1013.451) (-1006.886) [-1008.014] (-1008.422) -- 0:00:38
808000 -- (-1010.901) (-1003.884) [-1010.950] (-1015.908) * (-1008.953) (-1009.821) [-1007.101] (-1016.165) -- 0:00:38
808500 -- (-1003.023) [-1008.529] (-1002.685) (-1013.069) * [-1006.744] (-1004.511) (-1008.154) (-1008.850) -- 0:00:38
809000 -- (-1016.827) (-1010.824) (-1005.302) [-1008.235] * (-1009.596) [-1008.363] (-1002.598) (-1009.340) -- 0:00:38
809500 -- [-1006.153] (-1001.777) (-1015.387) (-1006.820) * (-1005.576) [-1006.110] (-1010.283) (-1012.981) -- 0:00:38
810000 -- (-1007.948) (-1008.644) (-1011.968) [-1004.030] * (-1004.562) (-1009.114) (-1014.803) [-1005.239] -- 0:00:38
Average standard deviation of split frequencies: 0.004071
810500 -- (-1012.648) [-1008.152] (-1015.233) (-1008.342) * (-1006.198) [-1003.971] (-1003.316) (-1008.031) -- 0:00:38
811000 -- (-1015.495) [-1006.100] (-1023.861) (-1006.496) * (-1009.048) (-1010.127) (-1005.211) [-1010.299] -- 0:00:38
811500 -- (-1019.330) [-1005.291] (-1012.088) (-1004.441) * [-1007.603] (-1005.073) (-1004.747) (-1014.168) -- 0:00:38
812000 -- (-1019.630) (-1006.543) (-1005.093) [-1009.088] * [-1003.804] (-1005.779) (-1014.599) (-1012.020) -- 0:00:37
812500 -- (-1011.032) (-1002.729) [-1004.813] (-1008.319) * [-1006.672] (-1012.565) (-1008.638) (-1006.766) -- 0:00:37
813000 -- [-1011.354] (-1006.667) (-1010.271) (-1010.422) * [-1008.713] (-1006.636) (-1008.430) (-1012.275) -- 0:00:37
813500 -- (-1010.471) [-1003.241] (-1005.262) (-1006.146) * (-1004.100) [-1008.750] (-1003.753) (-1007.611) -- 0:00:37
814000 -- (-1007.924) (-1006.907) [-1007.778] (-1008.126) * (-1009.426) (-1017.141) [-1002.094] (-1005.909) -- 0:00:37
814500 -- [-1007.325] (-1012.534) (-1003.314) (-1003.842) * (-1000.840) [-1008.775] (-1009.430) (-1011.717) -- 0:00:37
815000 -- (-1005.684) (-1008.183) [-1006.773] (-1003.622) * (-1004.423) (-1009.520) (-1011.984) [-1005.942] -- 0:00:37
Average standard deviation of split frequencies: 0.004429
815500 -- [-999.463] (-1001.956) (-1012.987) (-1015.253) * (-1010.067) [-1007.780] (-1004.571) (-1005.910) -- 0:00:37
816000 -- (-1009.058) (-1012.794) [-1002.476] (-1007.822) * (-1007.835) (-1016.455) [-1004.494] (-1002.657) -- 0:00:37
816500 -- [-1009.605] (-1011.070) (-1006.766) (-1006.880) * (-1014.869) (-1005.122) (-1004.198) [-1004.408] -- 0:00:37
817000 -- (-1011.001) (-1014.665) (-1009.930) [-1007.685] * [-1008.496] (-1009.337) (-1011.624) (-1010.078) -- 0:00:36
817500 -- (-1010.441) (-1013.549) [-1006.291] (-1009.745) * [-1009.382] (-1002.695) (-1016.596) (-1012.473) -- 0:00:36
818000 -- (-1002.302) (-1014.422) [-1005.341] (-1012.426) * (-1010.757) (-1006.623) [-1010.373] (-1010.331) -- 0:00:36
818500 -- [-1003.991] (-1008.000) (-1005.079) (-1010.975) * (-1011.575) (-1005.505) [-1004.541] (-1011.688) -- 0:00:36
819000 -- (-1012.112) (-1015.202) [-1003.202] (-1007.690) * (-1011.186) (-1004.999) [-1011.335] (-1008.881) -- 0:00:36
819500 -- (-1019.329) [-1003.328] (-1000.753) (-1008.627) * [-1009.154] (-1011.279) (-1010.930) (-1011.329) -- 0:00:36
820000 -- (-1007.974) (-1010.261) [-1007.590] (-1006.106) * [-1016.224] (-1012.266) (-1006.702) (-1007.802) -- 0:00:36
Average standard deviation of split frequencies: 0.004212
820500 -- (-1008.020) (-1014.056) (-1013.593) [-1008.832] * [-1004.691] (-1006.881) (-1011.744) (-1003.495) -- 0:00:36
821000 -- (-1006.301) (-1005.569) (-1007.799) [-1009.375] * (-1005.077) (-1005.240) (-1011.465) [-1004.773] -- 0:00:36
821500 -- (-1002.802) [-1003.975] (-1007.554) (-1013.428) * (-1008.441) (-1010.857) [-1005.735] (-1006.302) -- 0:00:36
822000 -- (-1007.652) [-1006.055] (-1010.999) (-1012.693) * (-1017.272) (-1003.845) (-1014.325) [-1005.004] -- 0:00:35
822500 -- (-1005.515) (-1012.734) (-1007.022) [-1007.745] * (-1014.252) (-1008.880) [-1009.628] (-1010.700) -- 0:00:35
823000 -- [-1009.445] (-1003.788) (-1007.528) (-1008.370) * (-1010.660) [-1006.453] (-1015.420) (-1008.941) -- 0:00:35
823500 -- (-1009.906) (-1008.323) (-1004.838) [-1002.678] * (-1015.040) [-1007.163] (-1005.911) (-1011.642) -- 0:00:35
824000 -- (-1006.081) (-1006.485) (-1005.104) [-1004.925] * [-1005.359] (-1010.995) (-1001.162) (-1006.185) -- 0:00:35
824500 -- (-1011.631) (-1004.012) [-1007.591] (-1001.693) * (-1013.296) (-1006.010) (-1009.335) [-1006.439] -- 0:00:35
825000 -- (-1007.641) (-1008.252) [-1005.340] (-1004.482) * (-1017.427) (-1003.845) [-1006.747] (-1009.711) -- 0:00:35
Average standard deviation of split frequencies: 0.004375
825500 -- (-1006.106) [-1009.129] (-1006.806) (-1014.024) * [-1009.446] (-1008.545) (-1007.646) (-1006.846) -- 0:00:35
826000 -- (-1005.128) [-1005.866] (-1007.419) (-1005.822) * (-1009.820) (-1011.453) (-1009.417) [-1003.274] -- 0:00:35
826500 -- (-1007.861) (-1008.307) (-1004.088) [-1005.732] * (-1011.174) [-1017.004] (-1013.385) (-1007.502) -- 0:00:35
827000 -- [-1008.691] (-1007.883) (-1009.079) (-1002.598) * [-1006.189] (-1005.344) (-1008.070) (-1016.034) -- 0:00:34
827500 -- (-1005.489) [-1005.336] (-1002.392) (-1005.597) * (-1006.124) (-1006.205) [-1006.991] (-1012.963) -- 0:00:34
828000 -- [-1006.935] (-1005.665) (-1003.534) (-1013.630) * (-1004.924) (-1001.985) [-1004.185] (-1010.612) -- 0:00:34
828500 -- [-1004.107] (-1009.443) (-1011.283) (-1007.043) * (-1012.579) (-1011.514) (-1010.478) [-1005.891] -- 0:00:34
829000 -- (-1009.933) (-1010.595) [-1012.579] (-1002.934) * (-1007.080) [-1007.077] (-1008.235) (-1008.651) -- 0:00:34
829500 -- (-1006.194) (-1008.672) [-1004.111] (-1005.590) * (-1003.334) [-1010.713] (-1008.493) (-1013.603) -- 0:00:34
830000 -- (-1005.107) (-1004.984) [-1008.979] (-1011.968) * (-1000.286) (-1009.307) (-1009.865) [-1004.351] -- 0:00:34
Average standard deviation of split frequencies: 0.004918
830500 -- (-1015.907) [-1003.609] (-1004.982) (-1006.556) * [-1006.490] (-1007.627) (-1011.350) (-1014.337) -- 0:00:34
831000 -- (-1010.810) (-1007.337) (-1012.304) [-1008.138] * (-1015.016) (-1006.658) (-1002.713) [-1004.557] -- 0:00:34
831500 -- (-1008.866) (-1009.971) (-1010.318) [-1002.664] * (-1013.422) [-1005.204] (-1012.580) (-1007.480) -- 0:00:34
832000 -- (-1005.844) (-1006.822) (-1007.381) [-1003.651] * (-1012.097) [-1005.287] (-1007.187) (-1004.992) -- 0:00:33
832500 -- (-1015.611) (-1007.529) [-1004.863] (-1006.939) * (-1014.737) (-1008.768) (-1012.150) [-1006.413] -- 0:00:33
833000 -- (-1005.623) (-1012.523) [-1003.316] (-1007.511) * (-1008.949) (-1005.179) [-1013.931] (-1005.529) -- 0:00:33
833500 -- [-1003.011] (-1010.570) (-1004.601) (-1000.956) * [-1009.311] (-1008.642) (-1008.328) (-1005.053) -- 0:00:33
834000 -- [-1008.563] (-1012.271) (-1006.624) (-1009.508) * [-1007.195] (-1016.072) (-1011.067) (-1005.416) -- 0:00:33
834500 -- (-1008.232) (-1005.027) [-1007.387] (-1011.441) * (-1012.662) (-1007.771) [-1010.255] (-1012.071) -- 0:00:33
835000 -- (-1011.819) [-1008.173] (-1008.631) (-1004.862) * [-1007.784] (-1012.528) (-1008.870) (-1018.442) -- 0:00:33
Average standard deviation of split frequencies: 0.004323
835500 -- [-1008.219] (-1008.504) (-1009.563) (-1003.512) * [-1016.921] (-1020.610) (-1012.304) (-1012.872) -- 0:00:33
836000 -- (-1005.775) (-1005.519) [-1003.883] (-1006.267) * (-1013.610) (-1004.252) [-1003.063] (-1014.886) -- 0:00:33
836500 -- (-1012.138) [-1008.844] (-1003.454) (-1010.825) * (-1008.323) [-1011.834] (-1011.065) (-1010.641) -- 0:00:33
837000 -- (-1006.925) (-1007.433) (-1005.019) [-1002.117] * [-1003.361] (-1008.888) (-1009.713) (-1012.629) -- 0:00:32
837500 -- (-1014.213) (-1010.483) (-1003.052) [-1004.102] * (-1004.469) [-1007.989] (-1007.541) (-1011.278) -- 0:00:32
838000 -- [-1010.864] (-1013.512) (-1008.242) (-1001.918) * (-1007.868) (-1011.005) [-1009.472] (-1010.648) -- 0:00:32
838500 -- (-1012.058) (-1010.035) [-1005.447] (-1012.194) * (-1012.503) (-1008.376) (-1008.433) [-1006.124] -- 0:00:32
839000 -- [-1007.144] (-1010.281) (-1004.210) (-1009.730) * (-1010.044) (-1005.638) (-1005.405) [-1009.413] -- 0:00:32
839500 -- (-1019.019) [-1011.137] (-1008.044) (-1002.917) * [-1004.031] (-1017.793) (-1002.568) (-1005.371) -- 0:00:32
840000 -- (-1001.558) (-1004.816) [-1003.445] (-1006.232) * (-1005.442) [-1005.730] (-1003.113) (-1018.480) -- 0:00:32
Average standard deviation of split frequencies: 0.004112
840500 -- (-1006.142) [-1008.533] (-1011.610) (-1006.062) * (-1011.562) [-1008.778] (-1009.978) (-1010.029) -- 0:00:32
841000 -- (-1008.438) (-1009.322) (-1005.783) [-1005.317] * (-1011.428) (-1013.360) (-1012.973) [-1009.369] -- 0:00:32
841500 -- [-1002.615] (-1011.207) (-1011.540) (-1010.512) * (-1018.843) [-1010.742] (-1009.337) (-1007.352) -- 0:00:32
842000 -- [-1002.109] (-1003.752) (-1011.644) (-1005.016) * [-1007.308] (-1004.084) (-1006.587) (-1006.381) -- 0:00:31
842500 -- (-1003.003) (-1008.786) [-1006.106] (-1004.011) * [-1009.981] (-1013.746) (-1009.353) (-1004.924) -- 0:00:31
843000 -- [-1003.902] (-1010.803) (-1007.572) (-1001.641) * [-1008.108] (-1009.078) (-1002.738) (-1010.492) -- 0:00:31
843500 -- (-1006.494) [-1004.714] (-1003.913) (-1006.114) * [-1012.393] (-1007.937) (-1005.023) (-1005.024) -- 0:00:31
844000 -- (-1004.464) (-1005.251) [-1007.751] (-1003.842) * (-1016.124) [-1007.010] (-1004.861) (-1015.319) -- 0:00:31
844500 -- [-1006.284] (-1004.328) (-1014.179) (-1007.839) * (-1014.127) (-1009.438) (-1015.495) [-1006.230] -- 0:00:31
845000 -- [-1007.223] (-1003.627) (-1005.118) (-1005.896) * (-1016.873) (-1006.900) [-1003.976] (-1010.518) -- 0:00:31
Average standard deviation of split frequencies: 0.004086
845500 -- [-1010.712] (-1010.470) (-1008.835) (-1012.438) * (-1012.439) [-1009.249] (-1006.080) (-1014.765) -- 0:00:31
846000 -- (-1002.279) [-1002.914] (-1017.525) (-1008.846) * (-1012.547) (-1009.755) (-1009.610) [-1008.485] -- 0:00:31
846500 -- (-1003.371) (-1009.979) [-1006.324] (-1013.556) * (-1009.325) (-1009.585) (-1013.139) [-1010.604] -- 0:00:31
847000 -- [-1007.143] (-1012.872) (-1004.292) (-1006.975) * (-1003.102) (-1003.854) (-1005.547) [-1005.423] -- 0:00:30
847500 -- [-1016.974] (-1007.399) (-1010.090) (-1012.560) * (-1005.646) [-1006.340] (-1008.005) (-1004.833) -- 0:00:30
848000 -- (-1007.924) (-1008.493) (-1006.837) [-1005.969] * (-1009.569) (-1009.656) [-1015.390] (-1006.993) -- 0:00:30
848500 -- (-1010.164) (-1001.980) (-1015.404) [-1006.863] * (-1009.648) (-1010.973) [-1004.884] (-1007.109) -- 0:00:30
849000 -- [-1010.368] (-1008.892) (-1009.457) (-1009.717) * (-1010.909) (-1010.174) [-1010.753] (-1012.219) -- 0:00:30
849500 -- (-1020.567) (-1004.275) (-1005.265) [-1004.107] * (-1015.001) (-1009.945) (-1013.112) [-1006.770] -- 0:00:30
850000 -- (-1007.740) [-1006.786] (-1002.210) (-1011.022) * (-1011.588) (-1011.668) (-1015.080) [-1008.842] -- 0:00:30
Average standard deviation of split frequencies: 0.003879
850500 -- [-1003.285] (-1005.693) (-1008.825) (-1012.566) * (-1009.382) (-1007.455) [-1009.468] (-1009.248) -- 0:00:30
851000 -- (-1006.396) (-1005.499) [-1009.724] (-1008.542) * (-1021.313) (-1009.529) [-1011.833] (-1009.840) -- 0:00:30
851500 -- [-1004.691] (-1009.947) (-1007.625) (-1007.548) * (-1019.068) [-1004.462] (-1016.807) (-1012.995) -- 0:00:29
852000 -- (-1004.513) [-1001.455] (-1006.139) (-1006.878) * (-1004.335) (-1003.378) (-1018.525) [-1006.606] -- 0:00:29
852500 -- [-1003.439] (-1013.395) (-1015.215) (-1008.928) * [-1009.910] (-1002.818) (-1022.227) (-1014.540) -- 0:00:29
853000 -- (-1008.942) [-1008.507] (-1011.020) (-1004.685) * (-1009.532) [-1002.802] (-1010.215) (-1013.951) -- 0:00:29
853500 -- (-1004.177) (-1005.810) (-1008.078) [-1006.327] * (-1010.512) [-1007.260] (-1012.081) (-1010.168) -- 0:00:29
854000 -- (-1007.626) [-1003.583] (-1013.148) (-1018.316) * (-1005.501) [-1008.884] (-1010.631) (-1007.915) -- 0:00:29
854500 -- (-1004.935) (-1005.447) (-1010.043) [-1007.856] * (-1009.714) (-1009.161) [-1006.121] (-1009.488) -- 0:00:29
855000 -- (-1004.647) [-1007.832] (-1008.905) (-1006.635) * (-1011.946) [-1013.147] (-1007.245) (-1010.467) -- 0:00:29
Average standard deviation of split frequencies: 0.003488
855500 -- [-1005.736] (-1013.316) (-1007.978) (-1006.919) * (-1013.839) (-1009.155) (-1011.803) [-1008.238] -- 0:00:29
856000 -- (-1011.643) (-1014.588) [-1009.978] (-1020.376) * (-1009.950) (-1008.835) [-1012.475] (-1007.087) -- 0:00:29
856500 -- (-1014.132) (-1014.824) (-1023.665) [-1013.761] * (-1010.286) [-1006.979] (-1004.141) (-1011.128) -- 0:00:28
857000 -- (-1014.969) (-1012.771) (-1005.184) [-1006.824] * (-1010.601) (-1009.112) (-1004.375) [-1008.498] -- 0:00:28
857500 -- (-1004.111) [-1003.143] (-1002.937) (-1008.877) * (-1008.222) (-1011.253) (-1017.669) [-1010.436] -- 0:00:28
858000 -- (-1012.564) (-1001.188) [-1006.404] (-1008.998) * (-1016.337) (-1005.624) (-1012.517) [-1006.317] -- 0:00:28
858500 -- [-1009.936] (-1011.788) (-1006.137) (-1019.775) * [-1013.135] (-1008.297) (-1007.770) (-1007.783) -- 0:00:28
859000 -- (-1007.034) (-1009.397) [-1011.465] (-1005.640) * (-1012.598) [-1004.411] (-1008.597) (-1009.568) -- 0:00:28
859500 -- (-1004.202) [-1010.702] (-1010.699) (-1009.306) * (-1008.400) (-1005.819) [-1012.469] (-1014.284) -- 0:00:28
860000 -- (-1007.774) (-1012.722) [-1001.312] (-1008.612) * (-1012.031) [-1005.621] (-1009.280) (-1009.449) -- 0:00:28
Average standard deviation of split frequencies: 0.003286
860500 -- [-1005.258] (-1006.148) (-1010.911) (-1010.026) * (-1009.893) (-1006.858) [-1006.764] (-1006.259) -- 0:00:28
861000 -- (-1006.819) [-1010.905] (-1013.837) (-1009.826) * (-1009.807) (-1012.578) [-1002.692] (-1002.318) -- 0:00:28
861500 -- (-1010.898) [-1005.531] (-1006.807) (-1013.588) * (-1013.181) (-1012.832) [-1002.045] (-1010.878) -- 0:00:27
862000 -- (-1011.751) (-1010.746) [-1007.279] (-1010.840) * (-1012.705) (-1004.908) (-1012.169) [-1005.572] -- 0:00:27
862500 -- [-1004.805] (-1011.430) (-1013.928) (-1001.698) * (-1005.954) (-1008.200) (-1006.817) [-1003.325] -- 0:00:27
863000 -- (-1002.607) (-1013.094) [-1008.946] (-1006.414) * (-1004.372) (-1005.057) (-1007.341) [-1005.109] -- 0:00:27
863500 -- [-1012.024] (-1009.931) (-1018.552) (-1006.605) * [-1005.074] (-1007.059) (-1007.308) (-1009.684) -- 0:00:27
864000 -- (-1011.198) (-1012.612) (-1006.103) [-1007.169] * (-1004.135) (-1004.493) [-1006.337] (-1009.428) -- 0:00:27
864500 -- [-1008.683] (-1008.498) (-1010.695) (-1010.359) * (-1005.975) [-1003.296] (-1011.507) (-1005.461) -- 0:00:27
865000 -- (-1006.644) (-1008.789) [-1001.511] (-1016.278) * (-1007.848) [-1007.973] (-1006.765) (-1013.151) -- 0:00:27
Average standard deviation of split frequencies: 0.003266
865500 -- [-1014.020] (-1009.901) (-1007.836) (-1019.712) * (-1019.146) (-1012.777) (-1008.742) [-1010.107] -- 0:00:27
866000 -- (-1002.334) [-1008.270] (-1003.557) (-1011.036) * (-1015.556) (-1012.598) (-1007.631) [-1007.951] -- 0:00:27
866500 -- (-1006.024) (-1012.944) [-1001.902] (-1007.137) * (-1014.143) (-1008.982) (-1006.431) [-1015.586] -- 0:00:26
867000 -- [-1000.485] (-1007.681) (-1012.737) (-1012.791) * (-1011.984) (-1008.235) [-1007.194] (-1007.577) -- 0:00:26
867500 -- (-1008.111) (-1010.098) [-1011.032] (-1009.109) * (-1011.684) [-1001.617] (-1010.712) (-1010.706) -- 0:00:26
868000 -- (-1014.496) (-1006.565) [-1003.931] (-1008.912) * [-1008.861] (-1015.015) (-1009.838) (-1003.458) -- 0:00:26
868500 -- (-1006.887) (-1009.769) (-1004.827) [-1004.420] * [-1005.174] (-1018.195) (-1005.991) (-1003.586) -- 0:00:26
869000 -- (-1011.265) (-1007.443) [-1012.988] (-1012.141) * (-1011.954) (-1011.381) (-1005.131) [-1002.818] -- 0:00:26
869500 -- (-1016.434) (-1004.666) [-1010.411] (-1008.189) * (-1009.603) (-1011.315) [-1008.020] (-1001.444) -- 0:00:26
870000 -- (-1008.113) (-1009.665) (-1016.447) [-1005.750] * [-1006.024] (-1018.157) (-1010.980) (-1012.264) -- 0:00:26
Average standard deviation of split frequencies: 0.003429
870500 -- (-1006.894) (-1004.579) (-1023.190) [-1006.120] * [-1003.489] (-1009.795) (-1007.371) (-1004.535) -- 0:00:26
871000 -- (-1008.283) (-1009.182) (-1014.428) [-1006.396] * (-1007.742) (-1013.382) (-1014.131) [-1011.847] -- 0:00:26
871500 -- (-1008.137) (-1005.213) (-1014.902) [-1002.104] * (-1007.588) (-1008.353) [-1006.253] (-1009.708) -- 0:00:25
872000 -- (-1004.669) [-1005.453] (-1012.899) (-1015.218) * (-1008.210) (-1008.481) [-1003.956] (-1004.622) -- 0:00:25
872500 -- (-1008.769) [-1006.934] (-1007.846) (-1005.912) * [-1010.088] (-1003.846) (-1008.564) (-1011.189) -- 0:00:25
873000 -- (-1011.291) (-1015.085) [-1010.908] (-1005.049) * (-1000.952) [-1004.204] (-1013.863) (-1011.040) -- 0:00:25
873500 -- (-1014.890) (-1011.113) (-1004.808) [-1007.640] * (-1006.763) (-1007.087) (-1005.689) [-1003.602] -- 0:00:25
874000 -- (-1010.113) (-1006.657) (-1006.495) [-1004.305] * (-1014.967) (-1010.498) (-1010.599) [-1001.870] -- 0:00:25
874500 -- (-1009.962) (-1005.430) [-1009.177] (-1017.568) * [-1010.960] (-1010.674) (-1004.256) (-1007.349) -- 0:00:25
875000 -- (-1009.016) [-1001.450] (-1001.872) (-1006.276) * (-1002.788) (-1005.781) (-1009.324) [-1004.753] -- 0:00:25
Average standard deviation of split frequencies: 0.003408
875500 -- [-1006.948] (-1014.057) (-1009.221) (-1010.842) * (-1006.350) [-1006.007] (-1012.733) (-1010.879) -- 0:00:25
876000 -- (-1006.796) (-1008.631) [-1005.754] (-1006.686) * (-1008.448) [-1005.961] (-1006.297) (-1006.345) -- 0:00:25
876500 -- (-1002.580) (-1008.634) (-1004.181) [-1004.828] * [-1003.216] (-1007.202) (-1015.378) (-1001.620) -- 0:00:24
877000 -- (-1001.353) (-1008.006) [-1004.963] (-1013.844) * (-1007.955) (-1015.969) [-1013.599] (-1010.662) -- 0:00:24
877500 -- (-1001.659) (-1010.840) (-1007.991) [-1003.574] * [-1004.062] (-1014.149) (-1008.989) (-1009.792) -- 0:00:24
878000 -- [-1002.020] (-1005.144) (-1003.651) (-1004.470) * (-1006.637) (-1005.680) (-1009.515) [-1004.547] -- 0:00:24
878500 -- [-1007.224] (-1009.408) (-1009.446) (-1006.419) * (-1007.439) [-1004.950] (-1010.445) (-1006.208) -- 0:00:24
879000 -- (-1008.875) (-1006.756) [-1009.266] (-1016.781) * (-1006.020) (-1009.688) (-1010.670) [-1006.849] -- 0:00:24
879500 -- (-1003.749) [-1005.986] (-1012.075) (-1009.059) * [-1004.285] (-1004.487) (-1005.015) (-1001.282) -- 0:00:24
880000 -- (-1010.125) (-1010.895) (-1012.013) [-1010.202] * (-1013.865) (-1010.399) (-1006.832) [-1003.609] -- 0:00:24
Average standard deviation of split frequencies: 0.003390
880500 -- (-1008.708) (-1005.019) [-1009.139] (-1009.826) * (-1006.335) [-1007.917] (-1004.996) (-1009.774) -- 0:00:24
881000 -- (-1005.388) (-1007.371) [-1006.338] (-1010.731) * (-1005.785) (-1010.892) [-1001.058] (-1013.943) -- 0:00:24
881500 -- (-1010.287) (-1009.312) [-1007.188] (-1012.203) * (-1010.399) [-1006.400] (-1015.567) (-1005.771) -- 0:00:23
882000 -- (-1009.578) (-1005.785) [-1006.614] (-1004.744) * [-1008.580] (-1007.159) (-1012.544) (-1011.639) -- 0:00:23
882500 -- (-1006.433) (-1009.938) [-1004.874] (-1015.416) * (-1008.743) [-1011.856] (-1011.209) (-1006.410) -- 0:00:23
883000 -- [-1011.968] (-1013.212) (-1007.853) (-1010.056) * (-1006.760) (-1009.718) [-1009.296] (-1002.287) -- 0:00:23
883500 -- [-1009.764] (-1010.416) (-1011.231) (-1006.972) * (-1004.525) (-1012.723) [-1006.422] (-1003.579) -- 0:00:23
884000 -- (-1007.611) (-1010.797) (-1006.271) [-1009.754] * [-1008.324] (-1006.311) (-1006.126) (-1017.043) -- 0:00:23
884500 -- (-1014.294) (-1015.511) [-1005.716] (-1011.669) * (-1005.933) (-1007.072) [-1008.614] (-1007.322) -- 0:00:23
885000 -- [-1011.418] (-1007.813) (-1010.903) (-1008.223) * (-1011.915) (-1007.588) [-1006.821] (-1010.132) -- 0:00:23
Average standard deviation of split frequencies: 0.003192
885500 -- (-1014.279) (-1009.629) [-1014.788] (-1007.626) * (-1004.109) (-1007.917) [-1010.740] (-1008.510) -- 0:00:23
886000 -- (-1005.109) [-1002.398] (-1014.751) (-1007.187) * (-1006.538) (-1007.418) [-1007.198] (-1011.694) -- 0:00:23
886500 -- (-1005.932) (-1003.986) [-1012.380] (-1006.347) * (-1005.945) (-1014.990) [-1007.110] (-1011.891) -- 0:00:22
887000 -- [-1005.737] (-1005.790) (-1006.741) (-1005.121) * [-1009.223] (-1014.045) (-1009.017) (-1003.443) -- 0:00:22
887500 -- [-1010.072] (-1007.454) (-1011.656) (-1007.150) * (-1013.407) [-1011.329] (-1013.211) (-1007.960) -- 0:00:22
888000 -- (-1016.011) (-1005.346) [-1011.280] (-1010.405) * (-1007.741) (-1009.744) (-1012.822) [-1003.007] -- 0:00:22
888500 -- (-1012.573) [-1002.241] (-1021.250) (-1007.267) * (-1008.083) (-1008.105) [-1011.187] (-1009.696) -- 0:00:22
889000 -- (-1003.316) (-1007.303) [-1006.531] (-1012.390) * [-1006.935] (-1010.026) (-1009.120) (-1006.661) -- 0:00:22
889500 -- (-1005.334) (-1011.483) (-1008.644) [-1002.578] * [-1005.110] (-1023.124) (-1006.673) (-1002.979) -- 0:00:22
890000 -- (-1005.690) (-1007.232) (-1008.766) [-1005.521] * (-1011.188) (-1009.477) [-1007.414] (-1009.234) -- 0:00:22
Average standard deviation of split frequencies: 0.003176
890500 -- [-1002.182] (-1013.160) (-1006.856) (-1009.649) * (-1020.655) (-1014.606) (-1007.557) [-1005.417] -- 0:00:22
891000 -- [-1005.664] (-1007.490) (-1014.508) (-1009.256) * [-1015.332] (-1006.678) (-1008.059) (-1008.282) -- 0:00:22
891500 -- [-1005.364] (-1008.274) (-1005.685) (-1000.239) * (-1018.840) (-1009.709) [-1005.964] (-1007.693) -- 0:00:21
892000 -- (-1004.752) [-1010.195] (-1007.273) (-1012.016) * (-1012.426) [-1010.258] (-1001.859) (-1009.950) -- 0:00:21
892500 -- [-1004.885] (-1007.816) (-1008.796) (-1005.915) * (-1007.338) (-1010.478) [-1008.307] (-1014.901) -- 0:00:21
893000 -- (-1011.402) (-1006.214) [-1007.043] (-1007.936) * (-1011.345) [-1011.953] (-1012.271) (-1018.690) -- 0:00:21
893500 -- (-1008.063) [-1004.868] (-1011.825) (-1005.864) * (-1010.384) [-1004.080] (-1009.940) (-1011.687) -- 0:00:21
894000 -- (-1017.066) [-1006.858] (-1005.695) (-1002.375) * (-1010.274) (-1007.740) [-1009.050] (-1008.027) -- 0:00:21
894500 -- [-1005.945] (-1009.076) (-1013.133) (-1012.219) * (-1004.325) (-1012.671) (-1009.737) [-1003.713] -- 0:00:21
895000 -- (-1004.757) (-1009.407) (-1003.777) [-1002.278] * [-1011.083] (-1006.783) (-1005.485) (-1004.715) -- 0:00:21
Average standard deviation of split frequencies: 0.003157
895500 -- [-1006.171] (-1004.765) (-1014.722) (-1005.955) * [-1008.512] (-1010.747) (-1008.173) (-1009.257) -- 0:00:21
896000 -- (-1007.865) (-1006.534) [-1009.995] (-1006.683) * [-1007.106] (-1014.444) (-1009.686) (-1012.520) -- 0:00:20
896500 -- (-1008.223) (-1005.974) (-1007.103) [-1007.251] * (-1010.078) [-1007.383] (-1012.472) (-999.911) -- 0:00:20
897000 -- (-1006.919) (-1009.059) [-1003.143] (-1005.920) * (-1009.544) (-1011.410) [-1004.081] (-1012.396) -- 0:00:20
897500 -- (-1008.377) (-1010.363) [-1002.345] (-1012.900) * (-1005.472) (-1009.950) (-1007.693) [-1007.506] -- 0:00:20
898000 -- (-1008.821) (-1008.710) [-1006.789] (-1015.031) * [-1007.944] (-1011.350) (-1012.786) (-1013.606) -- 0:00:20
898500 -- (-1007.568) (-1008.893) (-1012.728) [-1016.942] * [-1007.885] (-1008.460) (-1011.323) (-1009.231) -- 0:00:20
899000 -- (-1005.000) (-1005.685) (-1010.887) [-1004.343] * (-1010.329) [-1003.989] (-1006.792) (-1009.526) -- 0:00:20
899500 -- [-1004.347] (-1008.751) (-1010.026) (-1007.853) * (-1008.132) (-1004.756) [-1006.544] (-1007.401) -- 0:00:20
900000 -- [-1005.507] (-1005.927) (-1007.201) (-1006.959) * (-1007.666) (-1007.342) (-1010.330) [-1003.486] -- 0:00:20
Average standard deviation of split frequencies: 0.002966
900500 -- (-1008.027) (-1004.985) [-1003.061] (-1015.150) * [-1005.102] (-1001.950) (-1006.177) (-1017.537) -- 0:00:19
901000 -- (-1001.997) [-1005.097] (-1005.137) (-1005.979) * (-1007.556) [-1007.425] (-1011.857) (-1006.159) -- 0:00:19
901500 -- (-1006.021) (-1004.542) [-1005.424] (-1012.080) * (-1009.387) (-1003.945) [-1008.440] (-1012.262) -- 0:00:19
902000 -- (-1010.623) (-1007.114) (-1005.098) [-1004.442] * (-1011.556) (-1004.085) (-1008.557) [-1007.871] -- 0:00:19
902500 -- (-1004.468) (-1003.197) (-1011.827) [-1002.264] * (-1011.309) (-1009.685) [-1003.054] (-1010.563) -- 0:00:19
903000 -- (-1006.886) (-1013.525) (-1006.082) [-1009.508] * [-1003.741] (-1007.652) (-1010.031) (-1002.778) -- 0:00:19
903500 -- [-1015.387] (-1015.784) (-1004.497) (-999.999) * (-1005.788) (-1005.946) [-1016.369] (-1010.243) -- 0:00:19
904000 -- (-1014.006) (-1007.472) [-1003.728] (-1007.202) * (-1014.237) (-1003.498) [-1008.516] (-1007.222) -- 0:00:19
904500 -- (-1011.856) (-1010.794) (-1010.018) [-1007.053] * (-1012.987) [-1001.435] (-1012.649) (-1004.972) -- 0:00:19
905000 -- (-1005.408) (-1008.547) [-1007.555] (-1002.333) * (-1019.597) [-1008.989] (-1011.651) (-1006.422) -- 0:00:19
Average standard deviation of split frequencies: 0.003295
905500 -- (-1004.785) (-1011.017) (-1006.254) [-1004.173] * [-1008.607] (-1010.456) (-1009.043) (-1006.120) -- 0:00:18
906000 -- (-1006.851) (-1013.258) [-1002.786] (-1008.857) * (-1010.487) (-1013.635) (-1008.422) [-1007.251] -- 0:00:18
906500 -- (-1008.745) (-1009.511) (-1015.488) [-1007.389] * [-1008.624] (-1005.311) (-1008.089) (-1008.256) -- 0:00:18
907000 -- (-1014.171) [-1008.788] (-1011.817) (-1009.844) * (-1010.409) [-1003.690] (-1012.654) (-1008.302) -- 0:00:18
907500 -- (-1019.039) (-1006.385) [-1005.981] (-1009.795) * [-1004.710] (-1010.510) (-1014.179) (-1009.518) -- 0:00:18
908000 -- (-1003.779) [-1003.210] (-1014.478) (-1009.051) * [-1008.855] (-1009.715) (-1014.233) (-1008.950) -- 0:00:18
908500 -- (-1008.449) [-1004.629] (-1009.451) (-1008.111) * (-1008.112) (-1011.193) [-1008.754] (-1008.469) -- 0:00:18
909000 -- (-1008.323) (-1002.352) (-1006.952) [-1003.858] * (-1009.916) (-1011.223) (-1010.458) [-1002.306] -- 0:00:18
909500 -- (-1007.392) [-1007.986] (-1010.354) (-1008.607) * (-1008.666) (-1005.595) (-1007.519) [-1005.192] -- 0:00:18
910000 -- (-1006.135) (-1011.713) [-1005.295] (-1009.072) * (-1009.295) (-1001.442) [-1009.877] (-1002.318) -- 0:00:18
Average standard deviation of split frequencies: 0.003278
910500 -- (-1003.932) (-1003.832) [-1003.538] (-1012.580) * (-1008.981) [-1009.782] (-1016.348) (-1010.328) -- 0:00:17
911000 -- [-1005.872] (-1009.402) (-1008.281) (-1009.104) * (-1011.099) [-1002.440] (-1014.417) (-1012.647) -- 0:00:17
911500 -- (-1010.140) [-1008.180] (-1009.515) (-1008.685) * [-1004.695] (-1002.715) (-1011.345) (-1012.962) -- 0:00:17
912000 -- (-1004.567) (-1007.147) (-1010.279) [-1008.232] * (-1010.209) (-1007.053) [-1011.530] (-1018.679) -- 0:00:17
912500 -- [-1009.638] (-1001.999) (-1008.372) (-1010.895) * [-1007.523] (-1006.663) (-1014.305) (-1016.281) -- 0:00:17
913000 -- (-1008.205) [-1000.962] (-1009.952) (-1005.953) * (-1013.943) [-1011.774] (-1014.046) (-1015.339) -- 0:00:17
913500 -- (-1011.210) [-1005.170] (-1009.789) (-1005.530) * (-1004.723) (-1009.992) [-1007.351] (-1009.569) -- 0:00:17
914000 -- [-1010.049] (-1006.512) (-1007.839) (-1013.051) * (-1009.373) [-1005.781] (-1010.936) (-1005.922) -- 0:00:17
914500 -- [-1007.343] (-1000.492) (-1006.678) (-1014.049) * (-1007.386) (-1014.378) [-1006.359] (-1009.530) -- 0:00:17
915000 -- (-1010.962) (-1007.494) [-1003.975] (-1007.281) * (-1007.439) (-1009.009) (-1005.956) [-1004.977] -- 0:00:17
Average standard deviation of split frequencies: 0.003431
915500 -- (-1013.081) [-1003.986] (-1020.723) (-1007.878) * [-1002.762] (-1018.185) (-1009.083) (-1008.917) -- 0:00:16
916000 -- (-1012.153) [-1006.375] (-1013.874) (-1008.201) * [-1003.822] (-1009.130) (-1010.818) (-1008.407) -- 0:00:16
916500 -- (-1005.062) [-1005.688] (-1004.943) (-1004.687) * (-1012.100) [-1004.487] (-1012.408) (-1005.360) -- 0:00:16
917000 -- (-1007.380) [-1005.985] (-1008.003) (-1007.108) * (-1007.776) (-1009.914) (-1010.445) [-1006.634] -- 0:00:16
917500 -- (-1003.266) (-1011.702) (-1011.853) [-1007.277] * (-1012.115) [-1003.866] (-1009.146) (-1007.155) -- 0:00:16
918000 -- (-1006.488) (-1004.377) [-1002.348] (-1007.071) * (-1013.550) (-1009.688) [-1008.878] (-1013.546) -- 0:00:16
918500 -- (-1009.969) [-1005.457] (-1015.320) (-1011.503) * (-1007.807) (-1013.282) [-1005.063] (-1011.249) -- 0:00:16
919000 -- (-1011.263) (-1006.318) [-1004.134] (-1007.074) * (-1008.182) (-1009.947) [-1001.571] (-1011.269) -- 0:00:16
919500 -- (-1008.152) (-1012.358) [-1004.904] (-1008.221) * (-1010.580) (-1011.656) (-1010.694) [-1012.634] -- 0:00:16
920000 -- [-1001.660] (-1007.189) (-1010.429) (-1008.990) * (-1013.136) (-1013.022) [-1008.274] (-1007.184) -- 0:00:16
Average standard deviation of split frequencies: 0.003243
920500 -- (-1006.661) (-1005.980) [-1007.802] (-1006.630) * (-1009.252) (-1008.752) (-1012.849) [-1008.532] -- 0:00:15
921000 -- (-1006.213) (-1008.651) [-1006.676] (-1014.967) * (-1009.770) (-1005.652) [-1001.911] (-1006.884) -- 0:00:15
921500 -- (-1010.261) [-1011.945] (-1004.383) (-1011.879) * (-1006.739) (-1005.722) [-1002.675] (-1010.256) -- 0:00:15
922000 -- (-1008.122) (-1008.019) (-1003.800) [-1006.538] * (-1007.885) (-1013.754) (-1012.010) [-1010.058] -- 0:00:15
922500 -- (-1011.897) (-1013.734) [-1005.968] (-1007.760) * (-1012.107) (-1008.030) [-1005.179] (-1009.626) -- 0:00:15
923000 -- (-1007.425) (-1008.183) (-1009.143) [-1010.228] * (-1010.301) (-1013.170) [-1007.653] (-1009.642) -- 0:00:15
923500 -- (-1022.294) (-1005.711) [-1004.906] (-1009.366) * (-1005.904) [-1008.209] (-1003.099) (-1011.468) -- 0:00:15
924000 -- (-1022.108) [-1010.958] (-1013.866) (-1002.414) * (-1011.409) (-1008.091) [-1012.311] (-1008.455) -- 0:00:15
924500 -- (-1007.513) (-1007.050) (-1008.891) [-1003.838] * (-1015.033) (-1004.067) (-1007.347) [-1006.795] -- 0:00:15
925000 -- (-1020.570) (-1005.147) (-1010.738) [-1013.375] * (-1010.194) [-1004.726] (-1011.661) (-1013.362) -- 0:00:15
Average standard deviation of split frequencies: 0.003054
925500 -- (-1004.500) (-1005.205) [-1009.825] (-1012.396) * (-1010.643) (-1008.313) (-1012.028) [-1005.975] -- 0:00:14
926000 -- (-1010.398) [-1004.517] (-1011.615) (-1003.818) * [-1006.192] (-1005.654) (-1011.686) (-1008.775) -- 0:00:14
926500 -- [-1009.280] (-1002.069) (-1006.401) (-1004.811) * (-1012.891) (-1005.456) (-1009.103) [-1007.984] -- 0:00:14
927000 -- (-1013.939) [-1008.198] (-1008.499) (-1004.237) * (-1009.241) (-1008.527) [-1013.655] (-1005.859) -- 0:00:14
927500 -- (-1009.149) [-1004.782] (-1011.007) (-1011.353) * [-1006.044] (-1009.002) (-1011.917) (-1011.731) -- 0:00:14
928000 -- (-1012.174) (-1008.946) [-1004.103] (-1006.351) * (-1005.716) [-1003.157] (-1006.758) (-1008.851) -- 0:00:14
928500 -- (-1006.881) (-1003.443) [-1007.930] (-1016.120) * (-1007.946) [-1006.997] (-1002.979) (-1009.116) -- 0:00:14
929000 -- [-1010.543] (-1009.340) (-1005.767) (-1008.680) * (-1005.325) (-1006.622) (-1012.571) [-1003.902] -- 0:00:14
929500 -- (-1020.321) (-1013.202) [-1009.319] (-1013.768) * (-1008.462) (-1005.715) (-1006.616) [-1010.089] -- 0:00:14
930000 -- (-1005.275) (-1012.787) [-1014.866] (-1008.000) * [-1004.791] (-1012.402) (-1004.196) (-1009.114) -- 0:00:14
Average standard deviation of split frequencies: 0.002701
930500 -- [-1006.028] (-1010.714) (-1002.860) (-1008.422) * (-1007.617) (-1011.617) [-1003.656] (-1011.351) -- 0:00:13
931000 -- (-1019.914) (-1008.180) (-1005.223) [-1011.876] * [-1006.442] (-1004.753) (-1009.300) (-1016.176) -- 0:00:13
931500 -- [-1011.384] (-1014.197) (-1017.241) (-1004.346) * [-1013.773] (-1008.306) (-1012.229) (-1005.761) -- 0:00:13
932000 -- (-1011.096) (-1004.586) [-1008.516] (-1010.883) * (-1010.884) [-1006.529] (-1003.267) (-1008.530) -- 0:00:13
932500 -- (-1017.194) [-1003.599] (-1007.504) (-1011.286) * (-1012.499) (-1008.577) (-1013.806) [-1014.066] -- 0:00:13
933000 -- [-1007.604] (-1012.688) (-1007.942) (-1004.067) * [-1004.947] (-1011.230) (-1006.204) (-1014.366) -- 0:00:13
933500 -- (-1009.124) (-1013.925) [-1009.216] (-1008.356) * (-1006.634) [-1001.137] (-1010.573) (-1013.109) -- 0:00:13
934000 -- (-1010.214) (-1005.517) [-1006.655] (-1008.942) * [-1011.724] (-1007.766) (-1012.452) (-1018.482) -- 0:00:13
934500 -- (-1020.670) (-1004.230) [-1004.769] (-1006.811) * [-1010.060] (-1007.010) (-1009.073) (-1007.084) -- 0:00:13
935000 -- (-1011.370) (-1009.761) (-1010.296) [-1005.403] * (-1010.630) [-1002.677] (-1007.669) (-1012.295) -- 0:00:13
Average standard deviation of split frequencies: 0.002686
935500 -- (-1010.238) [-1004.904] (-1010.633) (-1007.643) * (-1017.300) (-1008.800) [-1011.279] (-1009.260) -- 0:00:12
936000 -- (-1006.538) [-1014.353] (-1009.696) (-1009.374) * [-1004.348] (-1005.651) (-1008.650) (-1006.361) -- 0:00:12
936500 -- (-1007.280) (-1013.823) (-1008.348) [-1005.103] * [-1006.816] (-1007.281) (-1010.796) (-1002.150) -- 0:00:12
937000 -- [-1004.874] (-1013.584) (-1008.491) (-1007.696) * (-1016.050) (-1006.598) (-1011.893) [-1004.005] -- 0:00:12
937500 -- (-1007.763) [-1003.443] (-1014.239) (-1010.582) * (-1012.898) (-1007.697) [-1010.970] (-1011.558) -- 0:00:12
938000 -- (-1002.837) (-1021.797) (-1002.859) [-1007.042] * (-1010.054) [-1007.054] (-1017.842) (-1006.628) -- 0:00:12
938500 -- (-1009.583) (-1006.558) [-1004.872] (-1009.830) * (-1009.103) (-1002.581) (-1013.278) [-1009.127] -- 0:00:12
939000 -- (-1011.305) (-1005.468) (-1006.693) [-1007.601] * (-1006.460) [-1003.841] (-1004.612) (-1014.429) -- 0:00:12
939500 -- (-1007.166) (-1013.009) [-1001.012] (-1011.296) * (-1011.689) [-1001.636] (-1008.875) (-1010.148) -- 0:00:12
940000 -- [-1002.535] (-1018.625) (-1007.133) (-1009.312) * (-1010.945) [-1002.530] (-1003.820) (-1007.261) -- 0:00:12
Average standard deviation of split frequencies: 0.003174
940500 -- (-1004.213) [-1013.640] (-1006.063) (-1015.172) * [-1004.125] (-1013.458) (-1007.475) (-1014.790) -- 0:00:11
941000 -- (-1005.981) (-1010.877) (-1009.518) [-1005.722] * (-1002.727) (-1008.624) (-1016.581) [-1012.157] -- 0:00:11
941500 -- (-1010.009) (-1008.909) (-1014.356) [-1001.285] * [-1006.336] (-1010.932) (-1013.813) (-1008.035) -- 0:00:11
942000 -- [-1002.849] (-1012.600) (-1013.618) (-1008.065) * (-1008.927) (-1009.694) [-1002.396] (-1008.941) -- 0:00:11
942500 -- (-1014.392) [-1014.024] (-1008.829) (-1010.277) * [-1003.109] (-1004.560) (-1010.908) (-1006.047) -- 0:00:11
943000 -- (-1011.225) (-1016.001) [-1005.977] (-1006.468) * (-1011.831) [-1007.354] (-1010.876) (-1011.523) -- 0:00:11
943500 -- [-1006.087] (-1007.942) (-1017.748) (-1005.928) * [-1012.718] (-1005.018) (-1006.413) (-1004.042) -- 0:00:11
944000 -- (-1004.559) (-1010.040) (-1018.378) [-1010.914] * (-1011.176) (-1001.277) (-1013.902) [-1002.304] -- 0:00:11
944500 -- [-1009.756] (-1010.708) (-1004.456) (-1009.770) * (-1008.145) (-1006.994) [-1010.741] (-1003.822) -- 0:00:11
945000 -- (-1005.327) (-1002.747) [-1005.466] (-1006.438) * (-1007.990) [-1006.320] (-1006.108) (-1015.166) -- 0:00:11
Average standard deviation of split frequencies: 0.003156
945500 -- (-1003.012) (-1009.044) [-1009.623] (-1010.730) * [-1007.577] (-1010.134) (-1013.212) (-1008.604) -- 0:00:10
946000 -- (-1006.140) (-1014.592) (-1007.934) [-1007.373] * (-1008.543) (-1005.585) (-1009.847) [-1005.912] -- 0:00:10
946500 -- (-1006.889) [-1014.681] (-1014.719) (-1005.038) * (-1005.196) [-1003.229] (-1007.323) (-1008.997) -- 0:00:10
947000 -- [-1007.009] (-1008.584) (-1006.718) (-1005.093) * [-1015.124] (-1009.387) (-1007.746) (-1002.488) -- 0:00:10
947500 -- (-1003.793) [-1008.589] (-1010.430) (-1005.016) * (-1020.126) [-1007.223] (-1003.528) (-1008.755) -- 0:00:10
948000 -- (-1010.688) (-1007.028) (-1020.191) [-1011.812] * (-1009.042) [-1003.702] (-1010.066) (-1014.016) -- 0:00:10
948500 -- (-1009.513) [-1014.594] (-1011.426) (-1006.432) * (-1000.302) [-1002.115] (-1012.364) (-1008.447) -- 0:00:10
949000 -- (-1005.225) (-1007.047) [-1008.977] (-1007.554) * [-1004.949] (-1008.797) (-1014.238) (-1008.261) -- 0:00:10
949500 -- (-1004.452) [-1011.487] (-1005.918) (-1007.034) * (-1011.850) [-1012.322] (-1008.142) (-1005.115) -- 0:00:10
950000 -- (-1007.269) [-1005.753] (-1006.384) (-1007.356) * (-1005.116) (-1007.897) [-1005.601] (-1012.865) -- 0:00:10
Average standard deviation of split frequencies: 0.003140
950500 -- [-1006.376] (-1007.270) (-1003.837) (-1017.746) * (-1012.785) (-1007.797) (-1004.825) [-1007.766] -- 0:00:09
951000 -- (-1002.122) (-1006.982) [-1006.921] (-1014.515) * (-1012.557) (-1007.382) (-1000.957) [-1003.993] -- 0:00:09
951500 -- (-1015.727) [-1008.670] (-1005.862) (-1006.051) * (-1008.811) (-1005.727) (-1003.395) [-1008.879] -- 0:00:09
952000 -- (-1006.375) [-1005.777] (-1009.608) (-1013.721) * (-1013.097) (-1005.175) (-1002.998) [-1003.340] -- 0:00:09
952500 -- [-1002.604] (-1018.271) (-1007.643) (-1009.960) * (-1009.210) (-1010.696) [-1003.878] (-1006.101) -- 0:00:09
953000 -- (-1007.926) [-1010.051] (-1009.522) (-1014.050) * [-1004.752] (-1010.504) (-1005.307) (-1011.839) -- 0:00:09
953500 -- (-1006.204) (-1005.865) (-1015.783) [-1009.669] * (-1012.219) [-1005.762] (-1011.351) (-1008.036) -- 0:00:09
954000 -- [-1004.464] (-1010.183) (-1013.085) (-1009.484) * (-1006.036) [-1014.524] (-1015.462) (-1008.289) -- 0:00:09
954500 -- [-1012.678] (-1015.723) (-1006.522) (-1011.720) * (-1010.142) (-1017.616) (-1004.766) [-1008.588] -- 0:00:09
955000 -- (-1009.556) (-1008.274) (-1013.028) [-1003.219] * (-1019.117) (-1010.180) (-1006.258) [-1014.397] -- 0:00:09
Average standard deviation of split frequencies: 0.003452
955500 -- (-1008.987) (-1011.096) [-1006.155] (-1003.972) * (-1011.644) (-1011.340) (-1018.340) [-1005.789] -- 0:00:08
956000 -- (-1009.171) [-1010.239] (-1012.435) (-1008.034) * (-1009.123) (-1007.582) (-1016.652) [-1007.803] -- 0:00:08
956500 -- (-1009.640) [-1005.943] (-1009.488) (-1001.930) * [-1011.351] (-1008.173) (-1012.319) (-1016.968) -- 0:00:08
957000 -- (-1006.009) (-1006.546) [-1006.909] (-1002.621) * (-1013.212) (-1010.197) [-1010.266] (-1015.929) -- 0:00:08
957500 -- (-1018.063) (-1005.762) [-1001.333] (-1006.831) * (-1007.883) (-1013.284) [-1005.834] (-1016.373) -- 0:00:08
958000 -- (-1003.064) (-1003.494) [-1010.121] (-1017.802) * [-1009.452] (-1006.999) (-1009.955) (-1016.546) -- 0:00:08
958500 -- (-1005.142) (-1005.012) [-1006.384] (-1009.848) * (-1012.862) (-1007.695) [-1006.645] (-1006.846) -- 0:00:08
959000 -- (-1008.724) (-1007.825) (-1008.782) [-1010.392] * (-1012.909) [-1006.077] (-1007.757) (-1005.839) -- 0:00:08
959500 -- (-1006.394) (-1004.718) [-1011.821] (-1007.481) * (-1010.830) (-1012.702) [-1004.911] (-1003.571) -- 0:00:08
960000 -- (-1008.053) (-1013.466) (-1014.617) [-1009.927] * [-1007.595] (-1016.420) (-1007.508) (-1009.415) -- 0:00:08
Average standard deviation of split frequencies: 0.003762
960500 -- (-1007.211) [-1006.169] (-1000.915) (-1006.580) * (-1009.723) (-1009.445) (-1016.228) [-1006.784] -- 0:00:07
961000 -- (-1005.462) (-1005.184) (-1002.371) [-1007.252] * (-1005.544) (-1016.703) [-1006.289] (-1016.199) -- 0:00:07
961500 -- (-1013.751) (-1010.702) [-1004.979] (-1007.796) * (-1004.479) (-1010.130) [-1007.924] (-1011.124) -- 0:00:07
962000 -- (-1007.424) (-1010.139) [-1008.040] (-1005.899) * (-1005.852) (-1018.409) (-1002.969) [-1003.215] -- 0:00:07
962500 -- (-1011.008) (-1022.885) [-1005.261] (-1009.923) * [-1004.548] (-1019.207) (-1009.795) (-1011.386) -- 0:00:07
963000 -- (-1010.009) (-1014.295) (-1005.060) [-1009.149] * (-1014.089) [-1012.626] (-1008.227) (-1001.549) -- 0:00:07
963500 -- (-1008.482) [-1012.585] (-1008.617) (-1003.549) * (-1009.597) (-1008.306) [-1006.295] (-1003.792) -- 0:00:07
964000 -- (-1011.523) (-1006.489) (-1001.415) [-1003.913] * (-1008.374) [-1010.537] (-1005.825) (-1010.548) -- 0:00:07
964500 -- (-1019.375) (-1008.280) [-1003.687] (-1009.378) * (-1016.987) (-1004.712) (-1007.423) [-1007.840] -- 0:00:07
965000 -- (-1028.751) (-1014.375) [-1003.327] (-1006.860) * [-1006.406] (-1011.352) (-1016.066) (-1006.079) -- 0:00:07
Average standard deviation of split frequencies: 0.003579
965500 -- (-1009.584) [-1003.654] (-1006.976) (-1006.359) * (-1002.673) (-1011.896) (-1011.282) [-1006.205] -- 0:00:06
966000 -- (-1009.062) (-1010.392) (-1008.067) [-1003.980] * (-1012.250) (-1017.098) [-1007.813] (-1015.497) -- 0:00:06
966500 -- (-1008.507) (-1005.469) [-1013.685] (-1002.133) * (-1012.484) (-1013.757) (-1001.367) [-1007.589] -- 0:00:06
967000 -- (-1010.571) (-1011.985) (-1010.896) [-1009.483] * [-1005.030] (-1012.812) (-1006.786) (-1007.809) -- 0:00:06
967500 -- (-1016.983) [-1007.137] (-1006.026) (-1010.954) * (-1006.382) (-1005.444) [-1007.289] (-1010.266) -- 0:00:06
968000 -- (-1009.697) [-1007.647] (-1012.045) (-1010.086) * (-1006.701) (-1007.555) [-1004.589] (-1009.437) -- 0:00:06
968500 -- [-1007.540] (-1012.734) (-1004.732) (-1013.615) * (-1004.981) (-1009.633) (-1005.991) [-1003.526] -- 0:00:06
969000 -- (-1005.427) (-1005.423) (-1016.113) [-1009.126] * (-1005.841) [-1010.935] (-1010.376) (-1005.336) -- 0:00:06
969500 -- (-1013.551) (-1004.948) (-1000.681) [-1008.338] * [-1007.571] (-1007.895) (-1011.113) (-1014.722) -- 0:00:06
970000 -- (-1014.961) (-1005.749) [-1009.033] (-1011.824) * (-1014.273) (-1003.596) (-1011.977) [-1003.236] -- 0:00:06
Average standard deviation of split frequencies: 0.003561
970500 -- (-1012.867) (-1007.038) (-1003.561) [-1014.240] * (-1003.695) [-1005.857] (-1011.504) (-1007.966) -- 0:00:05
971000 -- (-1009.136) [-1010.484] (-1016.552) (-1008.558) * [-1003.550] (-1009.827) (-1009.325) (-1009.848) -- 0:00:05
971500 -- (-1012.053) (-1010.336) [-1006.249] (-1017.904) * (-1007.040) (-1010.784) (-1014.512) [-1004.045] -- 0:00:05
972000 -- (-1010.413) [-1003.769] (-1016.274) (-1013.973) * (-1011.348) (-1008.165) [-1004.884] (-1001.199) -- 0:00:05
972500 -- (-1008.230) (-1010.935) (-1017.793) [-1013.050] * [-1004.574] (-1012.101) (-1006.109) (-1008.408) -- 0:00:05
973000 -- [-1008.069] (-1008.044) (-999.045) (-1004.947) * (-1011.186) [-1007.019] (-1009.908) (-1005.151) -- 0:00:05
973500 -- (-1013.357) (-1009.174) (-1002.355) [-1008.537] * (-1009.984) [-1005.797] (-1009.929) (-1011.623) -- 0:00:05
974000 -- (-1009.555) (-1008.077) [-1006.119] (-1012.150) * [-1007.880] (-1007.662) (-1012.396) (-1003.645) -- 0:00:05
974500 -- (-1011.292) (-1004.542) (-1007.620) [-1004.560] * (-1006.486) (-1007.401) [-1008.738] (-1010.793) -- 0:00:05
975000 -- (-1013.338) (-1008.664) (-1006.130) [-1002.115] * [-1005.023] (-1004.958) (-1006.200) (-1012.776) -- 0:00:05
Average standard deviation of split frequencies: 0.003542
975500 -- (-1006.064) (-1016.887) [-1007.381] (-1002.073) * (-1004.901) (-1020.179) (-1013.700) [-1007.099] -- 0:00:04
976000 -- (-1009.635) (-1010.657) (-1004.827) [-1006.380] * (-1003.131) (-1015.138) (-1015.908) [-1006.248] -- 0:00:04
976500 -- (-1008.639) (-1006.614) (-1006.080) [-1009.226] * [-1007.698] (-1008.770) (-1008.152) (-1016.947) -- 0:00:04
977000 -- [-1007.421] (-1006.935) (-1009.247) (-1027.424) * [-1003.016] (-1006.416) (-1013.365) (-1009.356) -- 0:00:04
977500 -- [-1002.417] (-1009.125) (-1008.726) (-1010.079) * [-1011.849] (-1005.525) (-1018.652) (-1006.119) -- 0:00:04
978000 -- (-1010.154) [-1009.198] (-1009.579) (-1004.646) * [-1001.897] (-1010.014) (-1012.462) (-1007.090) -- 0:00:04
978500 -- [-1014.206] (-1011.069) (-1004.783) (-1014.479) * (-1008.009) [-1004.921] (-1012.585) (-1012.770) -- 0:00:04
979000 -- [-1004.859] (-1002.968) (-1012.562) (-1003.449) * (-1012.317) (-1005.978) [-1005.971] (-1007.323) -- 0:00:04
979500 -- (-1010.301) (-1011.686) [-1007.829] (-1016.307) * (-1008.746) (-1007.123) [-1005.936] (-1013.502) -- 0:00:04
980000 -- (-1004.444) (-1007.689) [-1008.060] (-1013.406) * [-1005.706] (-1009.301) (-1009.279) (-1007.592) -- 0:00:04
Average standard deviation of split frequencies: 0.003365
980500 -- [-1007.978] (-1002.385) (-1012.390) (-1010.300) * (-1008.873) (-1007.483) (-1006.870) [-1012.812] -- 0:00:03
981000 -- [-1006.735] (-1011.064) (-1006.907) (-1004.949) * (-1001.529) (-1004.803) [-1007.197] (-1004.167) -- 0:00:03
981500 -- (-1003.233) (-1006.497) (-1010.511) [-1006.512] * [-1005.657] (-1010.327) (-1006.829) (-1008.038) -- 0:00:03
982000 -- (-1006.000) (-1012.848) (-1014.552) [-1007.553] * (-1011.873) [-1006.944] (-1014.565) (-1006.769) -- 0:00:03
982500 -- [-1004.349] (-1023.854) (-1006.888) (-1003.319) * (-1006.778) (-1003.447) (-1014.781) [-1006.315] -- 0:00:03
983000 -- (-1009.879) (-1015.254) (-1014.992) [-1004.091] * (-1012.415) (-1005.776) (-1010.954) [-1009.157] -- 0:00:03
983500 -- (-1005.153) (-1008.668) (-1009.020) [-1005.153] * (-1014.475) (-1010.652) [-1012.266] (-1020.217) -- 0:00:03
984000 -- (-1011.585) (-1007.512) (-1007.540) [-1007.658] * [-1009.541] (-1005.714) (-1005.737) (-1003.566) -- 0:00:03
984500 -- (-1011.891) [-1009.182] (-1011.494) (-1007.406) * (-1011.066) (-1010.083) [-1008.610] (-1011.883) -- 0:00:03
985000 -- (-1003.883) [-1009.139] (-1004.677) (-1006.227) * [-1008.708] (-1006.269) (-1011.952) (-1002.323) -- 0:00:03
Average standard deviation of split frequencies: 0.003187
985500 -- (-1003.179) (-1007.577) [-1007.258] (-1008.356) * [-1003.650] (-1005.848) (-1013.487) (-1011.950) -- 0:00:02
986000 -- (-1001.914) (-1009.298) [-1014.463] (-1012.940) * (-1009.868) [-1002.143] (-1020.235) (-1006.663) -- 0:00:02
986500 -- (-1006.546) [-1004.869] (-1004.567) (-1013.170) * (-1005.710) (-1002.267) [-1011.891] (-1005.648) -- 0:00:02
987000 -- [-1004.623] (-1006.792) (-1009.229) (-1006.224) * [-1012.674] (-1006.031) (-1004.807) (-1011.123) -- 0:00:02
987500 -- (-1015.380) [-1007.131] (-1005.838) (-1005.697) * (-1006.924) [-1009.546] (-1007.058) (-1007.809) -- 0:00:02
988000 -- (-1006.508) (-1019.327) [-1004.864] (-1009.290) * (-1005.951) (-1008.717) (-1018.000) [-1014.136] -- 0:00:02
988500 -- (-1010.076) (-1010.332) [-1006.862] (-1010.195) * [-1004.382] (-1008.276) (-1007.784) (-1004.908) -- 0:00:02
989000 -- [-1007.689] (-1006.068) (-1017.030) (-1009.410) * (-1010.652) [-1003.220] (-1008.850) (-1005.369) -- 0:00:02
989500 -- [-1010.002] (-1005.450) (-1016.912) (-1005.645) * (-1011.770) (-1008.640) [-1005.807] (-1010.276) -- 0:00:02
990000 -- [-1004.944] (-1008.253) (-1007.717) (-1010.186) * (-1010.634) [-1002.091] (-1003.387) (-1008.355) -- 0:00:02
Average standard deviation of split frequencies: 0.003172
990500 -- [-1013.285] (-1012.322) (-1008.221) (-1010.101) * [-1012.794] (-1011.334) (-1007.608) (-1010.759) -- 0:00:01
991000 -- (-1008.121) (-1018.374) (-1003.780) [-1003.522] * [-1006.998] (-1001.599) (-1008.906) (-1015.415) -- 0:00:01
991500 -- (-1012.021) (-1015.095) [-1010.010] (-1007.467) * (-1015.880) [-1011.798] (-1008.597) (-1012.097) -- 0:00:01
992000 -- (-1007.191) [-1011.363] (-1008.441) (-1005.874) * (-1007.968) [-1005.907] (-1010.613) (-1005.361) -- 0:00:01
992500 -- [-1009.090] (-1018.498) (-1009.656) (-1005.670) * (-1013.510) [-1002.708] (-1008.087) (-1005.608) -- 0:00:01
993000 -- (-1010.184) (-1004.914) [-1006.259] (-1003.543) * (-1004.649) (-1005.196) (-1003.880) [-1009.240] -- 0:00:01
993500 -- (-1006.305) (-1004.615) (-1002.507) [-1012.108] * (-1016.304) (-1006.208) [-1003.939] (-1011.434) -- 0:00:01
994000 -- (-1009.836) (-1012.005) [-1004.423] (-1010.399) * (-1009.122) [-1010.552] (-1009.602) (-1013.276) -- 0:00:01
994500 -- [-1004.372] (-1009.476) (-1006.340) (-1003.553) * (-1007.932) (-1017.023) [-1008.897] (-1009.245) -- 0:00:01
995000 -- (-1014.204) (-1008.404) [-1006.700] (-1011.958) * [-1003.649] (-1013.213) (-1010.963) (-1004.959) -- 0:00:01
Average standard deviation of split frequencies: 0.003629
995500 -- [-1007.643] (-1008.465) (-1010.580) (-1010.669) * (-1005.906) [-1006.532] (-1006.542) (-1006.092) -- 0:00:00
996000 -- (-1011.168) (-1006.593) (-1005.956) [-1006.684] * (-1006.129) (-1009.702) (-1006.380) [-1011.563] -- 0:00:00
996500 -- [-1004.042] (-1012.507) (-1005.977) (-1007.209) * (-1008.613) (-1003.571) (-1005.838) [-1006.972] -- 0:00:00
997000 -- (-1003.420) (-1010.334) [-1006.508] (-1011.391) * (-1010.719) [-1001.020] (-1007.270) (-1013.672) -- 0:00:00
997500 -- (-1004.458) (-1005.754) [-1007.578] (-1011.017) * (-1004.913) [-1013.243] (-1015.690) (-1012.032) -- 0:00:00
998000 -- (-1004.320) (-1011.741) [-1004.702] (-1010.230) * (-1001.524) (-1014.467) [-1005.671] (-1013.001) -- 0:00:00
998500 -- (-1003.577) [-1004.792] (-1014.790) (-1009.860) * [-1009.119] (-1011.421) (-1011.046) (-1008.471) -- 0:00:00
999000 -- (-1004.779) [-1008.737] (-1008.385) (-1001.808) * (-1007.921) [-1000.909] (-1008.625) (-1013.520) -- 0:00:00
999500 -- (-1007.365) (-1007.353) [-1008.287] (-1010.002) * (-1008.873) (-999.428) (-1009.734) [-1012.099] -- 0:00:00
1000000 -- (-1005.314) [-1002.065] (-1004.024) (-1008.185) * (-1013.260) [-1004.034] (-1006.031) (-1006.143) -- 0:00:00
Average standard deviation of split frequencies: 0.003455
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1005.314075 -- 11.911537
Chain 1 -- -1005.314072 -- 11.911537
Chain 2 -- -1002.065359 -- 13.157752
Chain 2 -- -1002.065358 -- 13.157752
Chain 3 -- -1004.023842 -- 9.310008
Chain 3 -- -1004.023842 -- 9.310008
Chain 4 -- -1008.184856 -- 12.414620
Chain 4 -- -1008.184864 -- 12.414620
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1013.260133 -- 13.704661
Chain 1 -- -1013.260135 -- 13.704661
Chain 2 -- -1004.034045 -- 13.707180
Chain 2 -- -1004.034041 -- 13.707180
Chain 3 -- -1006.030855 -- 12.778430
Chain 3 -- -1006.030857 -- 12.778430
Chain 4 -- -1006.142792 -- 13.097980
Chain 4 -- -1006.142792 -- 13.097980
Analysis completed in 3 mins 21 seconds
Analysis used 201.36 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -997.80
Likelihood of best state for "cold" chain of run 2 was -997.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
59.4 % ( 55 %) Dirichlet(Revmat{all})
74.4 % ( 61 %) Slider(Revmat{all})
31.1 % ( 24 %) Dirichlet(Pi{all})
32.1 % ( 30 %) Slider(Pi{all})
57.2 % ( 25 %) Multiplier(Alpha{1,2})
48.8 % ( 23 %) Multiplier(Alpha{3})
65.5 % ( 37 %) Slider(Pinvar{all})
3.2 % ( 6 %) ExtSPR(Tau{all},V{all})
1.7 % ( 3 %) ExtTBR(Tau{all},V{all})
6.0 % ( 14 %) NNI(Tau{all},V{all})
6.3 % ( 8 %) ParsSPR(Tau{all},V{all})
26.6 % ( 26 %) Multiplier(V{all})
44.8 % ( 37 %) Nodeslider(V{all})
25.9 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
59.3 % ( 43 %) Dirichlet(Revmat{all})
74.1 % ( 67 %) Slider(Revmat{all})
30.7 % ( 35 %) Dirichlet(Pi{all})
32.2 % ( 26 %) Slider(Pi{all})
56.0 % ( 30 %) Multiplier(Alpha{1,2})
48.2 % ( 29 %) Multiplier(Alpha{3})
64.9 % ( 34 %) Slider(Pinvar{all})
3.2 % ( 4 %) ExtSPR(Tau{all},V{all})
1.8 % ( 1 %) ExtTBR(Tau{all},V{all})
6.1 % ( 8 %) NNI(Tau{all},V{all})
6.3 % ( 7 %) ParsSPR(Tau{all},V{all})
26.6 % ( 25 %) Multiplier(V{all})
44.7 % ( 40 %) Nodeslider(V{all})
26.3 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.51
2 | 166875 0.83 0.67
3 | 166707 166751 0.84
4 | 166668 166363 166636
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.52
2 | 166734 0.83 0.68
3 | 167272 166336 0.84
4 | 167165 166306 166187
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1005.48
| 1 2 1 2 1 2 |
| 1 1 2 2 22 1 |
| 2 1 1 1 211 1 1 |
| 1 2 1 12 2 |
|1 * 2 2 12 2 2 1 2 1 2 2 2 |
| 1 2 1 1 12 111 11 2 2 |
| 21 1 2 11 * 1 2 1*|
|2 2 121 2 2 * 22 2 2 1 * 2 |
| 1 2 21 2 1 2 1 12 1 22 2 |
| 112 1 1 2 2 1 2 2 1 1 |
| 1 1 |
| 2 1 1 2 |
| |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1009.13
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1003.62 -1019.47
2 -1003.82 -1019.20
--------------------------------------
TOTAL -1003.71 -1019.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.741672 0.021176 0.482745 1.030501 0.724172 1244.74 1259.94 1.000
r(A<->C){all} 0.065714 0.000859 0.011769 0.120615 0.061903 802.44 818.04 1.000
r(A<->G){all} 0.212069 0.003302 0.109859 0.333056 0.206406 534.66 608.84 1.000
r(A<->T){all} 0.083458 0.002556 0.000215 0.178753 0.075942 461.48 482.80 1.000
r(C<->G){all} 0.053630 0.000579 0.009429 0.099983 0.051294 692.26 922.20 1.001
r(C<->T){all} 0.511629 0.006240 0.352431 0.663435 0.512056 639.85 685.03 1.000
r(G<->T){all} 0.073500 0.001480 0.011034 0.148840 0.068235 698.19 741.89 1.000
pi(A){all} 0.245949 0.000428 0.207191 0.287520 0.245300 1071.39 1088.14 1.000
pi(C){all} 0.304393 0.000430 0.264670 0.345523 0.303953 1056.12 1148.43 1.000
pi(G){all} 0.296726 0.000466 0.254436 0.338992 0.296180 1254.80 1314.85 1.000
pi(T){all} 0.152932 0.000258 0.122058 0.185669 0.152522 1059.87 1253.58 1.000
alpha{1,2} 0.065419 0.001459 0.000147 0.130183 0.066039 1145.79 1189.27 1.000
alpha{3} 1.883304 0.536422 0.720060 3.367525 1.765320 959.68 1230.34 1.000
pinvar{all} 0.280054 0.009101 0.088615 0.463562 0.284792 1244.97 1372.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...***
8 -- .**...
9 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 2970 0.989340 0.001884 0.988008 0.990673 2
8 2966 0.988008 0.006595 0.983344 0.992672 2
9 2632 0.876749 0.001884 0.875416 0.878081 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.041592 0.000259 0.013378 0.072684 0.039468 1.000 2
length{all}[2] 0.017833 0.000086 0.002901 0.036761 0.016365 1.000 2
length{all}[3] 0.016173 0.000079 0.001791 0.033392 0.014672 1.000 2
length{all}[4] 0.106610 0.001066 0.048753 0.168724 0.102224 1.000 2
length{all}[5] 0.023455 0.000355 0.000003 0.061253 0.019209 1.000 2
length{all}[6] 0.429778 0.013330 0.223804 0.641335 0.413493 1.000 2
length{all}[7] 0.048169 0.000467 0.010668 0.090994 0.045388 1.000 2
length{all}[8] 0.025844 0.000184 0.004180 0.052204 0.023588 1.000 2
length{all}[9] 0.034589 0.000391 0.001930 0.073474 0.031387 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003455
Maximum standard deviation of split frequencies = 0.006595
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------------------ C4 (4)
| |
|-----------99----------+ /------------------------ C5 (5)
+ \-----------88----------+
| \------------------------ C6 (6)
|
| /------------------------ C2 (2)
\-----------------------99----------------------+
\------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
| /--------------- C4 (4)
| |
|------+ /--- C5 (5)
+ \---+
| \------------------------------------------------------------- C6 (6)
|
| /--- C2 (2)
\--+
\--- C3 (3)
|-------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (12 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 5 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 390
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
2 sites are removed. 123 130
Sequences read..
Counting site patterns.. 0:00
89 patterns at 128 / 128 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
86864 bytes for conP
12104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, (5, 6)), (2, 3)); MP score: 97
173728 bytes for conP, adjusted
0.072735 0.053561 0.204580 0.029283 0.045417 0.477407 0.038160 0.019676 0.036530 0.300000 1.300000
ntime & nrate & np: 9 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 11
lnL0 = -1094.422422
Iterating by ming2
Initial: fx= 1094.422422
x= 0.07274 0.05356 0.20458 0.02928 0.04542 0.47741 0.03816 0.01968 0.03653 0.30000 1.30000
1 h-m-p 0.0000 0.0019 159.1907 +++YCYYCCC 1076.321204 6 0.0015 29 | 0/11
2 h-m-p 0.0004 0.0024 628.3797 YYCCC 1064.000983 4 0.0005 49 | 0/11
3 h-m-p 0.0003 0.0013 244.2072 +CYYYYCCCC 1040.776754 8 0.0012 76 | 0/11
4 h-m-p 0.0002 0.0011 271.8206 +YYCCCC 1030.474993 5 0.0007 99 | 0/11
5 h-m-p 0.0002 0.0012 162.4646 +YCYCCC 1026.599560 5 0.0007 122 | 0/11
6 h-m-p 0.0003 0.0022 373.7950 +YCYYCYYYYY 977.241836 10 0.0020 148 | 0/11
7 h-m-p 0.0000 0.0001 785.4651 YCCCCC 976.524185 5 0.0000 171 | 0/11
8 h-m-p 0.0017 0.0207 12.8262 +YYC 976.007370 2 0.0053 188 | 0/11
9 h-m-p 0.0039 0.0196 9.6337 CCC 975.935331 2 0.0014 206 | 0/11
10 h-m-p 0.0015 0.0183 8.9397 YC 975.763428 1 0.0034 221 | 0/11
11 h-m-p 0.0156 0.2407 1.9209 +CYYCCCC 968.760834 6 0.1215 246 | 0/11
12 h-m-p 0.0012 0.0062 34.1889 YCYCCC 965.438651 5 0.0033 268 | 0/11
13 h-m-p 0.1248 0.6239 0.1932 +YYCCC 961.313893 4 0.4272 289 | 0/11
14 h-m-p 0.2473 1.2365 0.1472 +YCYCCC 958.422009 5 0.6985 323 | 0/11
15 h-m-p 0.3292 1.6459 0.2410 YYCCC 956.218045 4 0.4733 354 | 0/11
16 h-m-p 0.6266 3.1328 0.1148 YCCCC 954.519135 4 1.3248 386 | 0/11
17 h-m-p 0.3832 1.9161 0.1073 CCCC 954.135652 3 0.5590 417 | 0/11
18 h-m-p 0.2658 3.0805 0.2257 +YYC 953.093782 2 0.9052 445 | 0/11
19 h-m-p 0.8316 4.1582 0.1307 CYCC 952.659915 3 0.8047 475 | 0/11
20 h-m-p 0.8816 8.0000 0.1193 YCCC 952.095459 3 2.0045 505 | 0/11
21 h-m-p 1.6000 8.0000 0.0979 CCC 951.716869 2 2.4336 534 | 0/11
22 h-m-p 1.6000 8.0000 0.0907 CCC 951.502872 2 1.5860 563 | 0/11
23 h-m-p 1.6000 8.0000 0.0322 CCC 951.454398 2 1.9093 592 | 0/11
24 h-m-p 1.6000 8.0000 0.0077 CC 951.438130 1 2.0367 619 | 0/11
25 h-m-p 1.0991 8.0000 0.0143 +YC 951.428216 1 2.7793 646 | 0/11
26 h-m-p 1.6000 8.0000 0.0090 +YC 951.412630 1 4.0154 673 | 0/11
27 h-m-p 1.6000 8.0000 0.0218 CC 951.408156 1 1.4911 700 | 0/11
28 h-m-p 1.6000 8.0000 0.0023 YC 951.408052 1 1.1278 726 | 0/11
29 h-m-p 1.6000 8.0000 0.0003 Y 951.408051 0 0.9722 751 | 0/11
30 h-m-p 1.6000 8.0000 0.0000 Y 951.408051 0 1.0259 776 | 0/11
31 h-m-p 1.6000 8.0000 0.0000 C 951.408051 0 0.4000 801 | 0/11
32 h-m-p 0.5798 8.0000 0.0000 ---C 951.408051 0 0.0031 829
Out..
lnL = -951.408051
830 lfun, 830 eigenQcodon, 7470 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, (4, (5, 6)), (2, 3)); MP score: 97
0.072735 0.053561 0.204580 0.029283 0.045417 0.477407 0.038160 0.019676 0.036530 2.663748 0.747245 0.296991
ntime & nrate & np: 9 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.638915
np = 12
lnL0 = -979.118640
Iterating by ming2
Initial: fx= 979.118640
x= 0.07274 0.05356 0.20458 0.02928 0.04542 0.47741 0.03816 0.01968 0.03653 2.66375 0.74724 0.29699
1 h-m-p 0.0000 0.0025 130.9288 ++++ 957.246942 m 0.0025 19 | 0/12
2 h-m-p 0.0000 0.0000 2000.7836 YCYCCC 954.655031 5 0.0000 42 | 0/12
3 h-m-p 0.0001 0.0004 84.3779 CCCC 954.304430 3 0.0001 63 | 0/12
4 h-m-p 0.0005 0.0108 21.5517 +CCCCC 953.805279 4 0.0022 87 | 0/12
5 h-m-p 0.0017 0.0184 28.2145 CYC 953.710072 2 0.0005 105 | 0/12
6 h-m-p 0.0006 0.0141 24.7477 +CCC 953.415395 2 0.0021 125 | 0/12
7 h-m-p 0.0027 0.0136 17.2177 CCC 953.232532 2 0.0023 144 | 0/12
8 h-m-p 0.0099 0.0495 2.6889 CCC 953.114652 2 0.0095 163 | 0/12
9 h-m-p 0.0061 0.0416 4.1648 +YYCC 952.131230 3 0.0220 183 | 0/12
10 h-m-p 0.0014 0.0110 65.1016 +YYYYCC 947.601284 5 0.0055 205 | 0/12
11 h-m-p 0.0009 0.0044 88.4791 YCYCCC 945.104293 5 0.0021 228 | 0/12
12 h-m-p 0.0012 0.0062 49.5408 +YYCYCCC 941.939530 6 0.0041 253 | 0/12
13 h-m-p 0.2224 1.2549 0.9141 YCCC 940.651752 3 0.3932 273 | 0/12
14 h-m-p 0.3226 2.5132 1.1139 CC 939.770260 1 0.4278 302 | 0/12
15 h-m-p 0.8248 4.1242 0.1482 CC 939.372816 1 0.8202 319 | 0/12
16 h-m-p 1.0756 8.0000 0.1130 CCC 939.175319 2 1.1963 350 | 0/12
17 h-m-p 0.8755 8.0000 0.1545 CCC 939.102630 2 0.9665 381 | 0/12
18 h-m-p 1.6000 8.0000 0.0558 YCC 939.071652 2 0.9020 411 | 0/12
19 h-m-p 1.6000 8.0000 0.0212 YC 939.065167 1 0.6770 439 | 0/12
20 h-m-p 1.6000 8.0000 0.0060 CC 939.062003 1 1.3002 468 | 0/12
21 h-m-p 1.6000 8.0000 0.0022 CC 939.061157 1 1.3571 497 | 0/12
22 h-m-p 1.6000 8.0000 0.0009 YC 939.061063 1 1.0120 525 | 0/12
23 h-m-p 1.4485 8.0000 0.0006 Y 939.061047 0 0.6214 552 | 0/12
24 h-m-p 1.6000 8.0000 0.0001 Y 939.061046 0 0.9736 579 | 0/12
25 h-m-p 1.6000 8.0000 0.0000 Y 939.061046 0 0.9444 606 | 0/12
26 h-m-p 1.6000 8.0000 0.0000 Y 939.061046 0 0.9183 633 | 0/12
27 h-m-p 1.6000 8.0000 0.0000 Y 939.061046 0 3.1655 660 | 0/12
28 h-m-p 1.4559 8.0000 0.0000 --------------N 939.061046 0 0.0000 701
Out..
lnL = -939.061046
702 lfun, 2106 eigenQcodon, 12636 P(t)
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, (4, (5, 6)), (2, 3)); MP score: 97
initial w for M2:NSpselection reset.
0.072735 0.053561 0.204580 0.029283 0.045417 0.477407 0.038160 0.019676 0.036530 2.709841 0.896732 0.199894 0.157918 2.073080
ntime & nrate & np: 9 3 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.981411
np = 14
lnL0 = -989.667268
Iterating by ming2
Initial: fx= 989.667268
x= 0.07274 0.05356 0.20458 0.02928 0.04542 0.47741 0.03816 0.01968 0.03653 2.70984 0.89673 0.19989 0.15792 2.07308
1 h-m-p 0.0000 0.0023 137.9740 ++++ 978.311359 m 0.0023 21 | 1/14
2 h-m-p 0.0011 0.0056 52.7772 +YYYCC 972.020144 4 0.0044 44 | 1/14
3 h-m-p 0.0005 0.0031 439.2035 YYCCC 965.973748 4 0.0008 67 | 1/14
4 h-m-p 0.0049 0.0247 26.8734 CCCCC 963.532483 4 0.0085 92 | 0/14
5 h-m-p 0.0001 0.0004 1250.0598 YCYCCC 962.702486 5 0.0000 117 | 0/14
6 h-m-p 0.0009 0.0120 51.5838 YCCC 962.005973 3 0.0017 139 | 0/14
7 h-m-p 0.0036 0.0234 23.7949 +YYCC 959.923868 3 0.0128 161 | 0/14
8 h-m-p 0.0083 0.0416 34.0005 YCCC 958.816791 3 0.0059 183 | 0/14
9 h-m-p 0.0053 0.0263 11.8321 YCCCC 958.327482 4 0.0100 207 | 0/14
10 h-m-p 0.0109 0.0545 5.3378 CCCCC 958.075639 4 0.0146 232 | 0/14
11 h-m-p 0.0368 0.1841 2.0223 CYCCC 957.203055 4 0.0707 256 | 0/14
12 h-m-p 0.0023 0.0248 62.1814 +YCYYCCC 947.287103 6 0.0191 284 | 0/14
13 h-m-p 0.0475 0.2377 4.5427 +YCYCCC 941.949230 5 0.1454 310 | 0/14
14 h-m-p 0.1794 0.8968 1.0554 CYCC 941.289051 3 0.1915 332 | 0/14
15 h-m-p 0.0804 0.8797 2.5132 CYCC 940.805104 3 0.0845 354 | 0/14
16 h-m-p 0.2073 1.0366 0.9884 YCCCC 940.229503 4 0.5029 378 | 0/14
17 h-m-p 0.0958 0.4791 1.8509 +YCCC 939.756684 3 0.2583 415 | 0/14
18 h-m-p 0.0995 0.4974 0.9031 ++ 939.359708 m 0.4974 432 | 1/14
19 h-m-p 1.0087 8.0000 0.2669 YCCC 939.149216 3 0.4485 468 | 1/14
20 h-m-p 0.4393 8.0000 0.2724 CCC 939.108534 2 0.4800 502 | 1/14
21 h-m-p 1.6000 8.0000 0.0571 YC 939.079406 1 1.2137 533 | 1/14
22 h-m-p 1.6000 8.0000 0.0427 YC 939.066107 1 0.8008 564 | 1/14
23 h-m-p 1.2380 8.0000 0.0276 YC 939.061617 1 0.8802 595 | 1/14
24 h-m-p 1.6000 8.0000 0.0098 YC 939.061102 1 0.9878 626 | 1/14
25 h-m-p 1.6000 8.0000 0.0050 Y 939.061049 0 1.1344 656 | 1/14
26 h-m-p 1.6000 8.0000 0.0002 Y 939.061046 0 0.7706 686 | 1/14
27 h-m-p 1.3309 8.0000 0.0001 Y 939.061046 0 0.7466 716 | 1/14
28 h-m-p 1.3485 8.0000 0.0001 Y 939.061046 0 0.8736 746 | 1/14
29 h-m-p 1.6000 8.0000 0.0000 Y 939.061046 0 0.8778 776 | 1/14
30 h-m-p 1.6000 8.0000 0.0000 ----C 939.061046 0 0.0016 810
Out..
lnL = -939.061046
811 lfun, 3244 eigenQcodon, 21897 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -949.521021 S = -901.755459 -39.306393
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 89 patterns 0:14
did 20 / 89 patterns 0:14
did 30 / 89 patterns 0:14
did 40 / 89 patterns 0:14
did 50 / 89 patterns 0:14
did 60 / 89 patterns 0:14
did 70 / 89 patterns 0:14
did 80 / 89 patterns 0:14
did 89 / 89 patterns 0:14
Time used: 0:14
Model 3: discrete
TREE # 1
(1, (4, (5, 6)), (2, 3)); MP score: 97
0.072735 0.053561 0.204580 0.029283 0.045417 0.477407 0.038160 0.019676 0.036530 2.709841 0.215184 0.509770 0.040443 0.101306 0.146810
ntime & nrate & np: 9 4 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 10.921488
np = 15
lnL0 = -951.301853
Iterating by ming2
Initial: fx= 951.301853
x= 0.07274 0.05356 0.20458 0.02928 0.04542 0.47741 0.03816 0.01968 0.03653 2.70984 0.21518 0.50977 0.04044 0.10131 0.14681
1 h-m-p 0.0000 0.0008 87.7322 ++++ 948.830507 m 0.0008 22 | 1/15
2 h-m-p 0.0008 0.0041 57.1217 CYCCC 948.192986 4 0.0007 47 | 1/15
3 h-m-p 0.0002 0.0010 136.4706 ++ 944.123292 m 0.0010 65 | 2/15
4 h-m-p 0.0027 0.0722 44.7385 YCCCC 943.511269 4 0.0015 90 | 2/15
5 h-m-p 0.0008 0.0038 41.8654 CCCCC 943.058843 4 0.0011 116 | 2/15
6 h-m-p 0.0017 0.0087 16.4582 CCC 942.704247 2 0.0021 138 | 2/15
7 h-m-p 0.0014 0.0072 11.9035 CCCCC 942.259963 4 0.0023 164 | 2/15
8 h-m-p 0.0006 0.0030 26.2588 CCCCC 942.009092 4 0.0007 190 | 2/15
9 h-m-p 0.0047 0.0587 3.9021 YCC 941.983740 2 0.0029 211 | 2/15
10 h-m-p 0.0041 0.2949 2.7547 ++YCC 941.747322 2 0.0486 234 | 2/15
11 h-m-p 0.0017 0.0263 80.1461 +YYCC 940.994736 3 0.0051 257 | 2/15
12 h-m-p 0.3196 1.5980 0.6714 YCCC 940.556159 3 0.1787 280 | 1/15
13 h-m-p 0.0030 0.0332 39.3782 -CYC 940.459076 2 0.0002 315 | 1/15
14 h-m-p 0.0020 0.1043 4.4478 ++YCCCC 939.146707 4 0.0631 342 | 1/15
15 h-m-p 0.3674 1.8371 0.4657 CYC 938.991951 2 0.3484 363 | 0/15
16 h-m-p 0.0831 0.5534 1.9512 --CC 938.990508 1 0.0011 399 | 0/15
17 h-m-p 0.0205 3.4734 0.1093 ++YCCC 938.875314 3 0.6796 424 | 0/15
18 h-m-p 0.5570 8.0000 0.1333 +CCC 938.772631 2 2.3918 462 | 0/15
19 h-m-p 1.6000 8.0000 0.1677 YCC 938.737041 2 1.1368 498 | 0/15
20 h-m-p 1.4766 8.0000 0.1291 YC 938.722341 1 0.7181 532 | 0/15
21 h-m-p 1.6000 8.0000 0.0131 CC 938.717621 1 1.4432 567 | 0/15
22 h-m-p 0.6873 8.0000 0.0276 CC 938.716515 1 0.7816 602 | 0/15
23 h-m-p 1.6000 8.0000 0.0024 YC 938.716407 1 0.9892 636 | 0/15
24 h-m-p 1.6000 8.0000 0.0011 Y 938.716360 0 2.8342 669 | 0/15
25 h-m-p 1.6000 8.0000 0.0010 YC 938.716294 1 2.9568 703 | 0/15
26 h-m-p 1.6000 8.0000 0.0017 YC 938.716219 1 2.8288 737 | 0/15
27 h-m-p 1.5625 8.0000 0.0030 Y 938.716198 0 1.0564 770 | 0/15
28 h-m-p 1.6000 8.0000 0.0012 Y 938.716194 0 1.1257 803 | 0/15
29 h-m-p 1.6000 8.0000 0.0001 Y 938.716194 0 0.8957 836 | 0/15
30 h-m-p 1.2608 8.0000 0.0000 Y 938.716194 0 0.9999 869 | 0/15
31 h-m-p 1.6000 8.0000 0.0000 C 938.716194 0 1.3146 902 | 0/15
32 h-m-p 1.6000 8.0000 0.0000 ---------Y 938.716194 0 0.0000 944
Out..
lnL = -938.716194
945 lfun, 3780 eigenQcodon, 25515 P(t)
Time used: 0:22
Model 7: beta
TREE # 1
(1, (4, (5, 6)), (2, 3)); MP score: 97
0.072735 0.053561 0.204580 0.029283 0.045417 0.477407 0.038160 0.019676 0.036530 2.696782 0.603915 1.022819
ntime & nrate & np: 9 1 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.461247
np = 12
lnL0 = -967.002729
Iterating by ming2
Initial: fx= 967.002729
x= 0.07274 0.05356 0.20458 0.02928 0.04542 0.47741 0.03816 0.01968 0.03653 2.69678 0.60392 1.02282
1 h-m-p 0.0000 0.0035 98.1264 +++CCYC 964.585195 3 0.0007 25 | 0/12
2 h-m-p 0.0007 0.0037 81.7881 +YYYCCC 956.838313 5 0.0027 48 | 0/12
3 h-m-p 0.0001 0.0003 665.4613 +YYCCC 952.539405 4 0.0002 70 | 0/12
4 h-m-p 0.0001 0.0003 927.9525 YCYCCCC 947.328356 6 0.0002 95 | 0/12
5 h-m-p 0.0002 0.0010 110.9319 YCCC 947.027483 3 0.0001 115 | 0/12
6 h-m-p 0.0006 0.0032 23.9758 YCY 946.912308 2 0.0005 133 | 0/12
7 h-m-p 0.0005 0.0204 25.6012 ++YCCC 945.997937 3 0.0052 155 | 0/12
8 h-m-p 0.0027 0.0266 48.2220 CCCC 945.243475 3 0.0027 176 | 0/12
9 h-m-p 0.0181 0.1950 7.2387 YCCCC 944.330496 4 0.0361 198 | 0/12
10 h-m-p 0.0026 0.0131 19.2978 CCC 944.201617 2 0.0023 217 | 0/12
11 h-m-p 0.0246 0.1231 0.5495 CCCC 944.068675 3 0.0368 238 | 0/12
12 h-m-p 0.0021 0.0489 9.5686 ++YCYCCC 941.022693 5 0.0249 275 | 0/12
13 h-m-p 0.4970 2.4852 0.2835 YYCCCC 940.507406 5 0.5062 298 | 0/12
14 h-m-p 1.6000 8.0000 0.0690 CCCC 940.204599 3 2.1946 331 | 0/12
15 h-m-p 0.5029 6.4501 0.3012 +YYYCC 939.682244 4 1.8561 364 | 0/12
16 h-m-p 0.4652 2.3259 0.5501 YCYCCC 939.095477 5 1.0901 399 | 0/12
17 h-m-p 0.5409 2.7043 0.1361 YYCC 938.937083 3 0.4033 430 | 0/12
18 h-m-p 0.5817 8.0000 0.0944 CCC 938.833472 2 0.5088 461 | 0/12
19 h-m-p 0.7695 8.0000 0.0624 CCC 938.814218 2 1.1371 492 | 0/12
20 h-m-p 1.6000 8.0000 0.0299 YC 938.806870 1 1.0493 520 | 0/12
21 h-m-p 0.6008 8.0000 0.0522 CC 938.803241 1 0.7538 549 | 0/12
22 h-m-p 1.6000 8.0000 0.0138 YC 938.802149 1 0.8914 577 | 0/12
23 h-m-p 1.6000 8.0000 0.0010 C 938.801980 0 1.6100 604 | 0/12
24 h-m-p 1.6000 8.0000 0.0009 YC 938.801757 1 2.9126 632 | 0/12
25 h-m-p 1.6000 8.0000 0.0007 Y 938.801669 0 1.2226 659 | 0/12
26 h-m-p 1.6000 8.0000 0.0001 Y 938.801668 0 1.0457 686 | 0/12
27 h-m-p 1.6000 8.0000 0.0001 Y 938.801668 0 0.8442 713 | 0/12
28 h-m-p 1.6000 8.0000 0.0000 Y 938.801668 0 1.1358 740 | 0/12
29 h-m-p 1.6000 8.0000 0.0000 Y 938.801668 0 0.2181 767 | 0/12
30 h-m-p 0.2792 8.0000 0.0000 --------C 938.801668 0 0.0000 802
Out..
lnL = -938.801668
803 lfun, 8833 eigenQcodon, 72270 P(t)
Time used: 0:45
Model 8: beta&w>1
TREE # 1
(1, (4, (5, 6)), (2, 3)); MP score: 97
initial w for M8:NSbetaw>1 reset.
0.072735 0.053561 0.204580 0.029283 0.045417 0.477407 0.038160 0.019676 0.036530 2.704684 0.900000 0.523761 1.873198 2.941449
ntime & nrate & np: 9 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.491300
np = 14
lnL0 = -963.878477
Iterating by ming2
Initial: fx= 963.878477
x= 0.07274 0.05356 0.20458 0.02928 0.04542 0.47741 0.03816 0.01968 0.03653 2.70468 0.90000 0.52376 1.87320 2.94145
1 h-m-p 0.0000 0.0007 182.0280 +++YCCC 952.833588 3 0.0007 27 | 0/14
2 h-m-p 0.0000 0.0001 99.0504 ++ 952.068697 m 0.0001 44 | 1/14
3 h-m-p 0.0000 0.0006 275.8525 ++YCYCCC 948.311270 5 0.0003 71 | 1/14
4 h-m-p 0.0004 0.0018 69.6694 YCYCCC 946.852462 5 0.0009 96 | 1/14
5 h-m-p 0.0002 0.0010 252.7404 +YCYCCC 943.974157 5 0.0005 122 | 1/14
6 h-m-p 0.0001 0.0005 552.5581 CYCCCC 942.121384 5 0.0002 148 | 1/14
7 h-m-p 0.0010 0.0052 35.2896 YC 941.928013 1 0.0005 166 | 1/14
8 h-m-p 0.0015 0.0076 6.8270 CC 941.914294 1 0.0006 185 | 1/14
9 h-m-p 0.0017 0.0931 2.2894 C 941.907244 0 0.0017 202 | 1/14
10 h-m-p 0.0026 0.0815 1.4965 +YCC 941.875298 2 0.0079 223 | 1/14
11 h-m-p 0.0029 0.0307 4.1115 +YC 941.738060 1 0.0075 242 | 1/14
12 h-m-p 0.0026 0.0892 11.7976 +YCCC 940.456586 3 0.0198 265 | 1/14
13 h-m-p 0.1113 0.7984 2.1004 +YYCCC 939.557243 4 0.3671 289 | 1/14
14 h-m-p 0.4226 2.1131 0.8262 CYCCC 939.216533 4 0.5993 313 | 1/14
15 h-m-p 0.7177 3.5886 0.2825 CCCCC 939.064828 4 0.9145 351 | 1/14
16 h-m-p 0.9095 8.0000 0.2841 CYC 938.906918 2 0.8603 384 | 1/14
17 h-m-p 1.3537 7.4914 0.1805 YCC 938.828102 2 0.8995 417 | 1/14
18 h-m-p 1.6000 8.0000 0.0400 YCC 938.811684 2 1.2268 450 | 1/14
19 h-m-p 0.9743 8.0000 0.0504 YC 938.804743 1 0.4622 481 | 1/14
20 h-m-p 1.3806 8.0000 0.0169 YC 938.802433 1 1.0753 512 | 1/14
21 h-m-p 1.6000 8.0000 0.0049 YC 938.802096 1 1.2468 543 | 1/14
22 h-m-p 1.6000 8.0000 0.0006 Y 938.802090 0 1.1399 573 | 1/14
23 h-m-p 1.6000 8.0000 0.0004 C 938.802089 0 1.6166 603 | 1/14
24 h-m-p 1.6000 8.0000 0.0002 C 938.802089 0 2.0800 633 | 1/14
25 h-m-p 1.2583 8.0000 0.0004 +Y 938.802088 0 5.8663 664 | 1/14
26 h-m-p 1.1537 8.0000 0.0018 ++ 938.802085 m 8.0000 694 | 1/14
27 h-m-p 0.1583 8.0000 0.0915 ++C 938.802057 0 2.9098 726 | 1/14
28 h-m-p 1.6000 8.0000 0.1607 ++ 938.801776 m 8.0000 756 | 1/14
29 h-m-p 0.0218 0.1090 1.9021 ++ 938.801739 m 0.1090 786 | 2/14
30 h-m-p 0.1231 8.0000 0.0019 +YC 938.801667 1 1.1119 805 | 1/14
31 h-m-p 0.0018 0.6954 1.1814 C 938.801404 0 0.0016 834 | 1/14
32 h-m-p 0.6006 8.0000 0.0031 ++ 938.799991 m 8.0000 851 | 1/14
33 h-m-p 1.6000 8.0000 0.0082 C 938.799438 0 1.7939 881 | 1/14
34 h-m-p 1.6000 8.0000 0.0034 Y 938.799397 0 1.1772 911 | 1/14
35 h-m-p 1.6000 8.0000 0.0006 Y 938.799396 0 0.9860 941 | 1/14
36 h-m-p 1.6000 8.0000 0.0000 Y 938.799396 0 1.1096 971 | 1/14
37 h-m-p 1.6000 8.0000 0.0000 Y 938.799396 0 1.1495 1001 | 1/14
38 h-m-p 1.6000 8.0000 0.0000 ---Y 938.799396 0 0.0063 1034
Out..
lnL = -938.799396
1035 lfun, 12420 eigenQcodon, 102465 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -950.530334 S = -902.162406 -40.709081
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 89 patterns 1:17
did 20 / 89 patterns 1:17
did 30 / 89 patterns 1:18
did 40 / 89 patterns 1:18
did 50 / 89 patterns 1:18
did 60 / 89 patterns 1:18
did 70 / 89 patterns 1:18
did 80 / 89 patterns 1:19
did 89 / 89 patterns 1:19
Time used: 1:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=130
D_melanogaster_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
D_sechellia_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
D_simulans_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
D_yakuba_Chrac-14-PB MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS
D_erecta_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS
D_biarmipes_Chrac-14-PB MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS
***************.*****:**:*********.***************
D_melanogaster_Chrac-14-PB SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
D_sechellia_Chrac-14-PB SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
D_simulans_Chrac-14-PB SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK
D_yakuba_Chrac-14-PB SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
D_erecta_Chrac-14-PB SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
D_biarmipes_Chrac-14-PB SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK
********************************************:**:**
D_melanogaster_Chrac-14-PB ESKASKKDSNTAENANASATAT-AEEAPEo
D_sechellia_Chrac-14-PB ESKASKKDSSTVENANASSTAAAAEEAAE-
D_simulans_Chrac-14-PB ESKASKKDSSTAENANASATAAAAEEAAE-
D_yakuba_Chrac-14-PB ESKASKKDSSVAESANASATPA-AEEAAEo
D_erecta_Chrac-14-PB ESKASKKDSSTTENANAIATAA-AEVAAEo
D_biarmipes_Chrac-14-PB ESKASKKDTSSSENANASSTAV-VEEATEo
********:. *.*** :*.. .* *.*
>D_melanogaster_Chrac-14-PB ATGGTCGAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTGATTGGCCG GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGC GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTCGTGACATCC TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA GGATATTCTACAGACCCTCACCGAGCTAGACTTCGAAAGCTTCGTGCCCT CTCTGACGCAGGATCTCGAGGTCTATCGTAAAGTGGTCAAGGAGAAAAAG GAGAGCAAGGCCAGCAAGAAGGATTCCAACACTGCCGAAAATGCCAACGC CAGTGCCACCGCAACA---GCAGAGGAAGCCCCCGAG--- >D_sechellia_Chrac-14-PB ATGGTCGAGCGCATCGAGGATCTTAACCTACCGAATGCCGTGATTGGCCG GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGA GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA GGACATTCTACAGACCCTCACCGAGCTAGACTTCGAGAGCTTTGTGCCCT CCCTGACGCAGGATCTTGAGGTCTATCGAAAAGTGGTCAAGGAGAAAAAG GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACTGTCGAAAATGCCAACGC CAGTTCCACAGCCGCAGCAGCAGAGGAAGCCGCCGAG--- >D_simulans_Chrac-14-PB ATGGTCGAGCGCATCGAGGATCTTAACCTACCAAATGCCGTGATTGGCCG GCTCATCAAGGAAGCACTGCCGGAGTCAGCTAGTGTCAGCAAGGAAGCGA GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC TCGTCGACGGCGTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA GGATATTCTACAGACCCTTACCGAGCTAGACTTCGAGAGCTTTGTGCCCT CCCTGACGCAAGATCTTGAGGTCTATCGAAAAGTGGTCAAGGAGAAAAAG GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACTGCCGAAAATGCCAACGC CAGTGCCACCGCCGCAGCAGCAGAGGAAGCCGCCGAG--- >D_yakuba_Chrac-14-PB ATGGTCGAGCGCATCGAGGATCTTAACCTGCCGAATGCCGTAATTGCGCG GCTCATCAAGGAATCACTGCCGGAGTCAGCCAGCGTCAGCAAGGAAGCGC GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC TCGTCGACGGCGTTGGCCCACAAGCAGAATCACAAGACCATCACGGCCAA AGATATTCTACAGACCCTCACTGAGCTGGACTTCGAGAGTTTTGTGCCCT CCCTGACGCAGGATCTCGAGGTCTATCGCAAGATGGTCAAGGACAAAAAG GAGAGCAAGGCCAGCAAGAAAGACTCCAGCGTCGCCGAAAGTGCCAATGC AAGTGCGACTCCAGCC---GCAGAGGAGGCTGCCGAG--- >D_erecta_Chrac-14-PB ATGGTCGAACGCATCGAGGATCTTAACCTGCCGAACGCCGTGATTGGCCG GCTCATCAAGGAAGCACTGCCGGAGTCAGCCAGCGTCAGCAAGGAAGCGC GAGCAGCGATCGCCCGAGCGGCATCTGTGTTTGCCATCTTTGTGACATCC TCGTCGACGGCTTTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA GGATATTCTACAGACCCTCACCGAGCTGGACTTCGAGAGCTTTGTGCCCT CCCTGACGCAGGATCTGGAGGTCTATCGCAAAATGGTCAAGGACAAAAAG GAGAGCAAGGCCAGCAAGAAGGACTCCAGCACCACCGAAAATGCCAACGC CATTGCCACAGCAGCC---GCGGAGGTAGCTGCCGAG--- >D_biarmipes_Chrac-14-PB ATGGTCGAGCGCATCGAGGACCTCAACCTGCCCAACGCTGTGATTGCCCG GCTCATCAAGGAATCGCTGCCGGACTCTGCGAGCGTCAGCAAGGAGGCGC GCGGTGCGATTGCCCGGGCAGCATCCGTGTTTGCCATCTTCGTGACCTCC TCGTCGACGGCTCTGGCCCACAAGCAGAACCACAAGACCATCACGGCCAA GGACATTCTGCAGACCCTCACCGAGCTGGACTTCGAGAGTTTCGTGCCCT CGCTGACGCAGGACCTGGAGGTCTACCGGAAAATGGTGAAGGATAAGAAG GAGAGCAAGGCCAGCAAGAAGGACACGAGCAGCTCGGAAAATGCCAACGC CAGCAGCACGGCCGTC---GTTGAAGAAGCCACCGAG---
>D_melanogaster_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK ESKASKKDSNTAENANASATAT-AEEAPE >D_sechellia_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK ESKASKKDSSTVENANASSTAAAAEEAAE >D_simulans_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEKK ESKASKKDSSTAENANASATAAAAEEAAE >D_yakuba_Chrac-14-PB MVERIEDLNLPNAVIARLIKESLPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK ESKASKKDSSVAESANASATPA-AEEAAE >D_erecta_Chrac-14-PB MVERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK ESKASKKDSSTTENANAIATAA-AEVAAE >D_biarmipes_Chrac-14-PB MVERIEDLNLPNAVIARLIKESLPDSASVSKEARGAIARAASVFAIFVTS SSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKMVKDKK ESKASKKDTSSSENANASSTAV-VEEATE
#NEXUS
[ID: 3081257782]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_Chrac-14-PB
D_sechellia_Chrac-14-PB
D_simulans_Chrac-14-PB
D_yakuba_Chrac-14-PB
D_erecta_Chrac-14-PB
D_biarmipes_Chrac-14-PB
;
end;
begin trees;
translate
1 D_melanogaster_Chrac-14-PB,
2 D_sechellia_Chrac-14-PB,
3 D_simulans_Chrac-14-PB,
4 D_yakuba_Chrac-14-PB,
5 D_erecta_Chrac-14-PB,
6 D_biarmipes_Chrac-14-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03946835,(4:0.1022241,(5:0.0192089,6:0.4134926)0.877:0.03138673)0.989:0.04538793,(2:0.01636486,3:0.01467203)0.988:0.02358751);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03946835,(4:0.1022241,(5:0.0192089,6:0.4134926):0.03138673):0.04538793,(2:0.01636486,3:0.01467203):0.02358751);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1003.62 -1019.47
2 -1003.82 -1019.20
--------------------------------------
TOTAL -1003.71 -1019.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/206/Chrac-14-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.741672 0.021176 0.482745 1.030501 0.724172 1244.74 1259.94 1.000
r(A<->C){all} 0.065714 0.000859 0.011769 0.120615 0.061903 802.44 818.04 1.000
r(A<->G){all} 0.212069 0.003302 0.109859 0.333056 0.206406 534.66 608.84 1.000
r(A<->T){all} 0.083458 0.002556 0.000215 0.178753 0.075942 461.48 482.80 1.000
r(C<->G){all} 0.053630 0.000579 0.009429 0.099983 0.051294 692.26 922.20 1.001
r(C<->T){all} 0.511629 0.006240 0.352431 0.663435 0.512056 639.85 685.03 1.000
r(G<->T){all} 0.073500 0.001480 0.011034 0.148840 0.068235 698.19 741.89 1.000
pi(A){all} 0.245949 0.000428 0.207191 0.287520 0.245300 1071.39 1088.14 1.000
pi(C){all} 0.304393 0.000430 0.264670 0.345523 0.303953 1056.12 1148.43 1.000
pi(G){all} 0.296726 0.000466 0.254436 0.338992 0.296180 1254.80 1314.85 1.000
pi(T){all} 0.152932 0.000258 0.122058 0.185669 0.152522 1059.87 1253.58 1.000
alpha{1,2} 0.065419 0.001459 0.000147 0.130183 0.066039 1145.79 1189.27 1.000
alpha{3} 1.883304 0.536422 0.720060 3.367525 1.765320 959.68 1230.34 1.000
pinvar{all} 0.280054 0.009101 0.088615 0.463562 0.284792 1244.97 1372.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/206/Chrac-14-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 128
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 3 3 3 3 1 | Ser TCT 2 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 0 | Cys TGT 0 0 0 0 0 0
TTC 3 1 1 1 1 3 | TCC 2 4 3 3 3 2 | TAC 0 0 0 0 0 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 2 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 0 | TCG 2 2 2 2 2 5 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 2 3 1 1 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 0 0 0 0 0
CTC 3 2 1 3 2 3 | CCC 2 1 1 1 1 2 | CAC 2 2 2 2 2 2 | CGC 1 1 1 2 2 2
CTA 2 3 3 1 1 0 | CCA 0 0 1 1 0 0 | Gln CAA 0 0 1 0 0 0 | CGA 2 2 2 2 2 0
CTG 3 2 2 4 5 7 | CCG 2 2 1 2 2 1 | CAG 3 3 2 3 3 3 | CGG 1 1 1 1 1 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 3 3 | Thr ACT 1 1 1 2 0 0 | Asn AAT 2 2 2 3 1 1 | Ser AGT 2 2 2 3 0 1
ATC 5 5 5 5 5 4 | ACC 4 3 4 2 5 5 | AAC 4 3 3 1 4 4 | AGC 4 5 5 5 6 8
ATA 0 0 0 0 0 0 | ACA 2 2 1 1 2 0 | Lys AAA 2 2 2 3 2 1 | Arg AGA 0 1 1 0 0 0
Met ATG 1 1 1 2 2 2 | ACG 3 3 3 3 3 5 | AAG 10 10 10 9 10 11 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 1 | Ala GCT 1 1 1 1 2 2 | Asp GAT 4 2 3 3 3 1 | Gly GGT 0 0 0 0 0 1
GTC 4 5 4 5 4 4 | GCC 11 11 13 11 12 10 | GAC 1 3 2 3 3 6 | GGC 1 1 1 0 1 0
GTA 0 0 0 1 1 0 | GCA 5 5 5 4 4 2 | Glu GAA 5 4 4 3 4 4 | GGA 0 0 0 0 0 0
GTG 5 5 5 3 4 5 | GCG 4 4 4 6 4 3 | GAG 9 10 10 10 8 8 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Chrac-14-PB
position 1: T:0.10156 C:0.17969 A:0.32812 G:0.39062
position 2: T:0.24219 C:0.32812 A:0.33594 G:0.09375
position 3: T:0.14062 C:0.36719 A:0.14844 G:0.34375
Average T:0.16146 C:0.29167 A:0.27083 G:0.27604
#2: D_sechellia_Chrac-14-PB
position 1: T:0.10938 C:0.16406 A:0.32812 G:0.39844
position 2: T:0.25000 C:0.32031 A:0.32812 G:0.10156
position 3: T:0.13281 C:0.36719 A:0.15625 G:0.34375
Average T:0.16406 C:0.28385 A:0.27083 G:0.28125
#3: D_simulans_Chrac-14-PB
position 1: T:0.10156 C:0.16406 A:0.32812 G:0.40625
position 2: T:0.24219 C:0.32812 A:0.32812 G:0.10156
position 3: T:0.14844 C:0.35938 A:0.16406 G:0.32812
Average T:0.16406 C:0.28385 A:0.27344 G:0.27865
#4: D_yakuba_Chrac-14-PB
position 1: T:0.10938 C:0.17969 A:0.32031 G:0.39062
position 2: T:0.25000 C:0.32812 A:0.32031 G:0.10156
position 3: T:0.15625 C:0.34375 A:0.14062 G:0.35938
Average T:0.17188 C:0.28385 A:0.26042 G:0.28385
#5: D_erecta_Chrac-14-PB
position 1: T:0.10156 C:0.17188 A:0.33594 G:0.39062
position 2: T:0.25781 C:0.32812 A:0.32031 G:0.09375
position 3: T:0.11719 C:0.39844 A:0.13281 G:0.35156
Average T:0.15885 C:0.29948 A:0.26302 G:0.27865
#6: D_biarmipes_Chrac-14-PB
position 1: T:0.10156 C:0.17969 A:0.35156 G:0.36719
position 2: T:0.25781 C:0.29688 A:0.32812 G:0.11719
position 3: T:0.09375 C:0.43750 A:0.05469 G:0.41406
Average T:0.15104 C:0.30469 A:0.24479 G:0.29948
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 14 | Ser S TCT 7 | Tyr Y TAT 5 | Cys C TGT 0
TTC 10 | TCC 17 | TAC 1 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 5 | TCG 15 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 8 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 1
CTC 14 | CCC 8 | CAC 12 | CGC 9
CTA 10 | CCA 2 | Gln Q CAA 1 | CGA 10
CTG 23 | CCG 10 | CAG 17 | CGG 8
------------------------------------------------------------------------------
Ile I ATT 14 | Thr T ACT 5 | Asn N AAT 11 | Ser S AGT 10
ATC 29 | ACC 23 | AAC 19 | AGC 33
ATA 0 | ACA 8 | Lys K AAA 12 | Arg R AGA 2
Met M ATG 9 | ACG 20 | AAG 60 | AGG 0
------------------------------------------------------------------------------
Val V GTT 1 | Ala A GCT 8 | Asp D GAT 16 | Gly G GGT 1
GTC 26 | GCC 68 | GAC 18 | GGC 4
GTA 2 | GCA 25 | Glu E GAA 24 | GGA 0
GTG 27 | GCG 25 | GAG 55 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10417 C:0.17318 A:0.33203 G:0.39062
position 2: T:0.25000 C:0.32161 A:0.32682 G:0.10156
position 3: T:0.13151 C:0.37891 A:0.13281 G:0.35677
Average T:0.16189 C:0.29123 A:0.26389 G:0.28299
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Chrac-14-PB
D_sechellia_Chrac-14-PB 0.1259 (0.0175 0.1389)
D_simulans_Chrac-14-PB 0.0688 (0.0104 0.1517) 0.1266 (0.0069 0.0548)
D_yakuba_Chrac-14-PB 0.1192 (0.0390 0.3270) 0.1078 (0.0353 0.3276) 0.0779 (0.0281 0.3612)
D_erecta_Chrac-14-PB 0.1289 (0.0282 0.2187) 0.1286 (0.0246 0.1913) 0.0750 (0.0175 0.2333) 0.1443 (0.0317 0.2200)
D_biarmipes_Chrac-14-PB 0.0876 (0.0573 0.6541) 0.0924 (0.0579 0.6264) 0.0756 (0.0536 0.7085) 0.0533 (0.0474 0.8888) 0.0895 (0.0499 0.5578)
Model 0: one-ratio
TREE # 1: (1, (4, (5, 6)), (2, 3)); MP score: 97
lnL(ntime: 9 np: 11): -951.408051 +0.000000
7..1 7..8 8..4 8..9 9..5 9..6 7..10 10..2 10..3
0.076110 0.082055 0.175952 0.029654 0.040603 0.575053 0.037400 0.029165 0.026586 2.663748 0.080886
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.07258
(1: 0.076110, (4: 0.175952, (5: 0.040603, 6: 0.575053): 0.029654): 0.082055, (2: 0.029165, 3: 0.026586): 0.037400);
(D_melanogaster_Chrac-14-PB: 0.076110, (D_yakuba_Chrac-14-PB: 0.175952, (D_erecta_Chrac-14-PB: 0.040603, D_biarmipes_Chrac-14-PB: 0.575053): 0.029654): 0.082055, (D_sechellia_Chrac-14-PB: 0.029165, D_simulans_Chrac-14-PB: 0.026586): 0.037400);
Detailed output identifying parameters
kappa (ts/tv) = 2.66375
omega (dN/dS) = 0.08089
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.076 294.4 89.6 0.0809 0.0070 0.0859 2.0 7.7
7..8 0.082 294.4 89.6 0.0809 0.0075 0.0926 2.2 8.3
8..4 0.176 294.4 89.6 0.0809 0.0161 0.1986 4.7 17.8
8..9 0.030 294.4 89.6 0.0809 0.0027 0.0335 0.8 3.0
9..5 0.041 294.4 89.6 0.0809 0.0037 0.0458 1.1 4.1
9..6 0.575 294.4 89.6 0.0809 0.0525 0.6492 15.5 58.1
7..10 0.037 294.4 89.6 0.0809 0.0034 0.0422 1.0 3.8
10..2 0.029 294.4 89.6 0.0809 0.0027 0.0329 0.8 2.9
10..3 0.027 294.4 89.6 0.0809 0.0024 0.0300 0.7 2.7
tree length for dN: 0.0979
tree length for dS: 1.2109
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, (5, 6)), (2, 3)); MP score: 97
lnL(ntime: 9 np: 12): -939.061046 +0.000000
7..1 7..8 8..4 8..9 9..5 9..6 7..10 10..2 10..3
0.079455 0.086729 0.184643 0.031816 0.037889 0.642309 0.040301 0.029648 0.028198 2.709841 0.899186 0.021616
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.16099
(1: 0.079455, (4: 0.184643, (5: 0.037889, 6: 0.642309): 0.031816): 0.086729, (2: 0.029648, 3: 0.028198): 0.040301);
(D_melanogaster_Chrac-14-PB: 0.079455, (D_yakuba_Chrac-14-PB: 0.184643, (D_erecta_Chrac-14-PB: 0.037889, D_biarmipes_Chrac-14-PB: 0.642309): 0.031816): 0.086729, (D_sechellia_Chrac-14-PB: 0.029648, D_simulans_Chrac-14-PB: 0.028198): 0.040301);
Detailed output identifying parameters
kappa (ts/tv) = 2.70984
dN/dS (w) for site classes (K=2)
p: 0.89919 0.10081
w: 0.02162 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.079 294.3 89.7 0.1203 0.0098 0.0813 2.9 7.3
7..8 0.087 294.3 89.7 0.1203 0.0107 0.0888 3.1 8.0
8..4 0.185 294.3 89.7 0.1203 0.0227 0.1890 6.7 16.9
8..9 0.032 294.3 89.7 0.1203 0.0039 0.0326 1.2 2.9
9..5 0.038 294.3 89.7 0.1203 0.0047 0.0388 1.4 3.5
9..6 0.642 294.3 89.7 0.1203 0.0791 0.6574 23.3 58.9
7..10 0.040 294.3 89.7 0.1203 0.0050 0.0412 1.5 3.7
10..2 0.030 294.3 89.7 0.1203 0.0036 0.0303 1.1 2.7
10..3 0.028 294.3 89.7 0.1203 0.0035 0.0289 1.0 2.6
Time used: 0:07
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, (5, 6)), (2, 3)); MP score: 97
lnL(ntime: 9 np: 14): -939.061046 +0.000000
7..1 7..8 8..4 8..9 9..5 9..6 7..10 10..2 10..3
0.079455 0.086729 0.184643 0.031816 0.037889 0.642309 0.040301 0.029648 0.028198 2.709841 0.899186 0.064929 0.021616 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.16099
(1: 0.079455, (4: 0.184643, (5: 0.037889, 6: 0.642309): 0.031816): 0.086729, (2: 0.029648, 3: 0.028198): 0.040301);
(D_melanogaster_Chrac-14-PB: 0.079455, (D_yakuba_Chrac-14-PB: 0.184643, (D_erecta_Chrac-14-PB: 0.037889, D_biarmipes_Chrac-14-PB: 0.642309): 0.031816): 0.086729, (D_sechellia_Chrac-14-PB: 0.029648, D_simulans_Chrac-14-PB: 0.028198): 0.040301);
Detailed output identifying parameters
kappa (ts/tv) = 2.70984
dN/dS (w) for site classes (K=3)
p: 0.89919 0.06493 0.03589
w: 0.02162 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.079 294.3 89.7 0.1203 0.0098 0.0813 2.9 7.3
7..8 0.087 294.3 89.7 0.1203 0.0107 0.0888 3.1 8.0
8..4 0.185 294.3 89.7 0.1203 0.0227 0.1890 6.7 16.9
8..9 0.032 294.3 89.7 0.1203 0.0039 0.0326 1.2 2.9
9..5 0.038 294.3 89.7 0.1203 0.0047 0.0388 1.4 3.5
9..6 0.642 294.3 89.7 0.1203 0.0791 0.6574 23.3 58.9
7..10 0.040 294.3 89.7 0.1203 0.0050 0.0412 1.5 3.7
10..2 0.030 294.3 89.7 0.1203 0.0036 0.0303 1.1 2.7
10..3 0.028 294.3 89.7 0.1203 0.0035 0.0289 1.0 2.6
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Chrac-14-PB)
Pr(w>1) post mean +- SE for w
22 A 0.507 1.626 +- 1.339
111 T 0.513 1.609 +- 1.093
112 A 0.575 1.854 +- 1.490
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.562 0.207 0.086 0.046 0.029 0.021 0.016 0.013 0.011 0.010
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.053
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.093 0.848
sum of density on p0-p1 = 1.000000
Time used: 0:14
Model 3: discrete (3 categories)
TREE # 1: (1, (4, (5, 6)), (2, 3)); MP score: 97
lnL(ntime: 9 np: 15): -938.716194 +0.000000
7..1 7..8 8..4 8..9 9..5 9..6 7..10 10..2 10..3
0.078919 0.085284 0.182801 0.031608 0.038961 0.631872 0.039644 0.029740 0.027699 2.696782 0.176302 0.683713 0.012415 0.012418 0.663266
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14653
(1: 0.078919, (4: 0.182801, (5: 0.038961, 6: 0.631872): 0.031608): 0.085284, (2: 0.029740, 3: 0.027699): 0.039644);
(D_melanogaster_Chrac-14-PB: 0.078919, (D_yakuba_Chrac-14-PB: 0.182801, (D_erecta_Chrac-14-PB: 0.038961, D_biarmipes_Chrac-14-PB: 0.631872): 0.031608): 0.085284, (D_sechellia_Chrac-14-PB: 0.029740, D_simulans_Chrac-14-PB: 0.027699): 0.039644);
Detailed output identifying parameters
kappa (ts/tv) = 2.69678
dN/dS (w) for site classes (K=3)
p: 0.17630 0.68371 0.13999
w: 0.01242 0.01242 0.66327
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.079 294.4 89.6 0.1035 0.0087 0.0841 2.6 7.5
7..8 0.085 294.4 89.6 0.1035 0.0094 0.0909 2.8 8.1
8..4 0.183 294.4 89.6 0.1035 0.0202 0.1948 5.9 17.5
8..9 0.032 294.4 89.6 0.1035 0.0035 0.0337 1.0 3.0
9..5 0.039 294.4 89.6 0.1035 0.0043 0.0415 1.3 3.7
9..6 0.632 294.4 89.6 0.1035 0.0697 0.6734 20.5 60.4
7..10 0.040 294.4 89.6 0.1035 0.0044 0.0422 1.3 3.8
10..2 0.030 294.4 89.6 0.1035 0.0033 0.0317 1.0 2.8
10..3 0.028 294.4 89.6 0.1035 0.0031 0.0295 0.9 2.6
Naive Empirical Bayes (NEB) analysis
Time used: 0:22
Model 7: beta (10 categories)
TREE # 1: (1, (4, (5, 6)), (2, 3)); MP score: 97
lnL(ntime: 9 np: 12): -938.801668 +0.000000
7..1 7..8 8..4 8..9 9..5 9..6 7..10 10..2 10..3
0.078716 0.085207 0.182499 0.031450 0.038796 0.631736 0.039578 0.029619 0.027682 2.704684 0.070722 0.608626
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14528
(1: 0.078716, (4: 0.182499, (5: 0.038796, 6: 0.631736): 0.031450): 0.085207, (2: 0.029619, 3: 0.027682): 0.039578);
(D_melanogaster_Chrac-14-PB: 0.078716, (D_yakuba_Chrac-14-PB: 0.182499, (D_erecta_Chrac-14-PB: 0.038796, D_biarmipes_Chrac-14-PB: 0.631736): 0.031450): 0.085207, (D_sechellia_Chrac-14-PB: 0.029619, D_simulans_Chrac-14-PB: 0.027682): 0.039578);
Detailed output identifying parameters
kappa (ts/tv) = 2.70468
Parameters in M7 (beta):
p = 0.07072 q = 0.60863
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00003 0.00051 0.00539 0.04026 0.21983 0.76250
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.079 294.3 89.7 0.1029 0.0086 0.0840 2.5 7.5
7..8 0.085 294.3 89.7 0.1029 0.0094 0.0909 2.8 8.2
8..4 0.182 294.3 89.7 0.1029 0.0200 0.1948 5.9 17.5
8..9 0.031 294.3 89.7 0.1029 0.0035 0.0336 1.0 3.0
9..5 0.039 294.3 89.7 0.1029 0.0043 0.0414 1.3 3.7
9..6 0.632 294.3 89.7 0.1029 0.0693 0.6743 20.4 60.4
7..10 0.040 294.3 89.7 0.1029 0.0043 0.0422 1.3 3.8
10..2 0.030 294.3 89.7 0.1029 0.0033 0.0316 1.0 2.8
10..3 0.028 294.3 89.7 0.1029 0.0030 0.0295 0.9 2.6
Time used: 0:45
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, (5, 6)), (2, 3)); MP score: 97
lnL(ntime: 9 np: 14): -938.799396 +0.000000
7..1 7..8 8..4 8..9 9..5 9..6 7..10 10..2 10..3
0.078781 0.085256 0.182634 0.031527 0.038782 0.632076 0.039620 0.029640 0.027705 2.705740 0.991941 0.070712 0.649425 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14602
(1: 0.078781, (4: 0.182634, (5: 0.038782, 6: 0.632076): 0.031527): 0.085256, (2: 0.029640, 3: 0.027705): 0.039620);
(D_melanogaster_Chrac-14-PB: 0.078781, (D_yakuba_Chrac-14-PB: 0.182634, (D_erecta_Chrac-14-PB: 0.038782, D_biarmipes_Chrac-14-PB: 0.632076): 0.031527): 0.085256, (D_sechellia_Chrac-14-PB: 0.029640, D_simulans_Chrac-14-PB: 0.027705): 0.039620);
Detailed output identifying parameters
kappa (ts/tv) = 2.70574
Parameters in M8 (beta&w>1):
p0 = 0.99194 p = 0.07071 q = 0.64942
(p1 = 0.00806) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09919 0.09919 0.09919 0.09919 0.09919 0.09919 0.09919 0.09919 0.09919 0.09919 0.00806
w: 0.00000 0.00000 0.00000 0.00000 0.00003 0.00045 0.00475 0.03559 0.19724 0.72562 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.079 294.3 89.7 0.1036 0.0087 0.0839 2.6 7.5
7..8 0.085 294.3 89.7 0.1036 0.0094 0.0908 2.8 8.1
8..4 0.183 294.3 89.7 0.1036 0.0202 0.1945 5.9 17.4
8..9 0.032 294.3 89.7 0.1036 0.0035 0.0336 1.0 3.0
9..5 0.039 294.3 89.7 0.1036 0.0043 0.0413 1.3 3.7
9..6 0.632 294.3 89.7 0.1036 0.0698 0.6733 20.5 60.4
7..10 0.040 294.3 89.7 0.1036 0.0044 0.0422 1.3 3.8
10..2 0.030 294.3 89.7 0.1036 0.0033 0.0316 1.0 2.8
10..3 0.028 294.3 89.7 0.1036 0.0031 0.0295 0.9 2.6
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Chrac-14-PB)
Pr(w>1) post mean +- SE for w
22 A 0.590 1.472 +- 1.301
111 T 0.656 1.558 +- 1.155
112 A 0.709 1.761 +- 1.421
119 A 0.535 1.329 +- 1.114
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
p : 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.006 0.028 0.070 0.128 0.192 0.257 0.319
ws: 0.632 0.200 0.073 0.034 0.020 0.013 0.009 0.007 0.006 0.005
Time used: 1:19
Model 1: NearlyNeutral -939.061046 Model 2: PositiveSelection -939.061046 Model 0: one-ratio -951.408051 Model 3: discrete -938.716194 Model 7: beta -938.801668 Model 8: beta&w>1 -938.799396 Model 0 vs 1 24.694009999999935 Model 2 vs 1 0.0 Model 8 vs 7 0.004543999999896187
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
