>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=248
C1 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C2 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C3 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C4 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C5 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C6 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C7 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C8 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C9 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C10 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C11 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C12 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
**************************************************
C1 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C2 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C3 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C4 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C5 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C6 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C7 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C8 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C9 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C10 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C11 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C12 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
**************************************************
C1 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C2 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C3 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C4 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C5 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C6 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C7 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C8 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C9 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C10 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C11 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C12 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
**************************************************
C1 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C2 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C3 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C4 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C5 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C6 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C7 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C8 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C9 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C10 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C11 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C12 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
**************************************************
C1 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C2 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C3 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C4 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C5 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C6 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C7 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C8 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C9 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C10 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C11 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C12 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
**********************************:*** ********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [32736]--->[32736]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.676 Mb, Max= 31.578 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
FORMAT of file /tmp/tmp6123767141380272777aln Not Supported[FATAL:T-COFFEE]
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:100 BS:248
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.19 C1 C6 99.19
TOP 5 0 99.19 C6 C1 99.19
BOT 0 6 99.19 C1 C7 99.19
TOP 6 0 99.19 C7 C1 99.19
BOT 0 7 99.19 C1 C8 99.19
TOP 7 0 99.19 C8 C1 99.19
BOT 0 8 99.19 C1 C9 99.19
TOP 8 0 99.19 C9 C1 99.19
BOT 0 9 99.19 C1 C10 99.19
TOP 9 0 99.19 C10 C1 99.19
BOT 0 10 99.19 C1 C11 99.19
TOP 10 0 99.19 C11 C1 99.19
BOT 0 11 98.79 C1 C12 98.79
TOP 11 0 98.79 C12 C1 98.79
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.19 C2 C6 99.19
TOP 5 1 99.19 C6 C2 99.19
BOT 1 6 99.19 C2 C7 99.19
TOP 6 1 99.19 C7 C2 99.19
BOT 1 7 99.19 C2 C8 99.19
TOP 7 1 99.19 C8 C2 99.19
BOT 1 8 99.19 C2 C9 99.19
TOP 8 1 99.19 C9 C2 99.19
BOT 1 9 99.19 C2 C10 99.19
TOP 9 1 99.19 C10 C2 99.19
BOT 1 10 99.19 C2 C11 99.19
TOP 10 1 99.19 C11 C2 99.19
BOT 1 11 98.79 C2 C12 98.79
TOP 11 1 98.79 C12 C2 98.79
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.19 C3 C6 99.19
TOP 5 2 99.19 C6 C3 99.19
BOT 2 6 99.19 C3 C7 99.19
TOP 6 2 99.19 C7 C3 99.19
BOT 2 7 99.19 C3 C8 99.19
TOP 7 2 99.19 C8 C3 99.19
BOT 2 8 99.19 C3 C9 99.19
TOP 8 2 99.19 C9 C3 99.19
BOT 2 9 99.19 C3 C10 99.19
TOP 9 2 99.19 C10 C3 99.19
BOT 2 10 99.19 C3 C11 99.19
TOP 10 2 99.19 C11 C3 99.19
BOT 2 11 98.79 C3 C12 98.79
TOP 11 2 98.79 C12 C3 98.79
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.19 C4 C6 99.19
TOP 5 3 99.19 C6 C4 99.19
BOT 3 6 99.19 C4 C7 99.19
TOP 6 3 99.19 C7 C4 99.19
BOT 3 7 99.19 C4 C8 99.19
TOP 7 3 99.19 C8 C4 99.19
BOT 3 8 99.19 C4 C9 99.19
TOP 8 3 99.19 C9 C4 99.19
BOT 3 9 99.19 C4 C10 99.19
TOP 9 3 99.19 C10 C4 99.19
BOT 3 10 99.19 C4 C11 99.19
TOP 10 3 99.19 C11 C4 99.19
BOT 3 11 98.79 C4 C12 98.79
TOP 11 3 98.79 C12 C4 98.79
BOT 4 5 99.19 C5 C6 99.19
TOP 5 4 99.19 C6 C5 99.19
BOT 4 6 99.19 C5 C7 99.19
TOP 6 4 99.19 C7 C5 99.19
BOT 4 7 99.19 C5 C8 99.19
TOP 7 4 99.19 C8 C5 99.19
BOT 4 8 99.19 C5 C9 99.19
TOP 8 4 99.19 C9 C5 99.19
BOT 4 9 99.19 C5 C10 99.19
TOP 9 4 99.19 C10 C5 99.19
BOT 4 10 99.19 C5 C11 99.19
TOP 10 4 99.19 C11 C5 99.19
BOT 4 11 98.79 C5 C12 98.79
TOP 11 4 98.79 C12 C5 98.79
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 5 11 99.60 C6 C12 99.60
TOP 11 5 99.60 C12 C6 99.60
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 6 11 99.60 C7 C12 99.60
TOP 11 6 99.60 C12 C7 99.60
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 7 11 99.60 C8 C12 99.60
TOP 11 7 99.60 C12 C8 99.60
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 8 11 99.60 C9 C12 99.60
TOP 11 8 99.60 C12 C9 99.60
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
BOT 9 11 99.60 C10 C12 99.60
TOP 11 9 99.60 C12 C10 99.60
BOT 10 11 99.60 C11 C12 99.60
TOP 11 10 99.60 C12 C11 99.60
AVG 0 C1 * 99.45
AVG 1 C2 * 99.45
AVG 2 C3 * 99.45
AVG 3 C4 * 99.45
AVG 4 C5 * 99.45
AVG 5 C6 * 99.60
AVG 6 C7 * 99.60
AVG 7 C8 * 99.60
AVG 8 C9 * 99.60
AVG 9 C10 * 99.60
AVG 10 C11 * 99.60
AVG 11 C12 * 99.23
TOT TOT * 99.51
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C2 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C3 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C4 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C5 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C6 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C7 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C8 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C9 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
C10 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C11 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C12 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
****************************************** *******
C1 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C2 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C3 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C4 GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C5 GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C6 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C7 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C8 GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C9 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C10 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C11 GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C12 GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
***.**.***** ******** *****************.**********
C1 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C2 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C3 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C4 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C5 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C6 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C7 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C8 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C9 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
C10 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C11 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C12 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
********************************** **.************
C1 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C2 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C3 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C4 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C5 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C6 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C7 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C8 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C9 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C10 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C11 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C12 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
**************************************************
C1 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C2 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C3 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C4 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C5 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C6 CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C7 CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C8 CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C9 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C10 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C11 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C12 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
*** **************.*******************************
C1 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C2 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C3 AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C4 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C5 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C6 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C7 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C8 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C9 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C10 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C11 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C12 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
************* ************************************
C1 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C2 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C3 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C4 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C5 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C6 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C7 CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C8 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C9 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C10 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C11 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C12 TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
**********.**************************************
C1 CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C2 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C3 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C4 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C5 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C6 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C7 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C8 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C9 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C10 CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
C11 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C12 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
****** ** *********************** ***********.****
C1 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C2 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C3 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C4 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C5 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C6 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C7 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C8 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C9 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C10 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C11 AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C12 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
**********.***** *********************************
C1 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C2 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C3 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C4 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C5 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C6 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C7 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C8 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C9 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C10 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C11 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C12 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
**************************************************
C1 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C2 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C3 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C4 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C5 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C6 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C7 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C8 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C9 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C10 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C11 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C12 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
*********************:****************************
C1 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C2 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C3 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C4 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C5 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C6 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C7 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C8 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C9 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C10 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C11 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C12 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
**************************************************
C1 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C2 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C3 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C4 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C5 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C6 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C7 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C8 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C9 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C10 GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C11 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C12 GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
** ***********.*********** ***********************
C1 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C2 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C3 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C4 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C5 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C6 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
C7 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C8 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C9 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
C10 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C11 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
C12 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
************************************ ** ******** *
C1 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C2 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C3 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C4 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C5 ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C6 ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C7 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C8 ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C9 ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
C10 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C11 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C12 ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
**.* ******** *..*.******:******************
>C1
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C2
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C3
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C4
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C5
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C6
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C7
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C8
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C9
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C10
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C11
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C12
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 744 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480082279
Setting output file names to "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1941058404
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6225957245
Seed = 313290748
Swapseed = 1480082279
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 7 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 30 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2686.402976 -- -24.979900
Chain 2 -- -2680.284916 -- -24.979900
Chain 3 -- -2661.327749 -- -24.979900
Chain 4 -- -2677.595942 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2654.507049 -- -24.979900
Chain 2 -- -2720.086824 -- -24.979900
Chain 3 -- -2666.127949 -- -24.979900
Chain 4 -- -2664.639264 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2686.403] (-2680.285) (-2661.328) (-2677.596) * [-2654.507] (-2720.087) (-2666.128) (-2664.639)
500 -- (-1336.381) (-1342.735) (-1332.209) [-1335.572] * (-1349.358) (-1335.217) [-1336.498] (-1370.288) -- 0:00:00
1000 -- (-1327.473) [-1325.586] (-1335.191) (-1337.548) * (-1320.648) (-1332.185) [-1328.513] (-1328.210) -- 0:00:00
1500 -- (-1324.848) (-1335.562) (-1331.309) [-1324.122] * [-1311.270] (-1329.193) (-1330.506) (-1329.377) -- 0:00:00
2000 -- [-1323.289] (-1327.299) (-1334.398) (-1324.370) * (-1317.483) (-1335.865) (-1319.051) [-1317.825] -- 0:00:00
2500 -- (-1316.571) (-1333.300) [-1324.659] (-1320.956) * (-1322.747) (-1331.295) (-1328.199) [-1324.245] -- 0:06:39
3000 -- (-1315.795) [-1318.807] (-1346.585) (-1328.750) * (-1312.402) [-1326.200] (-1319.965) (-1325.079) -- 0:05:32
3500 -- [-1321.772] (-1318.742) (-1328.258) (-1329.822) * (-1332.302) [-1311.814] (-1329.976) (-1315.149) -- 0:04:44
4000 -- (-1319.281) (-1331.570) (-1333.906) [-1319.697] * (-1326.657) (-1316.278) (-1326.268) [-1321.665] -- 0:04:09
4500 -- (-1312.033) (-1318.870) (-1321.074) [-1326.240] * (-1311.976) [-1312.704] (-1339.654) (-1321.114) -- 0:03:41
5000 -- (-1316.557) (-1328.542) (-1331.583) [-1326.640] * (-1319.644) [-1316.930] (-1331.743) (-1318.716) -- 0:03:19
Average standard deviation of split frequencies: 0.117851
5500 -- [-1317.135] (-1325.559) (-1346.090) (-1335.073) * (-1323.359) (-1309.626) (-1356.112) [-1325.915] -- 0:03:00
6000 -- [-1312.852] (-1323.252) (-1353.111) (-1340.465) * [-1318.025] (-1312.965) (-1361.161) (-1313.824) -- 0:02:45
6500 -- [-1304.499] (-1322.491) (-1336.926) (-1323.248) * [-1313.494] (-1320.760) (-1347.642) (-1314.311) -- 0:05:05
7000 -- (-1314.449) [-1320.226] (-1346.185) (-1321.894) * (-1311.172) (-1313.648) (-1353.444) [-1326.449] -- 0:04:43
7500 -- [-1312.737] (-1329.140) (-1347.419) (-1329.799) * (-1323.466) (-1318.432) (-1355.271) [-1326.799] -- 0:04:24
8000 -- (-1340.986) (-1342.227) (-1346.106) [-1328.800] * (-1322.874) [-1313.953] (-1346.104) (-1329.866) -- 0:04:08
8500 -- (-1348.307) (-1346.447) (-1346.086) [-1324.859] * (-1324.851) [-1315.754] (-1353.586) (-1322.676) -- 0:03:53
9000 -- (-1346.363) (-1345.138) (-1336.893) [-1337.333] * (-1341.479) (-1321.680) (-1358.206) [-1316.368] -- 0:03:40
9500 -- (-1339.651) (-1343.327) (-1331.236) [-1326.190] * (-1331.874) (-1309.761) (-1344.951) [-1315.190] -- 0:03:28
10000 -- (-1349.387) [-1343.398] (-1346.328) (-1320.234) * (-1337.209) [-1326.904] (-1349.363) (-1316.825) -- 0:03:18
Average standard deviation of split frequencies: 0.099437
10500 -- (-1335.715) (-1349.192) [-1327.645] (-1331.979) * (-1331.611) [-1316.459] (-1347.375) (-1317.791) -- 0:03:08
11000 -- (-1324.199) (-1348.310) (-1336.864) [-1342.505] * (-1332.972) (-1328.489) (-1352.106) [-1326.887] -- 0:04:29
11500 -- [-1319.441] (-1343.633) (-1341.099) (-1327.683) * (-1332.341) [-1319.730] (-1351.989) (-1330.588) -- 0:04:17
12000 -- [-1326.876] (-1336.318) (-1344.661) (-1337.189) * (-1339.146) [-1314.710] (-1346.515) (-1316.415) -- 0:04:07
12500 -- [-1327.352] (-1331.736) (-1344.621) (-1339.451) * (-1344.858) (-1306.918) (-1342.128) [-1319.620] -- 0:03:57
13000 -- (-1342.028) (-1348.609) (-1347.728) [-1339.737] * (-1342.396) [-1309.221] (-1345.677) (-1315.319) -- 0:03:47
13500 -- (-1343.765) (-1336.595) (-1341.028) [-1335.915] * (-1338.858) (-1349.081) (-1354.783) [-1330.549] -- 0:03:39
14000 -- (-1351.679) (-1337.276) (-1343.115) [-1338.730] * (-1356.975) (-1351.193) (-1358.518) [-1320.530] -- 0:03:31
14500 -- (-1349.254) (-1340.192) (-1345.503) [-1343.358] * (-1346.984) (-1354.521) (-1348.561) [-1316.536] -- 0:03:23
15000 -- [-1336.756] (-1345.243) (-1342.494) (-1344.593) * (-1334.097) (-1352.750) (-1339.664) [-1308.108] -- 0:04:22
Average standard deviation of split frequencies: 0.069238
15500 -- [-1347.898] (-1342.626) (-1329.492) (-1345.000) * (-1345.218) (-1350.929) (-1347.655) [-1329.095] -- 0:04:14
16000 -- (-1329.092) (-1342.718) (-1338.906) [-1309.877] * (-1342.243) (-1344.372) (-1340.141) [-1313.133] -- 0:04:06
16500 -- [-1324.504] (-1358.731) (-1342.304) (-1326.592) * (-1346.950) (-1344.426) (-1325.066) [-1311.164] -- 0:03:58
17000 -- (-1334.564) (-1349.494) (-1340.185) [-1323.050] * (-1340.057) (-1354.933) (-1328.716) [-1325.128] -- 0:03:51
17500 -- (-1342.620) (-1346.433) [-1334.970] (-1344.326) * (-1343.524) (-1345.641) (-1337.126) [-1314.284] -- 0:03:44
18000 -- (-1342.399) (-1353.471) [-1337.241] (-1341.449) * (-1357.447) (-1332.940) (-1344.641) [-1316.540] -- 0:03:38
18500 -- (-1347.321) (-1349.724) [-1317.822] (-1352.606) * (-1341.878) (-1343.622) (-1341.122) [-1320.457] -- 0:03:32
19000 -- [-1324.096] (-1353.219) (-1337.831) (-1351.002) * (-1346.500) (-1327.878) (-1345.438) [-1322.717] -- 0:04:18
19500 -- [-1328.159] (-1353.896) (-1336.800) (-1340.802) * [-1338.734] (-1344.666) (-1347.618) (-1345.876) -- 0:04:11
20000 -- [-1323.884] (-1353.186) (-1344.571) (-1350.073) * (-1350.824) (-1342.703) (-1335.773) [-1321.439] -- 0:04:05
Average standard deviation of split frequencies: 0.067344
20500 -- [-1320.915] (-1343.668) (-1333.220) (-1336.609) * (-1342.170) (-1341.238) (-1358.861) [-1319.007] -- 0:03:58
21000 -- (-1322.169) (-1340.246) [-1344.374] (-1341.676) * (-1341.910) (-1339.601) (-1344.898) [-1330.197] -- 0:03:53
21500 -- [-1327.553] (-1346.139) (-1345.480) (-1339.597) * (-1355.795) (-1337.199) (-1341.643) [-1317.972] -- 0:03:47
22000 -- [-1332.656] (-1344.048) (-1343.627) (-1347.930) * (-1341.704) (-1325.774) (-1359.551) [-1324.126] -- 0:03:42
22500 -- [-1341.226] (-1337.859) (-1343.683) (-1348.184) * (-1337.902) [-1328.046] (-1353.464) (-1342.873) -- 0:03:37
23000 -- [-1342.840] (-1342.303) (-1343.454) (-1346.952) * (-1340.776) (-1335.461) (-1348.578) [-1333.081] -- 0:04:14
23500 -- [-1319.631] (-1343.941) (-1350.304) (-1337.273) * (-1343.329) (-1345.015) (-1345.004) [-1333.063] -- 0:04:09
24000 -- (-1342.353) [-1334.770] (-1351.131) (-1343.183) * (-1346.408) (-1350.446) (-1342.140) [-1338.051] -- 0:04:04
24500 -- [-1323.266] (-1340.904) (-1355.410) (-1337.965) * (-1340.094) [-1343.218] (-1354.033) (-1334.669) -- 0:03:58
25000 -- [-1326.716] (-1345.243) (-1351.559) (-1338.974) * (-1340.417) (-1343.311) (-1350.334) [-1333.758] -- 0:03:54
Average standard deviation of split frequencies: 0.069623
25500 -- [-1328.411] (-1344.513) (-1343.718) (-1337.885) * (-1344.317) (-1341.341) (-1343.298) [-1335.994] -- 0:03:49
26000 -- [-1336.324] (-1327.142) (-1347.101) (-1346.493) * (-1342.335) (-1342.502) (-1352.212) [-1328.383] -- 0:03:44
26500 -- (-1331.891) [-1331.353] (-1343.415) (-1353.045) * (-1348.726) (-1343.164) (-1341.404) [-1338.848] -- 0:03:40
27000 -- (-1343.952) [-1327.521] (-1349.546) (-1338.307) * (-1350.195) (-1351.273) (-1338.846) [-1319.949] -- 0:04:12
27500 -- [-1329.318] (-1339.825) (-1346.602) (-1340.721) * (-1350.625) (-1344.308) (-1345.223) [-1328.217] -- 0:04:07
28000 -- [-1331.583] (-1343.939) (-1341.271) (-1341.257) * (-1347.389) (-1362.354) (-1350.247) [-1331.938] -- 0:04:03
28500 -- (-1333.463) (-1341.420) [-1334.781] (-1341.349) * (-1347.472) (-1355.541) (-1338.836) [-1322.893] -- 0:03:58
29000 -- [-1329.836] (-1328.495) (-1342.823) (-1342.223) * (-1347.241) (-1341.904) (-1346.563) [-1327.965] -- 0:03:54
29500 -- [-1322.846] (-1345.913) (-1347.542) (-1348.011) * (-1350.741) (-1338.390) (-1338.806) [-1315.960] -- 0:03:50
30000 -- (-1319.806) (-1348.436) [-1330.220] (-1341.024) * (-1349.648) (-1359.379) (-1345.307) [-1323.436] -- 0:03:46
Average standard deviation of split frequencies: 0.061488
30500 -- [-1322.770] (-1338.437) (-1336.038) (-1354.241) * [-1346.184] (-1348.701) (-1346.210) (-1335.696) -- 0:03:42
31000 -- (-1321.241) [-1332.488] (-1345.847) (-1344.291) * (-1346.672) [-1335.628] (-1338.053) (-1352.529) -- 0:04:10
31500 -- [-1336.406] (-1342.832) (-1335.318) (-1342.412) * (-1338.670) [-1338.458] (-1351.364) (-1344.604) -- 0:04:05
32000 -- (-1337.247) (-1336.438) [-1317.793] (-1347.408) * [-1341.652] (-1335.451) (-1342.636) (-1335.592) -- 0:04:02
32500 -- (-1344.498) (-1336.105) [-1325.241] (-1332.836) * (-1338.442) [-1333.444] (-1347.349) (-1344.270) -- 0:03:58
33000 -- (-1345.661) (-1335.763) [-1325.188] (-1341.749) * (-1342.327) (-1358.833) [-1342.378] (-1342.242) -- 0:03:54
33500 -- (-1349.847) (-1343.229) [-1319.428] (-1344.295) * (-1345.943) [-1345.018] (-1347.692) (-1350.879) -- 0:03:50
34000 -- (-1351.697) (-1337.970) [-1327.195] (-1341.657) * [-1338.474] (-1335.982) (-1340.741) (-1346.779) -- 0:03:47
34500 -- (-1344.712) (-1352.763) [-1315.426] (-1338.310) * (-1348.763) [-1332.746] (-1333.823) (-1339.953) -- 0:03:43
35000 -- (-1343.677) (-1350.727) (-1348.638) [-1337.799] * (-1353.346) (-1348.093) [-1318.303] (-1349.822) -- 0:04:08
Average standard deviation of split frequencies: 0.055354
35500 -- (-1337.244) (-1344.526) (-1341.133) [-1337.486] * [-1335.827] (-1330.725) (-1348.791) (-1347.714) -- 0:04:04
36000 -- (-1345.084) (-1336.969) [-1345.740] (-1344.623) * (-1350.867) (-1345.167) [-1340.270] (-1345.231) -- 0:04:01
36500 -- (-1334.701) [-1333.680] (-1346.891) (-1336.294) * (-1343.293) (-1340.745) [-1330.641] (-1343.995) -- 0:03:57
37000 -- [-1341.392] (-1341.722) (-1345.286) (-1346.520) * (-1345.230) (-1346.317) [-1340.477] (-1340.503) -- 0:03:54
37500 -- [-1339.922] (-1340.633) (-1344.883) (-1345.375) * (-1350.960) [-1338.525] (-1331.724) (-1344.834) -- 0:03:51
38000 -- (-1338.640) (-1340.580) (-1334.426) [-1337.216] * (-1351.943) (-1338.173) [-1330.909] (-1345.549) -- 0:03:47
38500 -- (-1342.295) (-1336.106) (-1339.643) [-1337.890] * (-1343.204) (-1335.282) (-1350.990) [-1342.661] -- 0:04:09
39000 -- (-1351.745) (-1355.823) (-1335.778) [-1339.343] * (-1353.724) [-1335.251] (-1337.785) (-1349.903) -- 0:04:06
39500 -- (-1353.940) (-1340.703) [-1338.015] (-1352.769) * (-1351.538) (-1343.350) (-1339.963) [-1333.562] -- 0:04:03
40000 -- (-1344.337) [-1328.964] (-1331.792) (-1347.396) * (-1341.473) (-1348.518) (-1352.641) [-1331.716] -- 0:04:00
Average standard deviation of split frequencies: 0.046368
40500 -- (-1339.400) [-1334.558] (-1346.452) (-1343.445) * (-1346.131) (-1355.735) (-1341.106) [-1338.755] -- 0:03:56
41000 -- (-1349.313) [-1335.073] (-1343.405) (-1350.870) * (-1348.889) [-1330.955] (-1335.560) (-1344.613) -- 0:03:53
41500 -- [-1354.130] (-1347.433) (-1345.900) (-1345.889) * (-1354.079) (-1342.938) [-1335.644] (-1337.281) -- 0:03:50
42000 -- (-1362.961) [-1343.950] (-1350.413) (-1358.014) * (-1345.931) [-1339.932] (-1339.576) (-1334.560) -- 0:03:48
42500 -- (-1338.649) [-1335.645] (-1353.549) (-1354.855) * [-1345.141] (-1342.395) (-1347.450) (-1345.533) -- 0:04:07
43000 -- (-1347.021) (-1347.878) [-1350.703] (-1354.207) * (-1330.801) (-1349.242) [-1334.291] (-1341.047) -- 0:04:04
43500 -- [-1332.632] (-1343.620) (-1343.470) (-1349.567) * (-1343.982) (-1335.560) [-1331.212] (-1347.226) -- 0:04:01
44000 -- [-1338.422] (-1346.212) (-1356.325) (-1344.069) * [-1327.323] (-1341.057) (-1339.329) (-1348.243) -- 0:03:59
44500 -- [-1333.817] (-1339.237) (-1347.195) (-1342.159) * (-1339.074) (-1341.187) [-1326.096] (-1349.567) -- 0:03:56
45000 -- [-1312.908] (-1347.070) (-1339.558) (-1353.327) * (-1339.818) [-1341.597] (-1324.413) (-1346.023) -- 0:03:53
Average standard deviation of split frequencies: 0.040992
45500 -- (-1333.911) (-1345.530) [-1330.411] (-1359.416) * (-1342.816) [-1329.362] (-1329.472) (-1343.779) -- 0:03:50
46000 -- [-1327.210] (-1345.483) (-1344.121) (-1345.107) * (-1349.311) [-1328.723] (-1316.935) (-1349.096) -- 0:03:48
46500 -- (-1333.177) (-1350.026) [-1346.381] (-1351.178) * (-1345.954) (-1336.611) [-1324.299] (-1354.568) -- 0:04:06
47000 -- [-1331.546] (-1349.013) (-1324.980) (-1346.328) * (-1344.033) (-1337.377) [-1331.575] (-1350.370) -- 0:04:03
47500 -- [-1320.757] (-1351.773) (-1343.097) (-1343.530) * (-1346.811) [-1329.177] (-1359.291) (-1340.450) -- 0:04:00
48000 -- [-1320.848] (-1343.850) (-1345.690) (-1336.710) * (-1355.495) [-1333.949] (-1349.995) (-1356.616) -- 0:03:58
48500 -- (-1342.871) (-1324.047) [-1336.022] (-1344.759) * (-1355.097) (-1338.516) [-1348.672] (-1368.501) -- 0:03:55
49000 -- [-1338.013] (-1342.842) (-1341.947) (-1339.884) * (-1349.533) (-1339.856) [-1320.540] (-1350.014) -- 0:03:52
49500 -- [-1334.958] (-1354.669) (-1346.399) (-1350.190) * (-1351.632) (-1339.545) [-1326.676] (-1343.091) -- 0:03:50
50000 -- [-1332.331] (-1347.548) (-1345.172) (-1339.088) * (-1350.443) (-1346.567) [-1335.145] (-1348.328) -- 0:03:48
Average standard deviation of split frequencies: 0.040048
50500 -- (-1350.079) [-1338.547] (-1329.979) (-1338.364) * (-1340.066) (-1357.476) [-1338.070] (-1345.602) -- 0:04:04
51000 -- (-1340.217) (-1350.666) [-1310.098] (-1342.182) * (-1335.430) (-1356.114) [-1319.496] (-1347.325) -- 0:04:01
51500 -- (-1360.091) (-1351.389) [-1323.182] (-1344.865) * (-1338.792) (-1345.117) [-1332.655] (-1358.745) -- 0:03:59
52000 -- (-1342.905) (-1347.760) [-1323.065] (-1345.642) * [-1338.779] (-1342.245) (-1328.336) (-1341.727) -- 0:03:57
52500 -- (-1345.819) (-1340.773) [-1314.086] (-1345.375) * (-1338.334) (-1354.972) [-1340.801] (-1341.324) -- 0:03:54
53000 -- (-1343.742) (-1358.924) (-1321.601) [-1334.880] * (-1355.811) (-1339.615) [-1341.607] (-1337.553) -- 0:03:52
53500 -- [-1343.791] (-1344.148) (-1332.313) (-1336.083) * [-1337.294] (-1345.255) (-1339.636) (-1347.638) -- 0:03:49
54000 -- (-1344.607) (-1348.164) [-1328.078] (-1337.432) * (-1353.801) (-1349.228) [-1340.998] (-1351.359) -- 0:03:47
54500 -- (-1338.101) (-1347.883) [-1332.538] (-1348.634) * [-1331.083] (-1340.966) (-1331.335) (-1349.616) -- 0:04:02
55000 -- [-1329.695] (-1347.843) (-1337.587) (-1339.308) * [-1318.095] (-1345.105) (-1345.482) (-1341.768) -- 0:04:00
Average standard deviation of split frequencies: 0.040626
55500 -- (-1340.581) (-1348.249) [-1327.423] (-1349.904) * [-1327.802] (-1349.331) (-1332.343) (-1349.674) -- 0:03:58
56000 -- (-1344.998) [-1339.835] (-1340.156) (-1343.442) * [-1328.413] (-1348.614) (-1336.201) (-1340.122) -- 0:03:56
56500 -- [-1334.764] (-1343.617) (-1344.473) (-1338.592) * (-1331.637) (-1358.376) (-1340.256) [-1345.515] -- 0:03:53
57000 -- (-1340.019) [-1344.357] (-1339.266) (-1350.000) * [-1321.313] (-1343.025) (-1348.031) (-1349.341) -- 0:03:51
57500 -- [-1335.395] (-1343.519) (-1339.862) (-1342.784) * (-1327.073) [-1342.228] (-1330.291) (-1355.336) -- 0:03:49
58000 -- (-1345.171) [-1333.738] (-1327.097) (-1349.406) * [-1337.227] (-1346.230) (-1343.068) (-1346.083) -- 0:03:47
58500 -- [-1324.238] (-1335.027) (-1340.015) (-1329.011) * (-1328.109) [-1342.595] (-1347.770) (-1349.352) -- 0:04:01
59000 -- (-1352.394) (-1354.462) [-1336.254] (-1348.236) * [-1324.635] (-1344.990) (-1339.464) (-1348.962) -- 0:03:59
59500 -- [-1327.885] (-1351.724) (-1337.802) (-1342.211) * (-1352.141) (-1353.806) [-1350.700] (-1346.831) -- 0:03:57
60000 -- [-1346.949] (-1333.092) (-1329.115) (-1342.196) * [-1329.903] (-1340.096) (-1335.808) (-1354.177) -- 0:03:55
Average standard deviation of split frequencies: 0.038514
60500 -- (-1336.331) (-1331.224) [-1332.760] (-1351.002) * (-1345.675) (-1338.528) [-1339.257] (-1354.137) -- 0:03:52
61000 -- (-1338.358) (-1350.042) (-1333.772) [-1339.642] * (-1352.768) [-1346.629] (-1333.891) (-1346.486) -- 0:03:50
61500 -- (-1337.921) (-1340.697) [-1323.371] (-1342.429) * [-1345.688] (-1338.421) (-1339.915) (-1345.526) -- 0:03:48
62000 -- (-1342.778) [-1335.373] (-1343.242) (-1347.975) * [-1336.426] (-1345.314) (-1339.638) (-1334.996) -- 0:04:02
62500 -- (-1345.801) [-1342.780] (-1334.523) (-1348.613) * (-1335.339) (-1336.856) (-1345.677) [-1340.991] -- 0:04:00
63000 -- (-1345.786) (-1347.098) [-1342.562] (-1346.118) * (-1353.626) (-1349.022) [-1335.728] (-1353.403) -- 0:03:57
63500 -- (-1340.778) (-1341.668) (-1343.320) [-1348.290] * [-1336.065] (-1338.147) (-1338.142) (-1346.565) -- 0:03:55
64000 -- (-1341.427) (-1335.417) (-1349.520) [-1330.372] * (-1338.483) (-1362.413) (-1343.678) [-1341.191] -- 0:03:54
64500 -- (-1346.600) [-1329.093] (-1343.834) (-1341.350) * (-1355.063) (-1350.545) [-1330.863] (-1346.764) -- 0:03:52
65000 -- (-1347.711) (-1333.648) [-1321.781] (-1353.979) * (-1341.116) (-1357.930) (-1341.478) [-1340.157] -- 0:03:50
Average standard deviation of split frequencies: 0.036334
65500 -- (-1362.667) (-1336.972) [-1327.493] (-1340.193) * (-1348.405) [-1330.179] (-1338.932) (-1348.384) -- 0:03:48
66000 -- [-1335.490] (-1335.918) (-1338.238) (-1345.166) * (-1345.290) (-1342.091) (-1349.964) [-1336.680] -- 0:04:00
66500 -- (-1341.352) (-1340.630) (-1344.318) [-1335.401] * (-1353.275) (-1347.546) (-1335.113) [-1334.638] -- 0:03:58
67000 -- (-1338.935) [-1330.498] (-1335.714) (-1340.880) * (-1348.214) (-1353.906) (-1335.513) [-1343.719] -- 0:03:56
67500 -- (-1350.704) (-1336.488) (-1342.014) [-1336.563] * (-1340.873) [-1346.213] (-1341.211) (-1353.413) -- 0:03:54
68000 -- (-1352.122) (-1333.670) [-1332.724] (-1349.337) * (-1347.946) (-1345.949) (-1337.202) [-1328.779] -- 0:03:53
68500 -- (-1343.911) [-1333.891] (-1339.020) (-1352.124) * (-1349.444) [-1336.349] (-1346.495) (-1350.592) -- 0:03:51
69000 -- (-1340.300) (-1342.780) [-1341.580] (-1353.486) * (-1343.051) (-1343.209) [-1348.078] (-1345.114) -- 0:03:49
69500 -- (-1339.969) (-1344.457) [-1339.566] (-1345.868) * (-1350.015) (-1352.483) [-1337.101] (-1348.763) -- 0:03:47
70000 -- [-1336.991] (-1341.435) (-1347.844) (-1352.996) * (-1344.424) (-1337.101) [-1344.804] (-1344.636) -- 0:03:59
Average standard deviation of split frequencies: 0.031130
70500 -- (-1335.828) [-1332.137] (-1342.229) (-1339.229) * (-1350.074) (-1338.505) (-1348.502) [-1338.124] -- 0:03:57
71000 -- (-1349.602) (-1338.744) (-1342.271) [-1325.197] * (-1343.190) (-1337.233) (-1346.994) [-1343.193] -- 0:03:55
71500 -- [-1338.764] (-1345.303) (-1345.409) (-1343.098) * (-1339.874) [-1328.405] (-1346.346) (-1340.409) -- 0:03:53
72000 -- [-1314.476] (-1353.309) (-1338.212) (-1341.121) * (-1341.428) [-1338.038] (-1336.718) (-1351.207) -- 0:03:52
72500 -- [-1324.194] (-1340.112) (-1340.754) (-1345.689) * (-1340.141) (-1344.595) [-1343.630] (-1343.828) -- 0:03:50
73000 -- [-1318.082] (-1342.273) (-1350.872) (-1348.266) * (-1354.113) (-1341.199) [-1331.451] (-1339.688) -- 0:03:48
73500 -- [-1315.296] (-1344.608) (-1353.915) (-1343.494) * (-1346.355) (-1337.663) [-1341.393] (-1326.717) -- 0:03:46
74000 -- [-1314.622] (-1356.233) (-1340.867) (-1352.507) * (-1351.188) (-1331.232) (-1345.362) [-1317.482] -- 0:03:57
74500 -- [-1325.107] (-1340.704) (-1345.135) (-1347.237) * [-1345.515] (-1332.151) (-1347.584) (-1333.318) -- 0:03:56
75000 -- [-1327.660] (-1347.777) (-1337.925) (-1353.459) * (-1346.141) [-1317.548] (-1349.282) (-1331.513) -- 0:03:54
Average standard deviation of split frequencies: 0.028194
75500 -- (-1337.978) (-1341.723) [-1342.922] (-1346.381) * (-1311.471) [-1324.813] (-1342.013) (-1344.641) -- 0:03:52
76000 -- [-1330.053] (-1341.960) (-1345.588) (-1351.849) * [-1324.861] (-1332.528) (-1344.993) (-1349.460) -- 0:03:51
76500 -- [-1314.986] (-1342.235) (-1339.084) (-1341.850) * [-1336.433] (-1336.708) (-1340.656) (-1346.984) -- 0:03:49
77000 -- (-1332.007) [-1340.575] (-1344.348) (-1345.551) * (-1327.131) (-1349.202) (-1338.534) [-1343.141] -- 0:03:47
77500 -- (-1345.493) (-1342.754) [-1341.443] (-1347.027) * [-1339.150] (-1353.555) (-1339.557) (-1352.951) -- 0:03:58
78000 -- [-1343.606] (-1342.586) (-1338.810) (-1347.652) * (-1338.624) (-1350.739) (-1343.914) [-1333.328] -- 0:03:56
78500 -- (-1343.978) (-1352.929) [-1341.190] (-1354.997) * (-1336.147) (-1346.681) [-1339.454] (-1347.311) -- 0:03:54
79000 -- (-1345.810) [-1332.225] (-1333.251) (-1352.195) * (-1334.305) [-1327.014] (-1347.224) (-1344.819) -- 0:03:53
79500 -- (-1336.961) (-1349.358) (-1346.373) [-1351.041] * (-1337.036) [-1325.063] (-1350.579) (-1340.497) -- 0:03:51
80000 -- (-1343.766) [-1334.377] (-1341.311) (-1360.266) * (-1342.656) [-1336.106] (-1352.877) (-1348.510) -- 0:03:50
Average standard deviation of split frequencies: 0.027094
80500 -- (-1344.160) (-1339.033) [-1338.172] (-1345.050) * (-1339.980) (-1331.980) (-1351.202) [-1342.890] -- 0:03:48
81000 -- (-1348.988) [-1336.114] (-1343.041) (-1339.990) * [-1336.529] (-1339.563) (-1353.386) (-1345.563) -- 0:03:46
81500 -- (-1346.401) (-1355.128) (-1334.369) [-1336.865] * (-1332.232) [-1333.307] (-1338.436) (-1346.652) -- 0:03:56
82000 -- (-1341.788) (-1343.537) [-1321.941] (-1344.316) * [-1331.874] (-1339.543) (-1349.342) (-1338.471) -- 0:03:55
82500 -- (-1339.166) [-1346.566] (-1335.611) (-1347.849) * [-1332.363] (-1343.376) (-1336.211) (-1340.042) -- 0:03:53
83000 -- (-1344.946) [-1338.366] (-1339.644) (-1350.499) * [-1324.079] (-1350.561) (-1357.428) (-1345.474) -- 0:03:52
83500 -- [-1328.284] (-1344.395) (-1344.299) (-1344.025) * [-1320.678] (-1356.160) (-1347.956) (-1348.250) -- 0:03:50
84000 -- (-1344.551) [-1330.184] (-1328.738) (-1348.500) * [-1321.019] (-1354.764) (-1342.042) (-1344.528) -- 0:03:49
84500 -- (-1345.852) [-1344.210] (-1339.449) (-1344.464) * [-1322.962] (-1334.559) (-1347.514) (-1341.354) -- 0:03:47
85000 -- (-1343.140) (-1355.594) (-1347.086) [-1344.179] * [-1317.697] (-1345.572) (-1346.970) (-1340.448) -- 0:03:46
Average standard deviation of split frequencies: 0.029691
85500 -- [-1328.427] (-1355.304) (-1339.197) (-1344.022) * (-1345.125) [-1337.610] (-1341.714) (-1341.222) -- 0:03:55
86000 -- (-1338.747) [-1349.046] (-1344.089) (-1342.312) * (-1331.073) [-1334.497] (-1341.712) (-1339.230) -- 0:03:53
86500 -- (-1332.728) [-1339.521] (-1345.457) (-1341.507) * (-1335.770) [-1334.557] (-1347.649) (-1341.185) -- 0:03:52
87000 -- [-1314.618] (-1344.247) (-1345.523) (-1351.368) * (-1331.656) [-1321.476] (-1336.453) (-1350.784) -- 0:03:50
87500 -- (-1340.566) [-1338.794] (-1341.304) (-1345.894) * (-1352.137) [-1330.987] (-1344.798) (-1343.553) -- 0:03:49
88000 -- [-1323.964] (-1337.956) (-1345.721) (-1340.246) * (-1332.568) [-1332.410] (-1339.824) (-1350.408) -- 0:03:48
88500 -- [-1336.666] (-1335.939) (-1345.058) (-1347.167) * [-1331.754] (-1342.699) (-1342.259) (-1343.708) -- 0:03:46
89000 -- (-1343.859) [-1338.783] (-1350.710) (-1351.133) * [-1316.634] (-1351.091) (-1354.802) (-1354.748) -- 0:03:45
89500 -- [-1329.561] (-1342.861) (-1345.627) (-1350.589) * (-1325.392) [-1345.030] (-1348.604) (-1344.442) -- 0:03:53
90000 -- [-1323.658] (-1339.799) (-1348.223) (-1343.868) * (-1350.261) (-1351.593) (-1343.110) [-1335.933] -- 0:03:52
Average standard deviation of split frequencies: 0.029840
90500 -- (-1335.275) [-1319.483] (-1349.944) (-1352.626) * [-1327.549] (-1343.908) (-1336.897) (-1339.805) -- 0:03:51
91000 -- (-1331.012) [-1324.916] (-1349.894) (-1349.799) * (-1337.280) (-1344.554) (-1337.332) [-1330.307] -- 0:03:49
91500 -- [-1330.523] (-1339.850) (-1350.412) (-1340.738) * (-1345.678) (-1345.884) (-1345.542) [-1313.352] -- 0:03:48
92000 -- [-1334.333] (-1338.005) (-1347.950) (-1342.815) * (-1332.766) (-1341.653) (-1344.272) [-1314.546] -- 0:03:47
92500 -- [-1334.269] (-1333.746) (-1351.921) (-1335.873) * (-1347.700) (-1345.136) (-1335.929) [-1313.909] -- 0:03:45
93000 -- [-1322.846] (-1345.061) (-1350.647) (-1344.349) * (-1354.523) [-1342.943] (-1345.988) (-1332.596) -- 0:03:54
93500 -- (-1340.150) (-1347.007) (-1352.627) [-1341.609] * (-1340.289) (-1346.614) (-1346.285) [-1319.053] -- 0:03:52
94000 -- [-1330.852] (-1344.400) (-1351.552) (-1339.051) * (-1321.200) (-1348.245) (-1345.434) [-1328.499] -- 0:03:51
94500 -- [-1323.429] (-1341.788) (-1347.636) (-1341.665) * (-1331.159) (-1343.282) (-1336.659) [-1316.547] -- 0:03:49
95000 -- [-1331.453] (-1344.769) (-1346.906) (-1344.183) * (-1346.089) (-1349.233) (-1344.933) [-1319.767] -- 0:03:48
Average standard deviation of split frequencies: 0.027826
95500 -- [-1346.152] (-1346.509) (-1343.999) (-1337.539) * (-1351.859) (-1345.357) [-1340.834] (-1327.547) -- 0:03:47
96000 -- [-1322.235] (-1343.488) (-1347.988) (-1342.483) * (-1342.026) (-1346.109) (-1333.193) [-1329.439] -- 0:03:46
96500 -- (-1338.331) [-1342.607] (-1356.761) (-1342.663) * (-1330.494) (-1350.460) (-1343.993) [-1320.109] -- 0:03:44
97000 -- [-1323.883] (-1344.003) (-1342.684) (-1337.860) * [-1343.245] (-1339.019) (-1342.600) (-1343.452) -- 0:03:52
97500 -- [-1336.193] (-1345.772) (-1341.222) (-1339.869) * (-1347.995) (-1339.382) (-1348.714) [-1336.561] -- 0:03:51
98000 -- [-1330.488] (-1360.687) (-1344.157) (-1343.733) * (-1339.951) (-1343.772) (-1345.096) [-1328.476] -- 0:03:50
98500 -- [-1329.258] (-1342.205) (-1341.463) (-1341.980) * [-1329.648] (-1331.070) (-1341.326) (-1351.781) -- 0:03:48
99000 -- (-1341.021) [-1339.529] (-1339.398) (-1349.023) * [-1336.486] (-1338.645) (-1335.805) (-1363.244) -- 0:03:47
99500 -- (-1335.753) [-1340.127] (-1343.946) (-1344.211) * (-1336.543) (-1335.036) [-1333.549] (-1346.694) -- 0:03:46
100000 -- [-1333.107] (-1339.778) (-1342.412) (-1339.392) * [-1336.585] (-1337.759) (-1344.685) (-1338.300) -- 0:03:45
Average standard deviation of split frequencies: 0.029658
100500 -- [-1334.140] (-1339.539) (-1341.839) (-1346.408) * (-1340.179) [-1334.703] (-1347.318) (-1340.878) -- 0:03:43
101000 -- (-1333.288) [-1338.534] (-1342.858) (-1353.598) * (-1333.520) (-1340.681) [-1333.128] (-1345.763) -- 0:03:51
101500 -- (-1341.868) [-1338.570] (-1347.076) (-1356.909) * (-1334.539) [-1335.394] (-1341.341) (-1340.255) -- 0:03:50
102000 -- (-1344.804) [-1337.173] (-1347.294) (-1341.530) * (-1336.171) (-1339.030) (-1351.780) [-1334.036] -- 0:03:48
102500 -- (-1340.206) [-1311.716] (-1354.375) (-1346.207) * (-1348.323) [-1334.307] (-1341.617) (-1348.097) -- 0:03:47
103000 -- (-1341.044) (-1345.993) (-1345.423) [-1338.849] * (-1334.544) [-1340.110] (-1344.546) (-1345.813) -- 0:03:46
103500 -- [-1338.069] (-1349.282) (-1342.622) (-1346.466) * (-1342.901) (-1348.271) (-1344.239) [-1335.830] -- 0:03:45
104000 -- (-1343.520) (-1341.626) (-1343.770) [-1340.344] * (-1350.386) (-1349.786) [-1340.804] (-1342.923) -- 0:03:44
104500 -- (-1361.853) (-1345.026) (-1349.159) [-1332.857] * (-1340.651) (-1356.831) (-1342.824) [-1338.005] -- 0:03:51
105000 -- [-1319.338] (-1338.705) (-1353.631) (-1345.968) * (-1344.344) (-1340.038) [-1337.087] (-1336.361) -- 0:03:50
Average standard deviation of split frequencies: 0.029513
105500 -- [-1337.902] (-1344.833) (-1344.111) (-1346.213) * (-1347.057) (-1344.390) (-1340.713) [-1335.806] -- 0:03:48
106000 -- [-1324.965] (-1338.540) (-1352.638) (-1340.342) * [-1324.399] (-1349.219) (-1328.288) (-1346.539) -- 0:03:47
106500 -- (-1343.974) (-1348.893) (-1348.243) [-1345.104] * [-1332.768] (-1333.194) (-1339.695) (-1343.753) -- 0:03:46
107000 -- [-1327.678] (-1351.026) (-1348.151) (-1342.163) * (-1346.583) (-1318.974) [-1332.788] (-1357.119) -- 0:03:45
107500 -- (-1325.311) (-1339.021) (-1352.916) [-1346.122] * [-1336.836] (-1340.290) (-1345.014) (-1344.568) -- 0:03:44
108000 -- [-1322.463] (-1342.353) (-1353.732) (-1333.068) * (-1330.541) (-1332.580) [-1335.053] (-1346.365) -- 0:03:43
108500 -- [-1314.415] (-1333.721) (-1336.163) (-1319.160) * [-1343.776] (-1338.865) (-1332.786) (-1353.102) -- 0:03:50
109000 -- (-1338.877) [-1332.809] (-1343.938) (-1337.725) * [-1329.254] (-1347.162) (-1334.246) (-1334.563) -- 0:03:48
109500 -- (-1347.024) (-1341.102) (-1360.352) [-1321.683] * (-1342.282) (-1347.019) (-1343.763) [-1326.880] -- 0:03:47
110000 -- [-1341.023] (-1341.365) (-1338.847) (-1345.381) * (-1347.145) (-1348.891) (-1336.199) [-1327.265] -- 0:03:46
Average standard deviation of split frequencies: 0.029624
110500 -- (-1331.026) (-1340.615) (-1356.695) [-1332.184] * (-1350.729) [-1335.185] (-1340.097) (-1347.603) -- 0:03:45
111000 -- [-1328.474] (-1331.337) (-1348.374) (-1340.527) * (-1349.329) [-1341.255] (-1340.181) (-1344.310) -- 0:03:44
111500 -- (-1336.589) [-1337.127] (-1347.986) (-1334.523) * (-1346.060) (-1346.920) (-1348.415) [-1329.863] -- 0:03:43
112000 -- [-1340.770] (-1339.061) (-1346.619) (-1344.767) * (-1344.524) (-1344.213) (-1349.421) [-1337.286] -- 0:03:42
112500 -- [-1327.098] (-1341.042) (-1349.521) (-1346.489) * (-1338.015) (-1347.365) [-1335.987] (-1347.396) -- 0:03:48
113000 -- (-1327.197) [-1337.518] (-1345.323) (-1348.634) * (-1345.953) (-1349.444) [-1343.622] (-1338.464) -- 0:03:47
113500 -- [-1335.515] (-1351.564) (-1345.506) (-1343.851) * (-1344.066) [-1334.685] (-1348.197) (-1356.470) -- 0:03:46
114000 -- [-1325.163] (-1349.953) (-1347.166) (-1340.602) * (-1354.266) (-1337.273) [-1339.236] (-1338.639) -- 0:03:45
114500 -- [-1326.690] (-1338.665) (-1343.974) (-1350.970) * (-1344.357) (-1339.365) (-1340.082) [-1337.223] -- 0:03:44
115000 -- (-1358.907) (-1323.468) (-1350.084) [-1344.168] * (-1349.548) (-1342.642) (-1341.038) [-1333.524] -- 0:03:43
Average standard deviation of split frequencies: 0.033091
115500 -- (-1327.771) (-1344.097) (-1342.855) [-1328.903] * (-1341.638) (-1337.546) [-1341.673] (-1356.952) -- 0:03:42
116000 -- [-1330.263] (-1349.490) (-1340.949) (-1347.027) * (-1338.988) [-1339.599] (-1345.713) (-1343.369) -- 0:03:48
116500 -- (-1355.294) (-1342.960) (-1344.992) [-1330.367] * [-1338.860] (-1336.285) (-1341.014) (-1346.838) -- 0:03:47
117000 -- [-1327.657] (-1344.896) (-1345.096) (-1336.948) * (-1330.639) [-1334.565] (-1347.179) (-1347.588) -- 0:03:46
117500 -- (-1333.323) (-1347.499) (-1342.623) [-1331.254] * (-1348.702) (-1346.060) [-1336.027] (-1354.588) -- 0:03:45
118000 -- (-1336.851) (-1347.963) (-1353.771) [-1335.918] * [-1333.940] (-1338.743) (-1345.476) (-1352.698) -- 0:03:44
118500 -- [-1318.770] (-1350.525) (-1351.910) (-1333.510) * (-1347.789) [-1341.984] (-1353.251) (-1338.664) -- 0:03:43
119000 -- [-1327.133] (-1346.986) (-1338.756) (-1354.609) * [-1340.912] (-1341.627) (-1346.974) (-1332.210) -- 0:03:42
119500 -- [-1320.748] (-1331.706) (-1340.639) (-1351.904) * (-1335.884) (-1345.292) (-1339.942) [-1331.326] -- 0:03:41
120000 -- [-1326.626] (-1349.445) (-1327.688) (-1338.447) * (-1333.527) (-1340.613) (-1345.526) [-1344.474] -- 0:03:47
Average standard deviation of split frequencies: 0.034602
120500 -- [-1325.044] (-1341.519) (-1340.329) (-1346.021) * [-1328.583] (-1348.028) (-1351.492) (-1351.933) -- 0:03:46
121000 -- [-1319.965] (-1338.427) (-1352.112) (-1339.368) * [-1334.019] (-1352.763) (-1335.917) (-1348.221) -- 0:03:45
121500 -- [-1320.969] (-1361.199) (-1357.496) (-1345.519) * (-1352.411) (-1348.526) (-1344.123) [-1328.603] -- 0:03:44
122000 -- [-1315.265] (-1352.763) (-1347.349) (-1333.116) * (-1340.359) (-1347.177) (-1335.348) [-1331.933] -- 0:03:43
122500 -- [-1330.502] (-1345.723) (-1340.191) (-1345.294) * [-1344.040] (-1331.192) (-1345.705) (-1329.746) -- 0:03:42
123000 -- [-1319.137] (-1345.083) (-1352.519) (-1339.925) * (-1347.917) (-1351.500) (-1361.383) [-1341.956] -- 0:03:41
123500 -- (-1334.002) (-1345.946) (-1345.166) [-1334.099] * [-1328.199] (-1350.476) (-1350.965) (-1342.995) -- 0:03:40
124000 -- (-1337.182) (-1343.420) (-1355.037) [-1334.479] * (-1330.014) [-1347.080] (-1338.280) (-1350.311) -- 0:03:46
124500 -- (-1344.542) [-1313.220] (-1345.843) (-1344.267) * (-1337.006) [-1328.346] (-1346.782) (-1342.644) -- 0:03:45
125000 -- (-1346.713) [-1328.148] (-1349.540) (-1349.015) * [-1337.106] (-1335.648) (-1349.119) (-1356.662) -- 0:03:44
Average standard deviation of split frequencies: 0.033502
125500 -- (-1335.352) [-1331.025] (-1342.783) (-1345.110) * (-1338.052) [-1315.590] (-1340.595) (-1340.082) -- 0:03:42
126000 -- (-1337.698) [-1321.499] (-1348.761) (-1348.681) * (-1348.384) [-1328.831] (-1352.679) (-1345.498) -- 0:03:41
126500 -- (-1342.752) [-1342.180] (-1350.536) (-1344.734) * (-1333.944) (-1335.284) [-1346.563] (-1350.243) -- 0:03:40
127000 -- (-1344.351) [-1322.506] (-1355.468) (-1344.318) * (-1348.488) (-1339.297) [-1332.777] (-1339.069) -- 0:03:39
127500 -- (-1334.684) [-1324.504] (-1347.903) (-1347.170) * (-1341.279) [-1327.105] (-1337.291) (-1345.443) -- 0:03:45
128000 -- (-1337.971) [-1336.218] (-1344.092) (-1349.836) * (-1333.894) [-1336.564] (-1346.776) (-1353.823) -- 0:03:44
128500 -- (-1340.680) (-1345.123) [-1342.667] (-1344.291) * [-1316.522] (-1346.653) (-1346.595) (-1356.225) -- 0:03:43
129000 -- [-1339.533] (-1345.212) (-1341.426) (-1337.204) * [-1332.075] (-1347.798) (-1342.258) (-1344.034) -- 0:03:42
129500 -- (-1347.225) [-1338.366] (-1343.988) (-1342.301) * [-1325.482] (-1348.838) (-1338.789) (-1337.497) -- 0:03:41
130000 -- [-1328.260] (-1347.192) (-1348.325) (-1346.508) * [-1327.937] (-1339.101) (-1344.175) (-1337.131) -- 0:03:47
Average standard deviation of split frequencies: 0.031438
130500 -- (-1343.523) [-1331.053] (-1341.436) (-1339.095) * [-1328.148] (-1354.659) (-1340.308) (-1349.559) -- 0:03:46
131000 -- (-1345.057) [-1317.865] (-1346.609) (-1343.539) * [-1323.897] (-1342.822) (-1346.638) (-1338.594) -- 0:03:45
131500 -- (-1341.346) [-1322.626] (-1335.573) (-1339.965) * [-1320.463] (-1350.287) (-1344.328) (-1352.096) -- 0:03:44
132000 -- (-1342.827) [-1305.401] (-1343.169) (-1343.353) * [-1334.395] (-1349.533) (-1345.057) (-1345.694) -- 0:03:43
132500 -- (-1344.455) [-1324.551] (-1338.929) (-1343.540) * (-1345.071) [-1339.364] (-1347.278) (-1345.050) -- 0:03:42
133000 -- (-1343.858) [-1335.100] (-1343.670) (-1343.104) * [-1334.008] (-1336.219) (-1358.989) (-1351.423) -- 0:03:41
133500 -- [-1330.706] (-1339.437) (-1341.583) (-1342.265) * [-1331.130] (-1350.324) (-1349.020) (-1336.146) -- 0:03:40
134000 -- [-1316.063] (-1343.496) (-1349.800) (-1348.709) * (-1329.878) (-1345.251) [-1340.325] (-1347.268) -- 0:03:46
134500 -- [-1342.440] (-1338.364) (-1347.061) (-1342.075) * [-1338.167] (-1341.674) (-1346.583) (-1350.074) -- 0:03:45
135000 -- [-1314.538] (-1349.311) (-1352.428) (-1346.229) * [-1338.270] (-1336.075) (-1343.014) (-1345.275) -- 0:03:44
Average standard deviation of split frequencies: 0.029710
135500 -- [-1322.957] (-1346.485) (-1342.945) (-1350.586) * (-1336.949) (-1339.169) (-1344.807) [-1333.543] -- 0:03:43
136000 -- [-1329.769] (-1335.111) (-1353.260) (-1356.069) * [-1327.783] (-1351.468) (-1343.146) (-1337.236) -- 0:03:42
136500 -- [-1305.733] (-1333.723) (-1340.017) (-1350.827) * (-1345.161) [-1339.603] (-1343.149) (-1353.162) -- 0:03:41
137000 -- [-1311.813] (-1347.535) (-1340.814) (-1347.689) * (-1334.077) [-1328.657] (-1348.005) (-1358.420) -- 0:03:40
137500 -- [-1326.849] (-1338.083) (-1344.849) (-1349.170) * (-1340.133) [-1330.042] (-1340.642) (-1343.402) -- 0:03:39
138000 -- [-1329.198] (-1344.089) (-1350.691) (-1348.223) * (-1336.672) [-1321.442] (-1341.751) (-1354.587) -- 0:03:44
138500 -- [-1337.259] (-1349.812) (-1345.514) (-1350.945) * (-1337.972) [-1340.689] (-1351.671) (-1351.271) -- 0:03:43
139000 -- [-1318.040] (-1342.060) (-1343.319) (-1338.826) * [-1326.542] (-1342.443) (-1341.270) (-1334.283) -- 0:03:42
139500 -- (-1337.202) (-1337.237) (-1344.618) [-1335.332] * [-1315.697] (-1344.955) (-1343.560) (-1355.998) -- 0:03:42
140000 -- [-1324.918] (-1339.663) (-1343.107) (-1342.979) * [-1317.869] (-1340.489) (-1333.982) (-1345.637) -- 0:03:41
Average standard deviation of split frequencies: 0.030001
140500 -- (-1349.937) (-1352.426) [-1336.947] (-1344.518) * [-1336.774] (-1338.115) (-1353.395) (-1341.818) -- 0:03:40
141000 -- (-1351.915) [-1322.440] (-1343.769) (-1343.720) * (-1344.555) (-1334.137) (-1340.847) [-1340.800] -- 0:03:39
141500 -- (-1353.050) [-1330.150] (-1333.233) (-1348.514) * [-1346.644] (-1338.199) (-1341.709) (-1346.676) -- 0:03:38
142000 -- (-1354.206) [-1312.982] (-1345.284) (-1348.797) * (-1335.421) (-1349.904) [-1343.695] (-1340.316) -- 0:03:43
142500 -- (-1356.935) (-1321.912) [-1336.267] (-1347.750) * (-1347.898) (-1332.635) (-1339.066) [-1330.776] -- 0:03:42
143000 -- [-1333.452] (-1337.225) (-1340.740) (-1360.471) * (-1338.998) (-1351.343) (-1347.702) [-1319.015] -- 0:03:41
143500 -- [-1331.377] (-1335.903) (-1346.258) (-1347.032) * (-1352.028) (-1342.986) (-1347.873) [-1337.557] -- 0:03:40
144000 -- (-1344.782) [-1344.598] (-1344.568) (-1345.123) * (-1355.565) [-1336.737] (-1342.011) (-1344.078) -- 0:03:39
144500 -- (-1357.196) [-1327.580] (-1338.013) (-1357.041) * (-1356.049) [-1324.463] (-1348.404) (-1345.593) -- 0:03:39
145000 -- (-1346.802) [-1341.368] (-1330.127) (-1353.034) * (-1342.579) (-1328.620) (-1350.719) [-1336.121] -- 0:03:38
Average standard deviation of split frequencies: 0.032118
145500 -- (-1348.601) (-1345.168) [-1323.477] (-1348.356) * (-1341.237) (-1341.396) (-1335.952) [-1324.211] -- 0:03:37
146000 -- (-1368.077) (-1355.182) [-1329.035] (-1349.607) * (-1350.076) (-1344.016) (-1350.578) [-1332.415] -- 0:03:42
146500 -- (-1357.195) [-1349.659] (-1340.834) (-1353.142) * [-1325.299] (-1339.810) (-1342.613) (-1338.665) -- 0:03:41
147000 -- (-1354.621) (-1342.041) (-1312.101) [-1339.101] * (-1338.620) [-1335.475] (-1352.924) (-1336.934) -- 0:03:40
147500 -- (-1343.759) (-1352.598) [-1312.028] (-1341.919) * (-1339.202) (-1327.090) (-1357.609) [-1335.424] -- 0:03:39
148000 -- (-1344.540) (-1341.130) [-1331.770] (-1342.571) * [-1344.720] (-1334.434) (-1342.202) (-1336.203) -- 0:03:38
148500 -- (-1350.297) [-1330.672] (-1335.166) (-1334.524) * (-1349.644) [-1330.860] (-1347.243) (-1353.032) -- 0:03:37
149000 -- (-1349.200) [-1317.865] (-1355.429) (-1339.642) * (-1358.109) (-1339.748) (-1347.069) [-1336.400] -- 0:03:37
149500 -- (-1342.214) [-1338.439] (-1354.263) (-1342.389) * (-1338.529) (-1337.255) [-1336.951] (-1350.916) -- 0:03:41
150000 -- [-1346.302] (-1347.720) (-1340.089) (-1342.306) * [-1337.969] (-1336.075) (-1337.412) (-1352.314) -- 0:03:40
Average standard deviation of split frequencies: 0.033593
150500 -- (-1341.407) (-1350.467) [-1328.098] (-1352.400) * (-1339.524) (-1340.897) [-1339.176] (-1345.126) -- 0:03:40
151000 -- [-1327.991] (-1357.425) (-1324.142) (-1341.767) * [-1340.058] (-1338.153) (-1346.484) (-1341.368) -- 0:03:39
151500 -- [-1344.373] (-1340.972) (-1341.748) (-1339.365) * [-1335.783] (-1337.610) (-1351.608) (-1345.558) -- 0:03:38
152000 -- [-1351.413] (-1337.212) (-1354.111) (-1344.862) * (-1344.093) [-1327.102] (-1350.335) (-1341.879) -- 0:03:37
152500 -- (-1339.331) [-1349.651] (-1349.063) (-1358.197) * (-1347.132) (-1353.294) [-1335.450] (-1336.892) -- 0:03:36
153000 -- (-1350.825) (-1345.209) [-1340.018] (-1351.716) * (-1341.135) (-1333.064) [-1339.930] (-1343.652) -- 0:03:35
153500 -- (-1352.687) [-1328.021] (-1350.344) (-1346.491) * (-1339.074) [-1327.571] (-1344.364) (-1340.076) -- 0:03:40
154000 -- (-1339.143) [-1332.777] (-1342.485) (-1354.713) * [-1332.793] (-1327.033) (-1343.769) (-1344.164) -- 0:03:39
154500 -- (-1350.663) [-1335.835] (-1346.767) (-1348.587) * [-1319.694] (-1346.417) (-1345.623) (-1331.604) -- 0:03:38
155000 -- (-1345.382) [-1340.603] (-1350.338) (-1344.304) * (-1350.452) (-1344.547) (-1346.033) [-1336.901] -- 0:03:38
Average standard deviation of split frequencies: 0.032127
155500 -- [-1347.188] (-1344.577) (-1345.145) (-1341.567) * (-1341.631) (-1337.730) (-1341.825) [-1336.742] -- 0:03:37
156000 -- (-1340.388) (-1344.426) (-1353.316) [-1340.700] * (-1340.287) [-1332.371] (-1344.747) (-1339.652) -- 0:03:36
156500 -- [-1330.774] (-1351.232) (-1331.240) (-1348.347) * (-1347.659) [-1319.894] (-1331.235) (-1342.832) -- 0:03:35
157000 -- [-1330.562] (-1351.129) (-1337.243) (-1347.395) * (-1344.436) [-1335.855] (-1344.124) (-1328.048) -- 0:03:34
157500 -- (-1333.080) (-1340.162) [-1322.927] (-1351.565) * [-1330.433] (-1343.131) (-1348.998) (-1328.593) -- 0:03:39
158000 -- (-1346.319) (-1335.807) [-1336.984] (-1353.486) * (-1345.972) (-1349.710) [-1347.955] (-1346.559) -- 0:03:38
158500 -- (-1342.331) [-1323.899] (-1348.654) (-1341.590) * [-1349.257] (-1342.778) (-1348.574) (-1348.190) -- 0:03:37
159000 -- (-1332.033) [-1334.523] (-1349.077) (-1345.018) * (-1344.825) (-1343.529) [-1319.349] (-1355.832) -- 0:03:36
159500 -- [-1339.639] (-1338.793) (-1347.663) (-1344.443) * (-1339.381) (-1343.062) [-1320.582] (-1338.708) -- 0:03:36
160000 -- [-1339.865] (-1338.026) (-1338.647) (-1346.055) * (-1338.886) (-1349.306) [-1321.021] (-1353.301) -- 0:03:35
Average standard deviation of split frequencies: 0.031502
160500 -- (-1351.209) [-1333.977] (-1347.195) (-1340.612) * (-1353.442) (-1335.665) [-1322.854] (-1328.496) -- 0:03:34
161000 -- [-1338.640] (-1352.422) (-1341.725) (-1355.056) * (-1355.851) (-1347.045) [-1317.072] (-1345.081) -- 0:03:33
161500 -- [-1343.475] (-1338.107) (-1339.800) (-1345.151) * [-1337.211] (-1339.911) (-1348.924) (-1341.705) -- 0:03:38
162000 -- (-1339.753) (-1332.405) (-1345.514) [-1347.369] * (-1347.021) (-1336.702) [-1338.216] (-1342.654) -- 0:03:37
162500 -- (-1340.663) (-1354.622) (-1329.402) [-1338.846] * (-1348.370) [-1338.379] (-1344.605) (-1349.698) -- 0:03:36
163000 -- (-1342.075) (-1354.883) [-1309.663] (-1345.899) * [-1332.986] (-1334.834) (-1337.816) (-1345.484) -- 0:03:35
163500 -- (-1335.566) (-1350.880) [-1319.120] (-1356.118) * (-1353.046) (-1337.716) [-1333.037] (-1344.079) -- 0:03:34
164000 -- (-1346.313) (-1350.325) [-1325.409] (-1348.356) * (-1352.138) [-1336.094] (-1343.940) (-1339.427) -- 0:03:34
164500 -- [-1327.085] (-1337.998) (-1332.485) (-1352.582) * (-1341.784) (-1352.518) [-1339.287] (-1336.918) -- 0:03:33
165000 -- [-1318.636] (-1342.518) (-1345.511) (-1353.569) * (-1345.390) (-1348.452) [-1345.398] (-1340.016) -- 0:03:32
Average standard deviation of split frequencies: 0.028540
165500 -- (-1342.503) [-1330.246] (-1347.689) (-1350.072) * (-1329.788) (-1342.644) [-1329.424] (-1343.489) -- 0:03:36
166000 -- [-1329.608] (-1332.212) (-1349.670) (-1349.288) * (-1328.462) (-1347.410) [-1334.132] (-1336.510) -- 0:03:36
166500 -- [-1315.229] (-1346.092) (-1356.134) (-1350.185) * (-1338.411) (-1347.257) [-1328.774] (-1342.064) -- 0:03:35
167000 -- (-1335.632) (-1347.285) (-1341.873) [-1348.497] * (-1346.011) (-1351.920) (-1340.907) [-1339.823] -- 0:03:34
167500 -- [-1329.889] (-1342.431) (-1337.851) (-1349.954) * [-1333.158] (-1353.149) (-1337.624) (-1338.768) -- 0:03:33
168000 -- (-1336.774) (-1338.912) [-1340.972] (-1346.401) * [-1326.810] (-1354.735) (-1330.950) (-1354.826) -- 0:03:32
168500 -- (-1339.910) [-1338.457] (-1345.861) (-1351.086) * (-1354.647) (-1350.524) (-1342.730) [-1337.610] -- 0:03:32
169000 -- [-1330.223] (-1337.947) (-1338.613) (-1342.566) * (-1354.681) (-1343.222) (-1343.548) [-1331.662] -- 0:03:31
169500 -- (-1337.797) [-1333.186] (-1343.358) (-1344.455) * (-1338.413) (-1349.870) (-1347.098) [-1333.498] -- 0:03:35
170000 -- (-1336.568) (-1343.647) [-1341.775] (-1357.605) * (-1341.289) (-1350.992) (-1351.749) [-1326.693] -- 0:03:34
Average standard deviation of split frequencies: 0.029511
170500 -- (-1342.638) (-1339.361) (-1343.406) [-1340.593] * [-1330.504] (-1354.994) (-1338.557) (-1329.918) -- 0:03:34
171000 -- (-1347.876) [-1323.356] (-1350.585) (-1337.709) * [-1326.211] (-1347.758) (-1356.196) (-1329.868) -- 0:03:33
171500 -- (-1345.620) [-1334.370] (-1343.439) (-1337.966) * (-1324.714) (-1346.767) (-1345.734) [-1328.211] -- 0:03:32
172000 -- (-1345.687) (-1343.090) (-1347.399) [-1342.535] * (-1346.023) (-1350.821) (-1341.843) [-1328.886] -- 0:03:31
172500 -- (-1347.335) (-1345.399) (-1342.170) [-1350.261] * (-1336.616) (-1345.681) (-1343.123) [-1343.506] -- 0:03:31
173000 -- (-1348.016) [-1322.816] (-1346.655) (-1340.298) * [-1315.115] (-1346.473) (-1331.966) (-1334.806) -- 0:03:35
173500 -- (-1344.531) (-1337.591) [-1345.526] (-1345.173) * (-1327.837) (-1353.110) [-1325.563] (-1343.321) -- 0:03:34
174000 -- (-1338.338) [-1327.900] (-1360.564) (-1345.858) * [-1332.294] (-1356.218) (-1329.209) (-1340.379) -- 0:03:33
174500 -- (-1340.919) (-1348.356) (-1342.367) [-1342.989] * (-1328.485) (-1349.344) (-1341.851) [-1340.078] -- 0:03:32
175000 -- [-1338.315] (-1338.175) (-1338.538) (-1349.498) * [-1326.126] (-1347.498) (-1343.284) (-1343.518) -- 0:03:32
Average standard deviation of split frequencies: 0.027348
175500 -- (-1343.745) [-1327.533] (-1358.406) (-1340.861) * [-1322.428] (-1353.899) (-1338.407) (-1345.733) -- 0:03:31
176000 -- (-1347.287) [-1321.703] (-1345.136) (-1346.914) * [-1320.695] (-1349.323) (-1342.366) (-1339.701) -- 0:03:30
176500 -- (-1332.937) [-1328.810] (-1340.749) (-1352.408) * [-1337.497] (-1339.483) (-1338.614) (-1351.689) -- 0:03:29
177000 -- (-1343.484) (-1332.348) (-1350.392) [-1321.405] * (-1340.390) (-1341.373) [-1343.306] (-1352.269) -- 0:03:33
177500 -- (-1338.075) (-1340.423) (-1343.552) [-1332.090] * (-1341.855) (-1354.610) [-1345.989] (-1353.595) -- 0:03:33
178000 -- (-1344.689) [-1333.758] (-1341.518) (-1339.671) * [-1325.790] (-1341.387) (-1345.501) (-1346.968) -- 0:03:32
178500 -- (-1352.578) (-1326.051) (-1341.243) [-1337.671] * [-1311.877] (-1345.139) (-1349.043) (-1344.511) -- 0:03:31
179000 -- (-1348.314) (-1340.905) [-1338.188] (-1341.253) * [-1315.093] (-1346.433) (-1350.765) (-1341.199) -- 0:03:30
179500 -- (-1334.552) [-1328.864] (-1345.016) (-1338.955) * [-1314.516] (-1340.377) (-1328.965) (-1342.342) -- 0:03:30
180000 -- (-1347.982) [-1318.298] (-1348.836) (-1347.340) * (-1338.463) (-1343.859) [-1348.379] (-1345.553) -- 0:03:29
Average standard deviation of split frequencies: 0.024582
180500 -- (-1342.348) [-1324.863] (-1351.259) (-1347.098) * [-1314.032] (-1343.979) (-1341.974) (-1347.345) -- 0:03:28
181000 -- (-1348.248) (-1334.088) [-1326.781] (-1346.000) * [-1331.733] (-1343.606) (-1346.870) (-1346.293) -- 0:03:32
181500 -- (-1342.705) (-1315.708) [-1332.163] (-1340.227) * (-1334.102) (-1348.442) [-1330.708] (-1338.299) -- 0:03:31
182000 -- (-1341.835) [-1322.922] (-1339.411) (-1345.927) * [-1302.441] (-1342.782) (-1354.766) (-1341.242) -- 0:03:31
182500 -- (-1339.437) [-1312.402] (-1344.784) (-1335.895) * [-1316.402] (-1332.006) (-1344.077) (-1349.973) -- 0:03:30
183000 -- (-1344.814) [-1326.633] (-1342.272) (-1339.622) * [-1314.853] (-1346.695) (-1332.083) (-1346.498) -- 0:03:29
183500 -- [-1323.572] (-1352.370) (-1347.246) (-1337.461) * [-1316.772] (-1339.284) (-1336.278) (-1346.493) -- 0:03:29
184000 -- [-1336.945] (-1341.190) (-1348.824) (-1350.283) * (-1317.977) [-1338.652] (-1345.338) (-1347.078) -- 0:03:28
184500 -- (-1352.732) (-1331.155) (-1349.921) [-1333.382] * [-1331.803] (-1343.040) (-1348.509) (-1355.816) -- 0:03:27
185000 -- (-1350.802) (-1329.350) (-1358.240) [-1338.876] * (-1341.346) [-1327.807] (-1343.798) (-1346.592) -- 0:03:31
Average standard deviation of split frequencies: 0.023877
185500 -- (-1337.233) [-1316.235] (-1333.782) (-1349.124) * (-1336.135) [-1330.081] (-1348.941) (-1351.532) -- 0:03:30
186000 -- (-1339.094) [-1327.197] (-1334.712) (-1347.861) * (-1339.424) [-1324.974] (-1344.521) (-1339.448) -- 0:03:30
186500 -- (-1336.864) [-1334.351] (-1346.957) (-1342.161) * (-1352.963) [-1328.351] (-1339.445) (-1341.487) -- 0:03:29
187000 -- (-1322.395) [-1342.357] (-1344.843) (-1343.224) * (-1350.584) (-1337.259) [-1337.988] (-1353.919) -- 0:03:28
187500 -- [-1325.942] (-1338.456) (-1340.874) (-1348.265) * (-1351.253) [-1348.861] (-1344.964) (-1352.198) -- 0:03:28
188000 -- [-1333.991] (-1339.563) (-1346.216) (-1351.344) * (-1348.898) [-1332.006] (-1352.812) (-1346.852) -- 0:03:27
188500 -- [-1327.855] (-1337.967) (-1341.801) (-1348.880) * (-1337.173) (-1348.145) (-1348.706) [-1329.783] -- 0:03:30
189000 -- (-1323.254) (-1341.395) [-1339.381] (-1341.171) * (-1334.775) [-1344.665] (-1352.957) (-1349.336) -- 0:03:30
189500 -- (-1335.941) [-1340.591] (-1349.099) (-1340.741) * (-1334.155) [-1336.697] (-1344.796) (-1346.520) -- 0:03:29
190000 -- [-1340.568] (-1346.460) (-1345.228) (-1350.010) * (-1343.477) [-1335.026] (-1336.132) (-1358.527) -- 0:03:28
Average standard deviation of split frequencies: 0.021211
190500 -- (-1337.091) [-1337.493] (-1351.963) (-1348.998) * [-1321.085] (-1342.441) (-1340.705) (-1347.428) -- 0:03:28
191000 -- [-1328.346] (-1344.891) (-1337.027) (-1350.332) * [-1322.595] (-1335.580) (-1338.374) (-1355.046) -- 0:03:27
191500 -- (-1330.896) (-1345.212) [-1336.855] (-1344.624) * [-1333.386] (-1332.266) (-1341.421) (-1349.030) -- 0:03:26
192000 -- [-1337.108] (-1358.829) (-1341.083) (-1340.060) * [-1320.254] (-1338.457) (-1345.714) (-1344.742) -- 0:03:26
192500 -- [-1332.199] (-1345.087) (-1342.909) (-1350.578) * [-1328.646] (-1340.602) (-1344.111) (-1339.665) -- 0:03:29
193000 -- (-1331.995) (-1332.988) [-1327.337] (-1343.428) * (-1335.815) (-1345.746) (-1347.925) [-1337.692] -- 0:03:29
193500 -- (-1356.970) (-1352.353) [-1318.320] (-1343.249) * (-1346.241) [-1325.936] (-1341.174) (-1323.695) -- 0:03:28
194000 -- (-1349.758) (-1341.108) [-1314.174] (-1342.225) * (-1339.453) (-1338.245) (-1342.764) [-1339.760] -- 0:03:27
194500 -- (-1352.973) [-1340.134] (-1327.687) (-1341.939) * (-1345.830) (-1328.315) (-1346.623) [-1337.710] -- 0:03:27
195000 -- [-1329.227] (-1337.283) (-1329.018) (-1342.340) * [-1339.002] (-1335.438) (-1344.532) (-1342.365) -- 0:03:26
Average standard deviation of split frequencies: 0.020380
195500 -- [-1323.077] (-1345.855) (-1332.444) (-1349.193) * (-1344.116) [-1327.665] (-1352.596) (-1340.542) -- 0:03:25
196000 -- (-1348.298) (-1340.461) [-1326.355] (-1341.230) * (-1345.638) (-1343.142) [-1338.689] (-1320.384) -- 0:03:25
196500 -- [-1332.608] (-1347.302) (-1328.977) (-1349.046) * (-1348.293) (-1348.196) (-1329.292) [-1330.573] -- 0:03:28
197000 -- (-1356.382) (-1333.109) [-1331.313] (-1340.201) * (-1352.329) [-1329.361] (-1343.434) (-1339.965) -- 0:03:27
197500 -- (-1333.044) (-1345.922) [-1342.882] (-1345.817) * (-1349.788) [-1337.394] (-1335.893) (-1334.038) -- 0:03:27
198000 -- (-1344.164) (-1342.064) [-1327.001] (-1348.884) * (-1334.280) (-1338.680) [-1341.525] (-1334.095) -- 0:03:26
198500 -- (-1333.489) [-1330.104] (-1309.641) (-1350.351) * (-1343.452) (-1349.197) (-1328.818) [-1315.209] -- 0:03:25
199000 -- (-1343.736) (-1339.974) [-1306.834] (-1341.566) * (-1344.039) (-1335.052) [-1321.337] (-1339.194) -- 0:03:25
199500 -- (-1344.203) (-1345.252) [-1337.738] (-1343.414) * (-1351.165) (-1342.629) [-1313.171] (-1347.384) -- 0:03:24
200000 -- (-1323.090) (-1345.158) [-1335.761] (-1357.039) * (-1336.557) (-1348.198) [-1325.246] (-1343.875) -- 0:03:24
Average standard deviation of split frequencies: 0.018299
200500 -- (-1353.658) [-1313.437] (-1335.027) (-1343.701) * (-1349.850) (-1360.890) [-1317.564] (-1345.576) -- 0:03:27
201000 -- (-1345.368) [-1318.117] (-1331.056) (-1344.574) * (-1338.700) [-1340.686] (-1327.896) (-1333.473) -- 0:03:26
201500 -- (-1345.342) [-1315.905] (-1325.998) (-1337.236) * (-1336.531) (-1344.828) [-1311.181] (-1325.742) -- 0:03:26
202000 -- (-1352.072) [-1323.411] (-1334.551) (-1350.371) * (-1339.900) (-1347.146) [-1316.725] (-1334.667) -- 0:03:25
202500 -- [-1328.538] (-1337.452) (-1340.096) (-1365.114) * (-1346.341) (-1352.031) [-1321.427] (-1321.875) -- 0:03:24
203000 -- [-1340.140] (-1340.841) (-1342.962) (-1347.460) * (-1356.392) (-1339.729) (-1326.473) [-1324.999] -- 0:03:24
203500 -- [-1333.723] (-1351.037) (-1335.126) (-1341.957) * (-1335.747) (-1345.003) (-1338.113) [-1319.801] -- 0:03:23
204000 -- (-1347.342) (-1338.269) [-1330.929] (-1341.220) * (-1344.776) (-1346.302) (-1350.798) [-1344.328] -- 0:03:22
204500 -- (-1349.127) [-1341.759] (-1342.342) (-1351.376) * [-1327.679] (-1336.885) (-1349.942) (-1337.358) -- 0:03:26
205000 -- (-1343.176) (-1350.041) [-1329.966] (-1332.457) * [-1326.175] (-1345.791) (-1344.833) (-1334.933) -- 0:03:25
Average standard deviation of split frequencies: 0.016259
205500 -- (-1349.237) (-1352.143) (-1339.666) [-1337.048] * [-1342.054] (-1345.985) (-1336.638) (-1344.951) -- 0:03:24
206000 -- (-1342.632) (-1346.044) (-1341.470) [-1335.665] * [-1349.481] (-1348.125) (-1341.273) (-1351.146) -- 0:03:24
206500 -- (-1337.445) (-1350.804) (-1346.051) [-1338.532] * (-1341.114) (-1346.800) [-1317.760] (-1350.822) -- 0:03:23
207000 -- (-1337.906) (-1344.662) [-1351.163] (-1345.657) * (-1335.065) (-1340.165) [-1315.329] (-1340.102) -- 0:03:23
207500 -- [-1311.636] (-1347.128) (-1346.712) (-1343.490) * [-1316.770] (-1341.906) (-1316.640) (-1345.339) -- 0:03:22
208000 -- [-1307.947] (-1350.652) (-1332.782) (-1347.439) * (-1319.780) (-1353.418) (-1342.356) [-1337.958] -- 0:03:25
208500 -- (-1337.480) (-1339.498) [-1336.212] (-1343.348) * [-1328.308] (-1351.198) (-1355.307) (-1339.955) -- 0:03:24
209000 -- [-1331.805] (-1348.936) (-1347.325) (-1343.529) * (-1339.060) (-1349.398) (-1338.221) [-1321.554] -- 0:03:24
209500 -- (-1358.016) (-1342.531) (-1336.142) [-1339.655] * (-1351.510) (-1346.478) [-1321.199] (-1342.228) -- 0:03:23
210000 -- [-1339.177] (-1351.388) (-1348.242) (-1342.878) * (-1345.685) (-1350.714) [-1335.851] (-1341.427) -- 0:03:23
Average standard deviation of split frequencies: 0.017548
210500 -- [-1326.337] (-1343.224) (-1334.302) (-1344.766) * (-1335.749) (-1351.079) (-1339.087) [-1336.878] -- 0:03:22
211000 -- (-1336.347) [-1334.083] (-1325.942) (-1339.919) * (-1338.122) (-1350.221) (-1343.789) [-1343.651] -- 0:03:21
211500 -- (-1344.162) (-1343.207) [-1333.334] (-1342.644) * (-1342.337) [-1323.676] (-1331.171) (-1333.620) -- 0:03:21
212000 -- (-1346.147) (-1343.299) [-1335.984] (-1343.169) * (-1347.694) (-1349.513) [-1324.650] (-1331.464) -- 0:03:24
212500 -- [-1343.963] (-1340.646) (-1337.744) (-1360.486) * [-1341.754] (-1343.685) (-1332.535) (-1355.239) -- 0:03:23
213000 -- (-1359.286) (-1344.182) [-1333.381] (-1347.589) * (-1352.104) (-1339.978) [-1321.930] (-1342.316) -- 0:03:23
213500 -- (-1340.591) [-1330.847] (-1332.967) (-1346.876) * (-1346.536) (-1338.121) [-1319.688] (-1337.645) -- 0:03:22
214000 -- (-1343.922) [-1330.744] (-1348.472) (-1344.180) * (-1351.808) (-1343.474) [-1337.011] (-1356.519) -- 0:03:22
214500 -- (-1329.006) [-1331.768] (-1351.891) (-1345.025) * (-1346.367) [-1334.639] (-1332.201) (-1341.900) -- 0:03:21
215000 -- [-1333.047] (-1338.172) (-1320.232) (-1343.836) * (-1351.243) (-1349.525) (-1342.132) [-1338.307] -- 0:03:20
Average standard deviation of split frequencies: 0.017115
215500 -- (-1352.557) (-1340.311) [-1321.325] (-1339.817) * (-1340.133) [-1341.676] (-1337.010) (-1352.287) -- 0:03:20
216000 -- (-1351.358) (-1348.727) [-1322.323] (-1348.011) * (-1349.149) (-1347.430) [-1319.235] (-1344.555) -- 0:03:23
216500 -- (-1345.832) (-1350.526) (-1338.155) [-1328.605] * [-1339.105] (-1346.254) (-1327.024) (-1351.283) -- 0:03:22
217000 -- (-1339.834) (-1340.430) [-1333.127] (-1354.670) * (-1333.094) (-1342.673) [-1338.532] (-1336.340) -- 0:03:22
217500 -- (-1334.501) (-1335.918) [-1327.199] (-1349.407) * (-1348.042) (-1331.976) (-1363.420) [-1325.932] -- 0:03:21
218000 -- (-1344.019) [-1341.372] (-1348.355) (-1347.850) * (-1334.660) [-1338.341] (-1346.848) (-1337.781) -- 0:03:20
218500 -- (-1341.292) (-1349.220) [-1338.004] (-1351.233) * (-1359.526) (-1347.683) [-1335.547] (-1344.683) -- 0:03:20
219000 -- (-1338.470) (-1342.097) [-1335.518] (-1356.732) * (-1355.747) (-1346.115) (-1328.487) [-1336.072] -- 0:03:19
219500 -- (-1342.711) (-1337.256) [-1336.258] (-1352.784) * (-1351.560) (-1349.656) (-1321.441) [-1316.280] -- 0:03:19
220000 -- (-1360.705) (-1331.733) [-1333.785] (-1345.329) * (-1342.353) (-1349.108) (-1329.336) [-1328.856] -- 0:03:22
Average standard deviation of split frequencies: 0.018633
220500 -- (-1351.779) [-1340.209] (-1337.427) (-1350.217) * (-1353.739) (-1346.351) [-1339.236] (-1338.169) -- 0:03:21
221000 -- (-1343.103) (-1351.849) [-1334.177] (-1347.206) * (-1342.456) (-1342.151) (-1321.330) [-1339.518] -- 0:03:20
221500 -- (-1348.769) [-1338.110] (-1340.894) (-1340.034) * (-1351.756) (-1356.808) (-1321.186) [-1324.367] -- 0:03:20
222000 -- (-1336.397) (-1344.077) [-1335.947] (-1341.132) * (-1356.606) (-1348.670) [-1329.102] (-1325.697) -- 0:03:19
222500 -- (-1344.603) (-1352.167) [-1333.909] (-1342.387) * (-1348.126) (-1353.098) [-1332.940] (-1328.682) -- 0:03:19
223000 -- (-1356.479) (-1343.797) (-1328.001) [-1345.915] * (-1350.543) (-1350.349) (-1338.101) [-1331.033] -- 0:03:18
223500 -- (-1346.544) (-1337.026) [-1331.765] (-1344.836) * (-1351.031) (-1351.561) (-1341.918) [-1339.465] -- 0:03:18
224000 -- (-1344.728) (-1345.585) [-1319.834] (-1345.436) * (-1357.897) (-1345.098) (-1334.127) [-1333.097] -- 0:03:20
224500 -- (-1346.931) (-1352.444) [-1326.358] (-1348.460) * (-1354.613) (-1350.237) [-1330.547] (-1339.227) -- 0:03:20
225000 -- (-1350.633) (-1346.678) [-1329.035] (-1345.287) * (-1344.697) (-1356.680) (-1335.901) [-1327.209] -- 0:03:19
Average standard deviation of split frequencies: 0.018889
225500 -- (-1341.800) (-1352.142) [-1322.259] (-1337.191) * (-1342.484) (-1344.408) (-1333.148) [-1321.371] -- 0:03:19
226000 -- [-1340.646] (-1355.512) (-1345.454) (-1344.438) * (-1346.798) (-1336.951) (-1350.168) [-1315.543] -- 0:03:18
226500 -- (-1345.352) (-1341.863) (-1342.057) [-1326.649] * [-1335.807] (-1345.862) (-1344.152) (-1334.685) -- 0:03:18
227000 -- (-1349.190) [-1333.763] (-1345.680) (-1308.844) * (-1353.027) (-1344.359) [-1333.904] (-1344.721) -- 0:03:17
227500 -- (-1344.503) (-1331.542) (-1344.754) [-1328.912] * (-1348.051) (-1348.593) (-1337.627) [-1335.349] -- 0:03:16
228000 -- [-1333.264] (-1357.118) (-1358.038) (-1335.647) * (-1342.998) (-1340.980) (-1345.850) [-1331.563] -- 0:03:19
228500 -- (-1339.882) (-1350.265) (-1348.109) [-1338.664] * (-1344.792) (-1349.184) (-1345.152) [-1329.477] -- 0:03:19
229000 -- (-1345.253) [-1341.545] (-1329.618) (-1349.790) * (-1348.491) (-1354.594) (-1344.599) [-1334.369] -- 0:03:18
229500 -- [-1347.879] (-1346.245) (-1340.788) (-1336.260) * (-1344.783) (-1350.761) [-1336.275] (-1339.119) -- 0:03:18
230000 -- (-1349.930) (-1355.299) (-1342.477) [-1328.266] * (-1333.949) (-1349.890) (-1333.677) [-1340.388] -- 0:03:17
Average standard deviation of split frequencies: 0.018823
230500 -- (-1344.274) (-1341.179) (-1347.546) [-1330.209] * (-1333.392) (-1349.664) (-1344.573) [-1336.008] -- 0:03:16
231000 -- (-1348.869) (-1349.604) [-1336.971] (-1340.520) * [-1336.973] (-1358.490) (-1343.395) (-1335.471) -- 0:03:16
231500 -- (-1342.690) (-1354.006) [-1321.650] (-1338.000) * (-1347.050) (-1346.433) (-1352.055) [-1319.771] -- 0:03:19
232000 -- (-1341.144) (-1353.862) [-1333.438] (-1349.902) * (-1340.255) (-1353.934) (-1333.264) [-1320.899] -- 0:03:18
232500 -- (-1338.660) (-1353.701) [-1324.547] (-1335.607) * (-1349.273) (-1353.252) (-1343.275) [-1341.035] -- 0:03:18
233000 -- (-1349.646) (-1341.516) [-1338.736] (-1341.489) * [-1338.765] (-1354.917) (-1337.253) (-1346.059) -- 0:03:17
233500 -- (-1340.789) [-1338.847] (-1351.999) (-1345.752) * [-1327.796] (-1337.636) (-1325.876) (-1340.187) -- 0:03:16
234000 -- (-1338.776) [-1337.823] (-1346.415) (-1345.394) * (-1336.609) (-1346.718) [-1337.832] (-1341.674) -- 0:03:16
234500 -- (-1335.747) (-1344.375) [-1339.547] (-1348.393) * (-1353.910) (-1349.857) [-1335.791] (-1359.006) -- 0:03:15
235000 -- (-1335.164) (-1339.098) [-1333.227] (-1345.030) * (-1337.859) [-1341.069] (-1344.402) (-1345.662) -- 0:03:15
Average standard deviation of split frequencies: 0.018818
235500 -- (-1347.484) (-1340.318) [-1322.865] (-1351.282) * [-1340.186] (-1336.408) (-1354.957) (-1340.846) -- 0:03:18
236000 -- (-1340.425) (-1333.764) (-1342.766) [-1325.103] * (-1343.362) (-1336.088) (-1346.277) [-1334.253] -- 0:03:17
236500 -- (-1343.484) (-1360.607) (-1344.738) [-1332.443] * (-1339.310) (-1340.956) (-1339.420) [-1325.230] -- 0:03:16
237000 -- (-1345.006) (-1325.253) [-1326.138] (-1346.966) * (-1342.518) (-1338.525) [-1326.081] (-1329.642) -- 0:03:16
237500 -- [-1325.837] (-1344.424) (-1340.804) (-1348.845) * (-1341.278) (-1352.757) (-1336.611) [-1334.248] -- 0:03:15
238000 -- [-1310.447] (-1349.682) (-1332.213) (-1344.767) * (-1345.860) [-1329.405] (-1339.297) (-1352.564) -- 0:03:15
238500 -- (-1332.087) [-1336.945] (-1341.868) (-1344.890) * (-1345.173) [-1334.948] (-1349.651) (-1345.480) -- 0:03:14
239000 -- [-1327.612] (-1338.419) (-1333.195) (-1341.104) * (-1342.868) [-1324.684] (-1321.468) (-1346.213) -- 0:03:14
239500 -- [-1318.829] (-1343.726) (-1327.435) (-1327.865) * [-1338.470] (-1328.519) (-1344.344) (-1339.783) -- 0:03:16
240000 -- (-1338.387) (-1341.161) (-1339.819) [-1327.462] * (-1332.943) [-1327.734] (-1348.868) (-1356.921) -- 0:03:16
Average standard deviation of split frequencies: 0.018144
240500 -- (-1346.320) [-1338.330] (-1347.776) (-1346.698) * (-1344.808) (-1330.142) (-1356.413) [-1332.298] -- 0:03:15
241000 -- (-1340.528) [-1345.582] (-1335.069) (-1346.882) * (-1334.156) [-1329.238] (-1339.098) (-1359.164) -- 0:03:15
241500 -- (-1346.091) (-1347.904) [-1316.424] (-1350.004) * (-1345.363) (-1343.674) [-1340.766] (-1339.716) -- 0:03:14
242000 -- (-1341.157) [-1319.338] (-1332.068) (-1343.570) * (-1351.263) (-1336.747) (-1345.173) [-1335.738] -- 0:03:14
242500 -- (-1340.120) (-1331.160) [-1320.331] (-1356.891) * [-1319.933] (-1341.636) (-1350.652) (-1335.390) -- 0:03:13
243000 -- (-1337.656) [-1322.885] (-1329.042) (-1357.791) * [-1336.848] (-1345.745) (-1337.824) (-1351.493) -- 0:03:13
243500 -- (-1340.656) [-1320.490] (-1330.820) (-1339.611) * (-1336.782) (-1341.989) (-1342.751) [-1343.929] -- 0:03:15
244000 -- (-1347.709) [-1329.953] (-1355.509) (-1344.898) * [-1332.721] (-1345.270) (-1345.068) (-1342.771) -- 0:03:15
244500 -- [-1334.529] (-1341.858) (-1353.482) (-1336.091) * (-1336.184) [-1325.131] (-1342.027) (-1348.705) -- 0:03:14
245000 -- (-1330.636) [-1323.983] (-1350.441) (-1362.678) * (-1330.444) [-1333.172] (-1340.000) (-1343.892) -- 0:03:14
Average standard deviation of split frequencies: 0.017347
245500 -- (-1337.882) [-1331.469] (-1354.750) (-1351.231) * [-1317.669] (-1347.006) (-1341.379) (-1329.609) -- 0:03:13
246000 -- (-1331.187) (-1341.640) [-1336.151] (-1348.579) * [-1315.302] (-1343.192) (-1348.188) (-1348.378) -- 0:03:13
246500 -- (-1341.006) [-1345.437] (-1356.396) (-1349.814) * [-1326.654] (-1345.723) (-1345.266) (-1340.319) -- 0:03:12
247000 -- (-1349.953) (-1335.308) (-1349.187) [-1326.232] * [-1322.709] (-1347.886) (-1353.464) (-1339.332) -- 0:03:12
247500 -- (-1343.572) (-1338.484) (-1350.444) [-1325.974] * [-1320.466] (-1344.802) (-1348.808) (-1341.027) -- 0:03:14
248000 -- (-1345.718) (-1349.497) (-1340.754) [-1322.469] * (-1336.576) [-1324.919] (-1349.914) (-1347.288) -- 0:03:14
248500 -- (-1344.190) (-1343.981) (-1343.407) [-1334.236] * (-1329.764) (-1342.515) [-1340.773] (-1342.844) -- 0:03:13
249000 -- (-1334.593) (-1346.503) (-1342.521) [-1333.380] * [-1317.445] (-1327.845) (-1341.868) (-1336.765) -- 0:03:13
249500 -- (-1333.698) (-1350.208) (-1341.504) [-1330.981] * [-1326.454] (-1333.303) (-1345.761) (-1338.538) -- 0:03:12
250000 -- (-1340.338) (-1353.903) (-1348.644) [-1324.974] * (-1330.163) [-1321.888] (-1341.628) (-1344.785) -- 0:03:12
Average standard deviation of split frequencies: 0.016233
250500 -- (-1343.181) (-1344.696) (-1344.655) [-1341.178] * (-1348.132) [-1326.757] (-1344.687) (-1340.589) -- 0:03:11
251000 -- (-1342.880) (-1338.820) (-1342.630) [-1331.969] * (-1347.006) [-1336.689] (-1342.230) (-1334.374) -- 0:03:10
251500 -- (-1340.212) (-1344.791) (-1347.513) [-1338.847] * (-1349.909) [-1324.872] (-1347.119) (-1337.236) -- 0:03:13
252000 -- [-1321.219] (-1347.453) (-1341.231) (-1349.976) * (-1346.985) [-1323.979] (-1346.754) (-1333.525) -- 0:03:12
252500 -- (-1322.478) (-1340.901) (-1344.287) [-1334.384] * (-1342.770) (-1337.860) (-1346.467) [-1336.649] -- 0:03:12
253000 -- (-1343.980) (-1347.458) [-1344.033] (-1335.417) * (-1344.039) (-1347.452) [-1326.877] (-1344.410) -- 0:03:11
253500 -- (-1341.390) [-1331.509] (-1343.032) (-1351.059) * (-1353.243) (-1337.824) (-1340.978) [-1335.692] -- 0:03:11
254000 -- (-1351.518) [-1346.574] (-1349.584) (-1358.288) * (-1361.645) [-1344.863] (-1341.959) (-1337.723) -- 0:03:10
254500 -- (-1336.676) (-1345.884) (-1353.619) [-1336.890] * (-1354.698) (-1347.400) [-1339.888] (-1341.447) -- 0:03:10
255000 -- (-1340.089) (-1345.390) (-1339.866) [-1327.468] * (-1341.617) [-1342.609] (-1344.102) (-1339.443) -- 0:03:12
Average standard deviation of split frequencies: 0.017251
255500 -- (-1347.915) (-1338.609) (-1350.486) [-1312.475] * (-1346.729) [-1335.192] (-1345.456) (-1349.503) -- 0:03:12
256000 -- (-1358.058) (-1348.961) (-1345.144) [-1341.006] * (-1350.624) (-1336.183) [-1335.583] (-1358.807) -- 0:03:11
256500 -- [-1338.438] (-1340.415) (-1342.554) (-1338.050) * (-1344.636) [-1342.882] (-1346.773) (-1339.036) -- 0:03:11
257000 -- (-1344.417) (-1341.999) (-1337.621) [-1311.188] * (-1342.506) [-1323.088] (-1350.475) (-1352.079) -- 0:03:10
257500 -- [-1346.220] (-1348.883) (-1341.695) (-1337.035) * (-1343.808) [-1338.048] (-1332.589) (-1351.917) -- 0:03:10
258000 -- [-1347.106] (-1354.471) (-1348.639) (-1346.359) * (-1348.568) (-1344.362) [-1343.341] (-1357.539) -- 0:03:09
258500 -- [-1332.115] (-1336.787) (-1347.877) (-1345.337) * (-1353.699) (-1349.652) [-1330.542] (-1339.574) -- 0:03:09
259000 -- [-1336.555] (-1344.533) (-1344.160) (-1343.380) * (-1341.947) [-1333.995] (-1346.352) (-1340.613) -- 0:03:11
259500 -- [-1330.104] (-1329.333) (-1360.175) (-1337.637) * (-1344.130) [-1324.394] (-1336.381) (-1340.336) -- 0:03:11
260000 -- [-1319.041] (-1338.208) (-1346.485) (-1342.808) * (-1351.637) [-1330.503] (-1338.371) (-1348.063) -- 0:03:10
Average standard deviation of split frequencies: 0.017133
260500 -- [-1323.629] (-1347.657) (-1347.094) (-1346.753) * (-1339.876) (-1335.523) (-1338.350) [-1331.656] -- 0:03:10
261000 -- [-1331.395] (-1344.519) (-1338.009) (-1339.699) * (-1342.799) [-1331.135] (-1344.132) (-1341.713) -- 0:03:09
261500 -- [-1339.451] (-1340.978) (-1363.999) (-1345.917) * (-1356.656) (-1332.929) [-1335.253] (-1346.746) -- 0:03:09
262000 -- [-1329.732] (-1344.831) (-1349.593) (-1340.856) * (-1342.229) [-1315.921] (-1347.186) (-1339.474) -- 0:03:08
262500 -- (-1342.634) [-1342.329] (-1338.596) (-1334.779) * (-1342.398) [-1342.185] (-1357.092) (-1344.348) -- 0:03:08
263000 -- [-1342.186] (-1353.757) (-1349.537) (-1335.257) * (-1342.865) (-1346.834) (-1344.466) [-1338.909] -- 0:03:10
263500 -- (-1345.585) (-1338.636) (-1345.777) [-1335.249] * (-1346.153) (-1344.209) [-1346.090] (-1342.269) -- 0:03:10
264000 -- [-1344.408] (-1340.296) (-1347.737) (-1344.872) * [-1345.191] (-1346.847) (-1349.409) (-1340.807) -- 0:03:09
264500 -- (-1347.116) (-1344.685) (-1342.224) [-1332.551] * [-1329.455] (-1343.072) (-1345.894) (-1345.321) -- 0:03:09
265000 -- (-1349.648) (-1362.871) [-1338.700] (-1335.622) * (-1348.403) (-1342.499) (-1336.827) [-1320.932] -- 0:03:08
Average standard deviation of split frequencies: 0.016659
265500 -- (-1346.368) (-1343.399) (-1350.968) [-1336.264] * (-1339.815) [-1332.950] (-1341.780) (-1325.866) -- 0:03:08
266000 -- (-1349.614) (-1345.375) (-1340.221) [-1340.434] * (-1348.864) (-1348.596) (-1332.213) [-1334.168] -- 0:03:07
266500 -- [-1333.424] (-1360.692) (-1349.366) (-1336.548) * (-1347.950) [-1330.097] (-1343.390) (-1341.546) -- 0:03:07
267000 -- (-1341.883) (-1345.897) (-1345.251) [-1332.684] * (-1340.704) (-1341.628) [-1337.285] (-1346.029) -- 0:03:09
267500 -- [-1343.488] (-1351.704) (-1338.909) (-1341.215) * [-1330.711] (-1339.070) (-1349.509) (-1340.549) -- 0:03:08
268000 -- [-1324.717] (-1361.499) (-1343.028) (-1343.842) * (-1341.333) [-1326.964] (-1350.766) (-1338.776) -- 0:03:08
268500 -- [-1327.798] (-1352.336) (-1351.683) (-1326.743) * [-1339.527] (-1340.958) (-1338.476) (-1349.305) -- 0:03:07
269000 -- (-1338.897) (-1335.736) (-1343.634) [-1330.140] * [-1338.424] (-1346.621) (-1342.481) (-1345.921) -- 0:03:07
269500 -- [-1334.157] (-1342.656) (-1347.025) (-1331.499) * (-1334.751) [-1342.439] (-1345.095) (-1340.778) -- 0:03:07
270000 -- [-1317.185] (-1342.440) (-1347.782) (-1338.685) * (-1347.057) (-1344.080) (-1349.659) [-1341.281] -- 0:03:06
Average standard deviation of split frequencies: 0.015858
270500 -- [-1314.043] (-1339.698) (-1346.603) (-1348.429) * [-1332.093] (-1339.142) (-1349.362) (-1336.896) -- 0:03:08
271000 -- [-1333.548] (-1353.820) (-1347.168) (-1346.425) * [-1343.510] (-1343.308) (-1358.372) (-1342.797) -- 0:03:08
271500 -- (-1352.250) (-1344.967) [-1334.384] (-1343.268) * (-1343.180) (-1348.198) (-1347.251) [-1339.270] -- 0:03:07
272000 -- (-1336.183) (-1335.824) [-1325.846] (-1350.755) * [-1340.135] (-1350.099) (-1351.731) (-1348.531) -- 0:03:07
272500 -- (-1345.117) (-1333.790) [-1324.021] (-1351.483) * (-1342.147) [-1340.947] (-1347.280) (-1342.415) -- 0:03:06
273000 -- (-1347.663) (-1338.695) (-1343.793) [-1332.235] * (-1337.367) (-1339.314) (-1341.910) [-1340.833] -- 0:03:06
273500 -- (-1343.439) (-1348.728) [-1333.555] (-1340.082) * (-1344.789) (-1341.568) [-1344.382] (-1345.661) -- 0:03:05
274000 -- (-1336.377) (-1344.329) (-1346.155) [-1324.764] * (-1343.300) (-1339.437) [-1342.301] (-1351.192) -- 0:03:05
274500 -- (-1354.670) (-1345.176) (-1343.921) [-1322.912] * (-1345.283) [-1344.875] (-1349.433) (-1358.934) -- 0:03:07
275000 -- (-1342.459) (-1339.141) [-1337.444] (-1337.787) * [-1333.530] (-1344.417) (-1336.293) (-1344.231) -- 0:03:07
Average standard deviation of split frequencies: 0.017260
275500 -- (-1343.745) (-1336.790) [-1328.145] (-1342.703) * (-1344.313) (-1358.294) (-1343.274) [-1339.937] -- 0:03:06
276000 -- [-1334.875] (-1341.200) (-1344.382) (-1337.796) * (-1336.720) [-1341.092] (-1347.413) (-1342.215) -- 0:03:06
276500 -- (-1345.625) [-1340.254] (-1349.986) (-1340.334) * [-1336.948] (-1334.031) (-1349.803) (-1352.044) -- 0:03:05
277000 -- [-1337.593] (-1338.277) (-1345.685) (-1346.893) * (-1351.138) [-1330.852] (-1349.804) (-1344.810) -- 0:03:05
277500 -- (-1350.367) [-1332.641] (-1340.738) (-1352.579) * (-1339.579) [-1328.079] (-1343.093) (-1346.806) -- 0:03:04
278000 -- (-1343.194) [-1330.726] (-1337.279) (-1342.797) * (-1352.130) [-1334.642] (-1346.258) (-1353.099) -- 0:03:04
278500 -- (-1342.917) [-1324.544] (-1336.590) (-1343.041) * (-1340.203) [-1314.160] (-1355.853) (-1348.018) -- 0:03:06
279000 -- [-1321.525] (-1326.137) (-1342.595) (-1344.304) * (-1345.399) [-1325.221] (-1340.805) (-1344.961) -- 0:03:06
279500 -- (-1336.754) [-1328.848] (-1340.190) (-1347.305) * (-1348.860) [-1335.265] (-1341.654) (-1351.570) -- 0:03:05
280000 -- (-1351.803) [-1335.589] (-1340.043) (-1339.858) * (-1348.013) [-1333.552] (-1346.832) (-1348.760) -- 0:03:05
Average standard deviation of split frequencies: 0.016796
280500 -- (-1345.219) [-1327.016] (-1325.446) (-1353.489) * (-1347.742) [-1333.886] (-1347.361) (-1341.381) -- 0:03:04
281000 -- [-1346.272] (-1341.132) (-1313.022) (-1345.208) * (-1344.529) [-1335.513] (-1340.768) (-1350.513) -- 0:03:04
281500 -- (-1338.243) (-1331.732) [-1323.532] (-1342.542) * (-1351.639) (-1338.694) (-1347.329) [-1346.080] -- 0:03:03
282000 -- [-1321.358] (-1340.342) (-1336.818) (-1347.422) * (-1339.555) [-1337.075] (-1337.938) (-1342.658) -- 0:03:03
282500 -- [-1328.653] (-1342.754) (-1340.712) (-1343.826) * [-1332.573] (-1344.669) (-1339.662) (-1356.694) -- 0:03:05
283000 -- (-1344.601) [-1327.409] (-1336.292) (-1346.881) * (-1345.699) [-1337.812] (-1348.745) (-1346.394) -- 0:03:04
283500 -- (-1348.776) [-1322.210] (-1352.934) (-1347.977) * (-1350.753) (-1344.013) (-1353.040) [-1343.137] -- 0:03:04
284000 -- (-1344.445) [-1333.018] (-1345.409) (-1349.523) * (-1348.245) [-1332.819] (-1348.085) (-1339.381) -- 0:03:04
284500 -- (-1356.296) (-1332.739) (-1343.883) [-1343.892] * (-1344.556) [-1328.241] (-1347.845) (-1337.391) -- 0:03:03
285000 -- (-1337.429) [-1320.766] (-1347.723) (-1348.938) * (-1330.049) [-1327.593] (-1342.933) (-1341.238) -- 0:03:03
Average standard deviation of split frequencies: 0.015227
285500 -- (-1337.958) [-1330.421] (-1346.273) (-1334.759) * (-1326.226) [-1345.672] (-1348.319) (-1344.876) -- 0:03:02
286000 -- (-1356.722) (-1342.303) (-1355.561) [-1316.054] * (-1343.655) (-1341.955) (-1346.927) [-1342.548] -- 0:03:02
286500 -- (-1356.555) (-1345.187) (-1344.621) [-1318.445] * [-1341.309] (-1344.597) (-1344.631) (-1343.312) -- 0:03:04
287000 -- (-1347.169) (-1343.371) (-1348.791) [-1331.646] * (-1348.256) (-1345.713) (-1343.540) [-1337.437] -- 0:03:03
287500 -- [-1338.226] (-1338.932) (-1337.532) (-1328.093) * [-1344.953] (-1342.952) (-1341.964) (-1336.518) -- 0:03:03
288000 -- (-1341.125) (-1348.224) (-1347.613) [-1325.183] * [-1351.663] (-1342.889) (-1355.523) (-1336.976) -- 0:03:02
288500 -- (-1344.710) (-1342.967) (-1339.926) [-1338.125] * (-1341.427) (-1357.978) (-1346.089) [-1338.093] -- 0:03:02
289000 -- (-1352.598) (-1326.784) (-1343.058) [-1337.164] * (-1344.674) (-1358.751) (-1339.440) [-1337.097] -- 0:03:02
289500 -- (-1339.676) (-1337.412) (-1348.084) [-1331.250] * (-1348.008) (-1343.282) (-1347.127) [-1326.320] -- 0:03:01
290000 -- (-1355.737) (-1336.562) (-1347.771) [-1321.537] * (-1339.286) (-1350.811) (-1332.293) [-1322.399] -- 0:03:03
Average standard deviation of split frequencies: 0.014029
290500 -- (-1341.717) (-1332.452) (-1347.902) [-1326.986] * (-1340.901) (-1349.736) (-1352.072) [-1322.710] -- 0:03:03
291000 -- (-1355.204) [-1334.664] (-1344.727) (-1342.216) * (-1351.856) (-1351.185) (-1345.488) [-1327.852] -- 0:03:02
291500 -- (-1347.453) [-1322.202] (-1339.878) (-1343.328) * (-1344.322) [-1332.960] (-1335.578) (-1345.527) -- 0:03:02
292000 -- (-1342.959) [-1335.262] (-1340.097) (-1350.310) * (-1345.500) [-1338.254] (-1347.758) (-1343.188) -- 0:03:01
292500 -- (-1336.553) [-1337.469] (-1343.349) (-1346.476) * (-1355.917) (-1341.534) (-1343.197) [-1330.893] -- 0:03:01
293000 -- [-1336.781] (-1346.759) (-1342.345) (-1350.576) * (-1341.147) (-1349.792) (-1345.004) [-1334.281] -- 0:03:00
293500 -- (-1338.932) (-1346.565) (-1341.063) [-1338.449] * (-1341.161) (-1340.783) (-1349.229) [-1338.191] -- 0:03:00
294000 -- [-1338.541] (-1344.154) (-1342.878) (-1347.830) * (-1341.714) [-1346.420] (-1345.139) (-1347.752) -- 0:03:02
294500 -- [-1321.427] (-1336.554) (-1355.508) (-1339.756) * (-1342.664) (-1347.695) (-1349.481) [-1336.014] -- 0:03:02
295000 -- [-1335.058] (-1352.220) (-1350.216) (-1353.873) * (-1346.438) (-1359.931) (-1348.645) [-1343.996] -- 0:03:01
Average standard deviation of split frequencies: 0.015050
295500 -- (-1341.746) [-1332.954] (-1343.275) (-1336.974) * (-1346.107) (-1346.087) (-1339.271) [-1332.328] -- 0:03:01
296000 -- [-1327.832] (-1339.708) (-1342.987) (-1345.217) * [-1331.043] (-1347.290) (-1346.990) (-1343.571) -- 0:03:00
296500 -- [-1333.005] (-1335.436) (-1347.074) (-1349.858) * [-1324.571] (-1337.677) (-1342.640) (-1350.945) -- 0:03:00
297000 -- (-1326.894) [-1344.393] (-1343.936) (-1350.829) * [-1320.111] (-1328.305) (-1354.376) (-1345.405) -- 0:02:59
297500 -- (-1351.912) (-1345.301) [-1351.912] (-1341.296) * (-1345.382) (-1317.332) [-1317.494] (-1349.063) -- 0:02:59
298000 -- (-1344.462) (-1347.061) (-1354.351) [-1351.786] * (-1343.663) [-1319.148] (-1331.410) (-1346.045) -- 0:03:01
298500 -- [-1339.916] (-1359.477) (-1337.529) (-1338.791) * (-1347.372) (-1314.950) (-1342.285) [-1332.683] -- 0:03:00
299000 -- [-1328.253] (-1349.512) (-1338.043) (-1337.082) * (-1342.940) [-1304.686] (-1341.453) (-1348.963) -- 0:03:00
299500 -- [-1329.245] (-1350.043) (-1339.452) (-1340.569) * (-1351.004) [-1315.380] (-1341.591) (-1341.764) -- 0:03:00
300000 -- [-1330.573] (-1339.668) (-1338.650) (-1344.465) * (-1354.902) [-1316.935] (-1340.285) (-1358.466) -- 0:02:59
Average standard deviation of split frequencies: 0.016071
300500 -- [-1343.205] (-1338.385) (-1340.144) (-1349.835) * (-1349.219) [-1313.817] (-1346.380) (-1348.754) -- 0:02:59
301000 -- (-1346.093) [-1330.367] (-1340.706) (-1346.854) * (-1358.001) [-1308.840] (-1345.821) (-1347.878) -- 0:02:58
301500 -- (-1338.062) [-1333.818] (-1345.193) (-1342.794) * (-1355.063) [-1315.633] (-1346.349) (-1338.956) -- 0:02:58
302000 -- (-1338.006) [-1340.654] (-1347.393) (-1346.747) * (-1343.233) [-1324.496] (-1347.386) (-1338.002) -- 0:03:00
302500 -- (-1344.960) [-1341.876] (-1352.441) (-1341.289) * (-1340.909) [-1307.248] (-1338.526) (-1349.024) -- 0:02:59
303000 -- (-1355.378) (-1345.252) [-1337.706] (-1343.787) * (-1355.176) [-1311.978] (-1336.819) (-1345.498) -- 0:02:59
303500 -- [-1337.141] (-1334.123) (-1346.317) (-1343.057) * (-1336.168) [-1315.889] (-1348.640) (-1341.267) -- 0:02:59
304000 -- (-1335.506) [-1329.115] (-1341.031) (-1343.088) * (-1343.340) [-1330.534] (-1342.493) (-1332.991) -- 0:02:58
304500 -- [-1325.852] (-1342.686) (-1344.401) (-1343.700) * [-1338.552] (-1342.000) (-1330.981) (-1347.651) -- 0:02:58
305000 -- [-1334.241] (-1345.819) (-1360.794) (-1344.004) * (-1340.632) [-1335.000] (-1346.195) (-1346.297) -- 0:02:57
Average standard deviation of split frequencies: 0.015919
305500 -- (-1352.318) [-1332.903] (-1343.803) (-1343.753) * (-1340.280) [-1338.949] (-1349.144) (-1339.419) -- 0:02:57
306000 -- (-1337.067) [-1335.874] (-1346.088) (-1352.979) * (-1347.091) (-1342.317) (-1340.837) [-1334.149] -- 0:02:59
306500 -- (-1344.462) [-1336.196] (-1342.693) (-1341.029) * [-1342.576] (-1336.439) (-1347.507) (-1345.040) -- 0:02:58
307000 -- [-1334.288] (-1337.219) (-1347.847) (-1341.293) * [-1336.920] (-1341.811) (-1341.140) (-1352.735) -- 0:02:58
307500 -- (-1344.576) (-1335.885) (-1350.044) [-1343.868] * [-1322.118] (-1339.929) (-1345.997) (-1342.767) -- 0:02:57
308000 -- [-1320.702] (-1341.596) (-1343.633) (-1349.868) * (-1343.275) (-1355.236) [-1330.779] (-1338.983) -- 0:02:57
308500 -- [-1321.045] (-1344.383) (-1354.950) (-1344.151) * [-1326.839] (-1349.145) (-1336.592) (-1337.888) -- 0:02:57
309000 -- [-1317.815] (-1340.102) (-1346.483) (-1347.667) * [-1330.410] (-1355.660) (-1343.650) (-1338.821) -- 0:02:56
309500 -- [-1323.919] (-1349.256) (-1359.837) (-1344.770) * (-1332.393) (-1352.641) (-1348.638) [-1333.342] -- 0:02:56
310000 -- (-1338.102) (-1349.219) (-1364.796) [-1335.525] * [-1311.194] (-1341.801) (-1362.053) (-1339.677) -- 0:02:58
Average standard deviation of split frequencies: 0.016052
310500 -- (-1337.947) (-1327.452) (-1361.329) [-1338.703] * [-1313.170] (-1349.193) (-1347.575) (-1335.603) -- 0:02:57
311000 -- (-1342.598) (-1342.119) (-1347.070) [-1337.602] * [-1331.867] (-1337.094) (-1353.852) (-1338.146) -- 0:02:57
311500 -- (-1341.244) (-1355.118) (-1346.052) [-1334.051] * (-1336.050) (-1337.488) (-1344.978) [-1339.884] -- 0:02:56
312000 -- (-1338.751) (-1347.301) (-1351.055) [-1327.614] * (-1345.072) [-1320.765] (-1341.121) (-1336.291) -- 0:02:56
312500 -- [-1325.274] (-1337.637) (-1344.800) (-1339.131) * (-1340.065) [-1332.319] (-1352.180) (-1344.724) -- 0:02:56
313000 -- (-1350.216) [-1333.758] (-1345.691) (-1331.408) * (-1348.699) [-1330.149] (-1335.648) (-1339.325) -- 0:02:55
313500 -- (-1341.402) (-1339.926) (-1339.206) [-1333.592] * (-1357.448) (-1336.544) [-1318.203] (-1338.123) -- 0:02:55
314000 -- [-1338.536] (-1329.299) (-1341.038) (-1343.620) * (-1350.486) (-1339.722) [-1340.226] (-1347.617) -- 0:02:56
314500 -- [-1329.897] (-1344.663) (-1339.999) (-1347.744) * (-1346.122) (-1349.364) [-1336.246] (-1346.847) -- 0:02:56
315000 -- (-1332.273) (-1343.455) [-1338.153] (-1348.315) * (-1360.400) (-1340.066) [-1337.011] (-1344.752) -- 0:02:56
Average standard deviation of split frequencies: 0.015703
315500 -- (-1346.476) (-1344.727) (-1337.239) [-1324.834] * (-1341.132) (-1344.832) [-1334.284] (-1353.571) -- 0:02:55
316000 -- (-1347.095) (-1335.694) [-1336.343] (-1331.442) * (-1349.911) (-1344.056) [-1332.397] (-1343.875) -- 0:02:55
316500 -- (-1335.529) [-1321.860] (-1347.141) (-1340.709) * [-1347.391] (-1342.474) (-1338.953) (-1325.704) -- 0:02:54
317000 -- (-1343.201) (-1337.023) (-1355.191) [-1345.216] * (-1351.653) (-1334.453) [-1326.720] (-1324.282) -- 0:02:54
317500 -- (-1341.575) [-1318.597] (-1341.773) (-1346.417) * (-1346.989) (-1346.300) [-1318.785] (-1343.783) -- 0:02:56
318000 -- (-1346.935) [-1337.841] (-1333.848) (-1357.084) * (-1353.821) (-1356.886) [-1334.001] (-1339.624) -- 0:02:55
318500 -- (-1351.585) [-1310.895] (-1339.750) (-1350.241) * [-1336.556] (-1335.647) (-1337.569) (-1346.353) -- 0:02:55
319000 -- (-1347.947) [-1325.931] (-1346.325) (-1345.437) * [-1342.037] (-1334.566) (-1331.754) (-1346.884) -- 0:02:55
319500 -- (-1350.021) [-1336.802] (-1346.457) (-1338.304) * (-1349.017) [-1318.906] (-1346.173) (-1338.971) -- 0:02:54
320000 -- (-1336.811) (-1359.789) [-1332.608] (-1353.754) * (-1344.913) [-1331.657] (-1337.308) (-1335.527) -- 0:02:54
Average standard deviation of split frequencies: 0.015629
320500 -- [-1332.372] (-1345.195) (-1339.237) (-1335.549) * (-1347.411) (-1337.023) [-1336.560] (-1335.521) -- 0:02:53
321000 -- [-1321.497] (-1343.359) (-1347.060) (-1337.265) * (-1345.825) (-1344.603) (-1340.844) [-1331.500] -- 0:02:53
321500 -- [-1326.435] (-1350.844) (-1345.596) (-1332.833) * (-1342.604) [-1345.809] (-1345.497) (-1334.571) -- 0:02:55
322000 -- (-1340.556) (-1339.794) [-1329.961] (-1339.634) * (-1347.686) (-1340.873) (-1342.061) [-1314.375] -- 0:02:54
322500 -- [-1335.301] (-1350.729) (-1332.363) (-1352.143) * [-1337.594] (-1343.215) (-1343.946) (-1337.509) -- 0:02:54
323000 -- (-1348.412) [-1326.814] (-1343.621) (-1342.330) * (-1342.715) [-1334.614] (-1347.116) (-1327.098) -- 0:02:53
323500 -- (-1343.233) (-1338.510) (-1351.781) [-1344.081] * (-1353.245) [-1332.860] (-1327.291) (-1336.745) -- 0:02:53
324000 -- (-1357.681) [-1336.833] (-1339.277) (-1357.983) * (-1354.341) [-1337.269] (-1329.041) (-1341.957) -- 0:02:53
324500 -- [-1333.416] (-1346.508) (-1338.757) (-1345.185) * [-1334.454] (-1350.235) (-1344.449) (-1357.196) -- 0:02:52
325000 -- [-1324.652] (-1352.358) (-1335.931) (-1342.380) * (-1340.455) (-1340.477) (-1337.233) [-1340.467] -- 0:02:52
Average standard deviation of split frequencies: 0.014232
325500 -- (-1343.476) (-1343.247) [-1334.804] (-1334.836) * (-1341.644) (-1343.803) (-1336.735) [-1337.003] -- 0:02:54
326000 -- (-1335.989) [-1329.386] (-1349.094) (-1354.168) * (-1336.034) (-1330.831) (-1346.112) [-1336.693] -- 0:02:53
326500 -- (-1338.726) [-1318.644] (-1342.375) (-1339.284) * (-1342.969) (-1351.647) [-1336.337] (-1343.530) -- 0:02:53
327000 -- (-1343.741) [-1331.203] (-1344.899) (-1353.124) * (-1351.706) (-1342.778) (-1333.402) [-1328.592] -- 0:02:52
327500 -- (-1346.363) [-1330.256] (-1329.932) (-1350.260) * (-1345.401) [-1347.436] (-1347.087) (-1335.736) -- 0:02:52
328000 -- (-1347.791) (-1349.262) [-1333.769] (-1348.198) * (-1344.629) (-1346.973) [-1320.010] (-1321.803) -- 0:02:52
328500 -- (-1348.813) [-1342.968] (-1343.276) (-1345.763) * (-1345.852) (-1342.899) [-1331.570] (-1340.292) -- 0:02:51
329000 -- (-1347.472) (-1352.038) (-1337.042) [-1339.549] * (-1348.666) (-1340.092) [-1322.130] (-1348.775) -- 0:02:51
329500 -- (-1341.769) (-1332.779) (-1345.161) [-1320.598] * (-1346.882) (-1339.789) [-1330.791] (-1342.240) -- 0:02:52
330000 -- (-1347.426) [-1351.243] (-1342.146) (-1343.186) * (-1342.765) (-1335.150) [-1337.271] (-1340.211) -- 0:02:52
Average standard deviation of split frequencies: 0.014631
330500 -- (-1339.593) [-1338.425] (-1357.742) (-1351.059) * (-1349.122) [-1326.797] (-1339.952) (-1341.116) -- 0:02:52
331000 -- [-1328.079] (-1336.387) (-1337.291) (-1349.879) * (-1348.810) [-1334.027] (-1326.409) (-1345.151) -- 0:02:51
331500 -- (-1346.871) (-1340.771) [-1337.073] (-1345.593) * (-1336.125) (-1352.868) [-1329.330] (-1351.575) -- 0:02:51
332000 -- (-1340.649) (-1349.436) (-1346.512) [-1337.241] * (-1334.471) (-1349.074) [-1327.253] (-1337.865) -- 0:02:51
332500 -- (-1349.028) (-1348.723) [-1343.594] (-1345.093) * (-1345.239) (-1338.753) [-1333.012] (-1345.655) -- 0:02:50
333000 -- (-1346.905) (-1343.946) (-1338.198) [-1342.992] * (-1341.325) (-1364.008) [-1331.281] (-1347.432) -- 0:02:50
333500 -- (-1345.693) (-1347.678) (-1346.759) [-1337.684] * (-1346.345) [-1333.075] (-1337.654) (-1341.822) -- 0:02:51
334000 -- (-1348.199) [-1340.943] (-1347.154) (-1336.807) * [-1340.542] (-1351.652) (-1339.368) (-1340.059) -- 0:02:51
334500 -- (-1340.996) [-1336.420] (-1331.979) (-1342.883) * (-1347.214) (-1349.133) (-1339.071) [-1352.741] -- 0:02:51
335000 -- (-1339.373) (-1348.628) [-1314.820] (-1341.253) * (-1343.739) [-1331.019] (-1324.613) (-1350.503) -- 0:02:50
Average standard deviation of split frequencies: 0.014178
335500 -- (-1342.438) (-1341.783) (-1331.053) [-1323.182] * (-1353.845) (-1337.714) [-1325.088] (-1333.083) -- 0:02:50
336000 -- (-1343.533) (-1330.821) [-1331.786] (-1357.055) * (-1353.137) (-1344.197) [-1311.872] (-1349.806) -- 0:02:49
336500 -- [-1336.323] (-1327.814) (-1348.793) (-1356.529) * (-1356.761) (-1352.750) [-1328.334] (-1353.802) -- 0:02:49
337000 -- (-1346.918) [-1340.052] (-1342.528) (-1358.774) * (-1352.938) (-1342.206) [-1324.326] (-1347.555) -- 0:02:49
337500 -- (-1349.844) (-1344.626) (-1334.110) [-1328.359] * (-1346.562) (-1353.077) [-1333.414] (-1350.114) -- 0:02:50
338000 -- (-1342.327) (-1339.978) (-1343.788) [-1321.635] * (-1341.875) (-1351.988) [-1325.018] (-1349.847) -- 0:02:50
338500 -- [-1335.559] (-1352.307) (-1337.111) (-1332.834) * [-1345.968] (-1347.038) (-1337.032) (-1353.158) -- 0:02:50
339000 -- (-1342.382) (-1349.400) [-1314.380] (-1338.436) * (-1354.537) (-1336.297) [-1331.949] (-1351.224) -- 0:02:49
339500 -- (-1344.813) (-1348.604) [-1321.822] (-1349.794) * (-1333.285) (-1335.091) [-1329.406] (-1348.100) -- 0:02:49
340000 -- (-1337.290) (-1348.707) [-1337.440] (-1344.847) * (-1330.382) (-1343.603) [-1327.978] (-1343.503) -- 0:02:48
Average standard deviation of split frequencies: 0.013692
340500 -- [-1336.556] (-1343.414) (-1340.636) (-1335.282) * (-1342.833) (-1348.920) [-1326.497] (-1351.096) -- 0:02:48
341000 -- [-1325.541] (-1340.540) (-1345.107) (-1346.868) * [-1338.485] (-1345.395) (-1342.437) (-1341.234) -- 0:02:48
341500 -- [-1332.349] (-1342.279) (-1336.353) (-1338.547) * (-1342.295) (-1340.502) [-1343.897] (-1339.884) -- 0:02:49
342000 -- [-1320.944] (-1348.637) (-1339.784) (-1339.531) * (-1339.300) [-1333.983] (-1350.370) (-1351.695) -- 0:02:49
342500 -- [-1315.103] (-1357.817) (-1345.718) (-1354.529) * [-1334.460] (-1343.841) (-1338.075) (-1328.082) -- 0:02:48
343000 -- [-1327.345] (-1349.279) (-1334.033) (-1342.826) * (-1334.817) (-1350.112) [-1335.846] (-1339.782) -- 0:02:48
343500 -- [-1319.556] (-1346.005) (-1350.800) (-1342.863) * (-1335.409) (-1342.591) (-1337.822) [-1313.907] -- 0:02:48
344000 -- (-1320.055) (-1340.699) (-1345.449) [-1326.704] * (-1351.669) (-1341.264) (-1350.643) [-1322.579] -- 0:02:47
344500 -- [-1320.729] (-1338.516) (-1344.744) (-1347.621) * (-1346.170) (-1332.509) (-1343.403) [-1329.576] -- 0:02:47
345000 -- [-1318.561] (-1331.850) (-1336.228) (-1340.623) * (-1349.359) (-1340.286) [-1319.184] (-1335.825) -- 0:02:47
Average standard deviation of split frequencies: 0.014578
345500 -- [-1316.550] (-1340.926) (-1344.325) (-1349.592) * (-1356.938) (-1340.642) (-1343.303) [-1333.249] -- 0:02:48
346000 -- (-1333.741) (-1346.755) [-1347.494] (-1342.407) * (-1351.876) (-1344.739) (-1335.997) [-1326.479] -- 0:02:48
346500 -- (-1336.564) (-1349.743) [-1346.750] (-1342.435) * (-1346.431) (-1336.442) (-1336.942) [-1323.331] -- 0:02:47
347000 -- (-1339.286) (-1349.607) [-1335.615] (-1348.579) * (-1342.485) (-1337.194) (-1351.803) [-1315.696] -- 0:02:47
347500 -- (-1332.751) (-1344.978) [-1326.721] (-1344.674) * (-1343.895) (-1342.719) (-1339.583) [-1326.876] -- 0:02:47
348000 -- [-1329.703] (-1341.317) (-1334.054) (-1340.619) * (-1350.958) (-1342.190) (-1345.836) [-1323.575] -- 0:02:46
348500 -- (-1348.944) (-1351.338) [-1328.347] (-1340.706) * (-1351.831) (-1346.256) (-1341.774) [-1328.668] -- 0:02:46
349000 -- (-1338.282) (-1338.360) [-1327.745] (-1343.722) * (-1344.212) (-1338.969) (-1361.360) [-1338.224] -- 0:02:47
349500 -- [-1338.373] (-1340.217) (-1338.159) (-1348.792) * (-1350.587) [-1337.159] (-1340.793) (-1335.286) -- 0:02:47
350000 -- (-1340.209) [-1345.087] (-1355.436) (-1341.386) * (-1341.335) [-1341.122] (-1346.157) (-1332.369) -- 0:02:47
Average standard deviation of split frequencies: 0.014317
350500 -- (-1344.250) [-1339.475] (-1347.382) (-1343.515) * (-1342.659) (-1351.048) (-1341.880) [-1343.197] -- 0:02:46
351000 -- (-1354.017) (-1346.314) [-1335.221] (-1347.199) * (-1345.939) (-1357.506) (-1331.088) [-1323.145] -- 0:02:46
351500 -- (-1353.503) (-1349.621) [-1330.368] (-1342.817) * (-1343.329) (-1341.612) (-1347.393) [-1333.637] -- 0:02:46
352000 -- (-1353.480) (-1339.353) [-1324.829] (-1346.262) * (-1342.445) (-1354.765) (-1346.022) [-1335.090] -- 0:02:45
352500 -- [-1345.806] (-1351.611) (-1330.460) (-1339.196) * (-1344.622) (-1339.034) (-1347.624) [-1334.802] -- 0:02:45
353000 -- [-1337.724] (-1352.042) (-1341.264) (-1348.324) * (-1344.635) (-1342.019) (-1343.126) [-1346.035] -- 0:02:46
353500 -- (-1349.807) [-1335.417] (-1342.833) (-1349.505) * (-1356.541) [-1343.602] (-1346.825) (-1338.689) -- 0:02:46
354000 -- [-1338.272] (-1346.291) (-1341.211) (-1363.977) * [-1336.700] (-1343.564) (-1361.924) (-1335.986) -- 0:02:46
354500 -- [-1340.377] (-1329.324) (-1347.904) (-1352.147) * (-1347.094) (-1346.965) (-1346.459) [-1321.645] -- 0:02:45
355000 -- [-1341.792] (-1332.939) (-1347.070) (-1336.630) * (-1348.923) (-1339.773) (-1345.183) [-1329.048] -- 0:02:45
Average standard deviation of split frequencies: 0.013838
355500 -- (-1346.737) [-1323.036] (-1348.783) (-1355.666) * (-1333.923) (-1343.763) (-1350.096) [-1327.806] -- 0:02:44
356000 -- (-1337.735) (-1333.729) (-1343.871) [-1334.826] * (-1349.218) (-1355.804) [-1332.143] (-1355.968) -- 0:02:44
356500 -- (-1343.986) (-1331.560) (-1346.861) [-1336.454] * (-1346.852) (-1354.645) (-1329.976) [-1339.495] -- 0:02:44
357000 -- (-1340.973) [-1331.376] (-1341.325) (-1347.059) * (-1343.657) (-1341.081) [-1321.818] (-1353.677) -- 0:02:45
357500 -- (-1349.260) [-1330.268] (-1344.147) (-1341.230) * (-1341.728) [-1330.586] (-1342.833) (-1346.335) -- 0:02:45
358000 -- (-1349.587) [-1317.852] (-1334.823) (-1348.568) * (-1353.811) (-1333.673) (-1349.167) [-1326.141] -- 0:02:44
358500 -- (-1345.777) (-1330.599) [-1333.834] (-1344.434) * (-1337.710) (-1342.160) [-1343.340] (-1334.011) -- 0:02:44
359000 -- (-1354.299) (-1342.942) (-1339.995) [-1337.955] * (-1331.209) (-1350.142) (-1346.901) [-1320.536] -- 0:02:44
359500 -- (-1340.726) (-1342.982) [-1335.116] (-1346.469) * [-1317.956] (-1345.042) (-1341.313) (-1340.511) -- 0:02:43
360000 -- (-1350.631) (-1344.080) [-1328.010] (-1349.713) * [-1332.176] (-1341.043) (-1331.437) (-1345.436) -- 0:02:43
Average standard deviation of split frequencies: 0.012417
360500 -- (-1346.625) [-1328.869] (-1345.594) (-1341.932) * (-1349.616) (-1344.547) (-1338.846) [-1330.099] -- 0:02:43
361000 -- (-1348.014) (-1351.232) [-1331.363] (-1334.264) * (-1341.458) [-1333.220] (-1342.387) (-1334.475) -- 0:02:44
361500 -- (-1341.265) (-1356.336) [-1323.027] (-1345.298) * [-1340.755] (-1332.297) (-1347.401) (-1333.159) -- 0:02:44
362000 -- [-1329.819] (-1343.693) (-1350.838) (-1340.607) * (-1342.381) (-1341.378) (-1341.487) [-1333.134] -- 0:02:43
362500 -- (-1344.706) (-1342.868) (-1346.751) [-1338.259] * (-1343.372) (-1339.007) (-1362.508) [-1330.316] -- 0:02:43
363000 -- (-1332.084) [-1340.535] (-1340.858) (-1340.335) * [-1334.880] (-1342.234) (-1344.119) (-1324.711) -- 0:02:43
363500 -- (-1334.247) (-1343.033) [-1336.983] (-1340.624) * (-1334.798) (-1337.408) (-1350.293) [-1341.718] -- 0:02:42
364000 -- [-1333.724] (-1346.919) (-1349.711) (-1354.458) * (-1338.021) [-1328.109] (-1341.933) (-1342.219) -- 0:02:42
364500 -- [-1313.108] (-1338.532) (-1344.438) (-1344.675) * (-1340.397) [-1332.444] (-1348.694) (-1331.374) -- 0:02:42
365000 -- (-1313.301) (-1349.073) [-1329.420] (-1353.997) * [-1320.585] (-1340.802) (-1353.909) (-1344.590) -- 0:02:43
Average standard deviation of split frequencies: 0.012270
365500 -- [-1317.441] (-1343.394) (-1335.587) (-1345.942) * [-1310.322] (-1343.262) (-1350.969) (-1324.548) -- 0:02:43
366000 -- (-1336.439) [-1323.156] (-1328.734) (-1346.000) * [-1330.176] (-1337.097) (-1347.790) (-1346.606) -- 0:02:42
366500 -- (-1343.271) (-1357.976) [-1323.803] (-1357.257) * [-1322.734] (-1340.143) (-1337.640) (-1334.336) -- 0:02:42
367000 -- (-1344.433) (-1344.416) [-1332.777] (-1353.899) * [-1324.387] (-1350.331) (-1347.496) (-1341.824) -- 0:02:42
367500 -- [-1338.917] (-1350.511) (-1337.642) (-1344.573) * (-1319.944) (-1347.042) (-1345.546) [-1332.525] -- 0:02:41
368000 -- [-1332.425] (-1345.975) (-1319.810) (-1346.718) * [-1348.597] (-1343.129) (-1346.103) (-1343.230) -- 0:02:41
368500 -- (-1346.373) (-1363.030) (-1331.075) [-1320.242] * (-1337.726) (-1337.729) (-1341.369) [-1323.816] -- 0:02:42
369000 -- [-1328.689] (-1352.138) (-1338.747) (-1348.884) * (-1360.642) (-1334.001) (-1355.889) [-1318.562] -- 0:02:42
369500 -- [-1333.046] (-1339.320) (-1352.901) (-1342.051) * (-1348.764) (-1338.707) (-1351.621) [-1317.476] -- 0:02:42
370000 -- (-1344.797) [-1334.161] (-1342.298) (-1350.739) * (-1340.201) (-1343.991) (-1336.630) [-1317.933] -- 0:02:41
Average standard deviation of split frequencies: 0.012919
370500 -- (-1353.158) (-1344.168) [-1338.116] (-1347.348) * (-1347.315) (-1336.104) (-1335.245) [-1325.992] -- 0:02:41
371000 -- (-1344.022) [-1333.270] (-1334.367) (-1346.869) * (-1352.270) (-1331.551) (-1356.189) [-1329.126] -- 0:02:41
371500 -- (-1343.403) (-1335.621) [-1318.949] (-1339.399) * (-1346.897) (-1342.843) [-1326.824] (-1336.004) -- 0:02:40
372000 -- (-1342.623) [-1340.941] (-1337.350) (-1350.888) * (-1344.603) (-1340.294) [-1329.048] (-1341.882) -- 0:02:40
372500 -- [-1334.516] (-1341.772) (-1344.725) (-1337.884) * (-1332.174) (-1344.187) [-1330.673] (-1347.608) -- 0:02:41
373000 -- [-1336.420] (-1342.901) (-1339.526) (-1342.884) * [-1319.071] (-1336.035) (-1354.775) (-1352.390) -- 0:02:41
373500 -- (-1347.390) [-1333.813] (-1338.973) (-1346.065) * [-1327.895] (-1347.883) (-1358.185) (-1341.216) -- 0:02:41
374000 -- (-1345.603) (-1325.469) [-1312.498] (-1351.298) * (-1340.314) (-1357.393) (-1356.166) [-1332.907] -- 0:02:40
374500 -- (-1343.589) [-1325.375] (-1333.080) (-1349.463) * [-1332.918] (-1346.646) (-1337.966) (-1335.620) -- 0:02:40
375000 -- (-1349.485) (-1344.178) [-1323.278] (-1347.842) * (-1335.866) (-1343.577) (-1346.386) [-1341.058] -- 0:02:40
Average standard deviation of split frequencies: 0.013461
375500 -- (-1341.074) (-1346.597) [-1332.685] (-1344.528) * [-1324.362] (-1346.947) (-1346.522) (-1339.749) -- 0:02:39
376000 -- [-1333.136] (-1338.727) (-1342.702) (-1357.097) * [-1328.620] (-1353.669) (-1336.231) (-1342.574) -- 0:02:39
376500 -- [-1335.373] (-1340.867) (-1352.974) (-1352.395) * [-1324.181] (-1353.981) (-1345.719) (-1340.311) -- 0:02:40
377000 -- (-1340.195) (-1344.509) [-1328.110] (-1331.280) * [-1324.639] (-1349.816) (-1340.767) (-1348.057) -- 0:02:40
377500 -- (-1337.730) (-1346.451) (-1339.597) [-1327.060] * (-1338.882) (-1347.147) [-1338.588] (-1347.959) -- 0:02:39
378000 -- [-1330.391] (-1334.589) (-1341.328) (-1328.565) * [-1325.048] (-1357.475) (-1341.099) (-1341.963) -- 0:02:39
378500 -- (-1345.241) (-1343.631) [-1334.086] (-1332.989) * [-1328.808] (-1361.719) (-1346.456) (-1340.638) -- 0:02:39
379000 -- (-1340.891) (-1348.769) (-1344.301) [-1310.740] * (-1330.616) (-1346.490) (-1342.032) [-1330.379] -- 0:02:38
379500 -- (-1336.937) (-1348.312) (-1341.437) [-1326.198] * [-1343.911] (-1342.895) (-1348.023) (-1345.840) -- 0:02:38
380000 -- (-1343.891) (-1348.675) (-1340.615) [-1339.421] * (-1358.093) (-1344.536) [-1341.588] (-1342.672) -- 0:02:38
Average standard deviation of split frequencies: 0.013752
380500 -- [-1336.766] (-1347.729) (-1341.400) (-1343.043) * (-1344.406) (-1341.375) (-1353.725) [-1339.415] -- 0:02:39
381000 -- (-1349.541) (-1356.362) (-1330.880) [-1331.043] * (-1336.387) (-1331.887) (-1337.909) [-1313.917] -- 0:02:39
381500 -- (-1333.584) (-1346.081) [-1334.680] (-1338.791) * (-1336.500) (-1344.684) (-1340.273) [-1319.023] -- 0:02:38
382000 -- [-1335.519] (-1350.752) (-1345.205) (-1354.618) * [-1330.704] (-1343.751) (-1348.394) (-1321.010) -- 0:02:38
382500 -- [-1341.576] (-1340.444) (-1339.174) (-1350.699) * (-1338.635) (-1346.127) (-1336.427) [-1322.519] -- 0:02:38
383000 -- (-1341.823) (-1344.896) [-1334.699] (-1339.705) * (-1341.356) (-1341.145) (-1349.853) [-1337.462] -- 0:02:37
383500 -- (-1346.240) (-1345.030) (-1346.118) [-1334.459] * (-1341.411) (-1340.255) (-1338.615) [-1330.441] -- 0:02:37
384000 -- (-1354.511) (-1347.531) (-1347.414) [-1344.886] * (-1336.100) (-1337.411) (-1353.774) [-1328.951] -- 0:02:37
384500 -- (-1362.829) (-1327.541) [-1327.905] (-1334.663) * (-1344.673) [-1328.072] (-1341.425) (-1338.669) -- 0:02:38
385000 -- (-1340.056) (-1330.166) [-1333.653] (-1347.653) * (-1306.152) (-1350.349) (-1346.550) [-1335.661] -- 0:02:38
Average standard deviation of split frequencies: 0.013434
385500 -- (-1339.240) (-1330.453) [-1327.627] (-1342.038) * [-1322.606] (-1330.528) (-1340.809) (-1352.828) -- 0:02:37
386000 -- (-1345.446) (-1329.470) [-1320.485] (-1337.566) * (-1333.941) (-1339.426) [-1339.731] (-1345.985) -- 0:02:37
386500 -- (-1346.445) [-1328.231] (-1335.504) (-1350.052) * (-1349.786) [-1337.523] (-1328.036) (-1344.787) -- 0:02:37
387000 -- (-1345.857) [-1329.842] (-1340.777) (-1353.230) * (-1345.934) (-1337.738) (-1350.605) [-1344.256] -- 0:02:36
387500 -- [-1330.715] (-1344.548) (-1334.198) (-1349.934) * (-1344.181) (-1344.311) [-1331.949] (-1349.529) -- 0:02:36
388000 -- [-1332.038] (-1349.219) (-1351.724) (-1345.480) * (-1352.444) [-1338.975] (-1334.656) (-1343.925) -- 0:02:36
388500 -- [-1342.555] (-1339.220) (-1348.080) (-1343.650) * (-1345.406) (-1340.889) [-1325.838] (-1341.730) -- 0:02:37
389000 -- (-1332.390) (-1354.780) [-1338.073] (-1346.160) * (-1350.796) (-1337.576) [-1330.909] (-1343.766) -- 0:02:37
389500 -- [-1328.396] (-1346.154) (-1333.497) (-1350.264) * (-1338.387) [-1323.450] (-1342.223) (-1339.940) -- 0:02:36
390000 -- [-1326.342] (-1351.836) (-1345.429) (-1352.462) * (-1344.646) (-1331.906) (-1340.968) [-1332.396] -- 0:02:36
Average standard deviation of split frequencies: 0.013810
390500 -- (-1335.725) [-1343.440] (-1345.824) (-1346.667) * (-1345.342) [-1330.742] (-1352.715) (-1349.735) -- 0:02:36
391000 -- [-1334.716] (-1341.123) (-1343.472) (-1344.972) * (-1352.075) (-1340.907) (-1344.933) [-1344.280] -- 0:02:35
391500 -- (-1326.158) [-1331.934] (-1348.669) (-1344.300) * (-1346.974) (-1342.268) [-1342.976] (-1344.413) -- 0:02:35
392000 -- [-1324.140] (-1323.282) (-1348.357) (-1352.574) * (-1341.074) (-1331.596) [-1339.813] (-1338.449) -- 0:02:35
392500 -- (-1328.828) (-1340.237) [-1332.662] (-1362.707) * (-1343.701) [-1326.669] (-1349.403) (-1345.660) -- 0:02:36
393000 -- (-1342.064) [-1337.935] (-1340.647) (-1352.228) * [-1326.381] (-1339.500) (-1343.615) (-1347.056) -- 0:02:35
393500 -- (-1341.980) (-1338.705) [-1323.544] (-1352.318) * [-1331.885] (-1348.515) (-1346.504) (-1342.098) -- 0:02:35
394000 -- (-1345.820) (-1331.134) [-1334.532] (-1339.415) * (-1334.611) [-1319.237] (-1349.683) (-1356.087) -- 0:02:35
394500 -- (-1344.373) (-1345.120) [-1337.441] (-1344.650) * (-1342.375) [-1341.516] (-1342.932) (-1347.048) -- 0:02:35
395000 -- (-1343.347) (-1356.341) (-1333.071) [-1340.875] * (-1339.462) [-1331.800] (-1341.298) (-1359.259) -- 0:02:34
Average standard deviation of split frequencies: 0.012896
395500 -- (-1349.029) [-1334.990] (-1337.392) (-1343.643) * (-1343.033) [-1329.434] (-1343.606) (-1344.407) -- 0:02:34
396000 -- (-1345.473) (-1337.851) [-1340.468] (-1345.378) * (-1336.805) [-1333.940] (-1341.645) (-1337.427) -- 0:02:34
396500 -- (-1351.884) [-1331.239] (-1335.987) (-1350.577) * (-1342.413) [-1334.224] (-1337.417) (-1336.098) -- 0:02:35
397000 -- (-1342.412) (-1345.742) (-1340.083) [-1336.143] * (-1351.817) (-1319.468) [-1342.192] (-1353.369) -- 0:02:34
397500 -- (-1356.538) [-1331.411] (-1338.903) (-1340.560) * (-1348.235) [-1321.344] (-1342.879) (-1348.050) -- 0:02:34
398000 -- (-1342.240) [-1322.663] (-1347.919) (-1347.584) * (-1341.680) (-1340.794) [-1338.050] (-1352.982) -- 0:02:34
398500 -- [-1336.739] (-1313.318) (-1338.073) (-1360.194) * (-1357.791) (-1341.885) [-1335.060] (-1339.192) -- 0:02:33
399000 -- (-1348.200) (-1316.777) (-1339.239) [-1335.331] * (-1344.900) (-1352.908) (-1338.003) [-1346.434] -- 0:02:33
399500 -- (-1337.559) [-1324.257] (-1340.807) (-1359.963) * (-1350.433) (-1354.947) [-1331.096] (-1339.196) -- 0:02:33
400000 -- [-1319.945] (-1341.116) (-1335.409) (-1351.713) * (-1346.862) [-1346.598] (-1338.435) (-1344.064) -- 0:02:34
Average standard deviation of split frequencies: 0.014119
400500 -- [-1316.797] (-1349.613) (-1340.374) (-1347.802) * (-1337.368) (-1334.450) [-1341.530] (-1344.931) -- 0:02:34
401000 -- [-1317.940] (-1343.554) (-1339.893) (-1340.316) * (-1344.950) (-1351.042) [-1338.101] (-1339.561) -- 0:02:33
401500 -- [-1322.700] (-1341.786) (-1341.765) (-1339.684) * (-1345.908) [-1329.393] (-1330.778) (-1338.238) -- 0:02:33
402000 -- [-1322.294] (-1356.870) (-1340.560) (-1341.676) * (-1347.946) (-1337.181) [-1340.788] (-1336.638) -- 0:02:33
402500 -- (-1347.051) (-1347.709) [-1333.170] (-1356.027) * (-1348.962) (-1335.096) (-1343.526) [-1328.292] -- 0:02:32
403000 -- (-1336.342) (-1335.681) [-1332.891] (-1351.287) * (-1336.932) (-1345.025) (-1351.114) [-1343.390] -- 0:02:32
403500 -- [-1325.358] (-1337.321) (-1349.666) (-1351.514) * [-1337.100] (-1331.728) (-1350.984) (-1341.779) -- 0:02:32
404000 -- (-1340.684) [-1343.978] (-1332.466) (-1340.556) * (-1339.901) (-1340.748) [-1330.496] (-1349.131) -- 0:02:33
404500 -- [-1343.688] (-1335.572) (-1347.675) (-1345.808) * (-1349.389) (-1339.274) [-1324.400] (-1352.931) -- 0:02:33
405000 -- (-1347.355) [-1325.322] (-1342.672) (-1345.090) * (-1341.772) (-1337.311) [-1319.687] (-1344.155) -- 0:02:32
Average standard deviation of split frequencies: 0.014127
405500 -- (-1339.260) [-1329.960] (-1343.421) (-1342.429) * (-1344.078) (-1342.070) [-1338.129] (-1338.884) -- 0:02:32
406000 -- [-1342.409] (-1345.140) (-1322.916) (-1363.853) * (-1338.041) (-1351.361) [-1321.699] (-1341.419) -- 0:02:32
406500 -- (-1350.181) (-1335.542) [-1324.331] (-1346.956) * (-1340.567) (-1353.650) [-1320.487] (-1346.003) -- 0:02:31
407000 -- (-1345.612) (-1340.842) [-1337.991] (-1346.281) * (-1344.178) (-1343.383) [-1317.480] (-1345.936) -- 0:02:31
407500 -- (-1339.746) (-1344.224) [-1331.575] (-1348.201) * (-1345.645) (-1341.006) [-1337.181] (-1346.559) -- 0:02:31
408000 -- (-1335.588) (-1345.359) (-1336.130) [-1330.171] * (-1344.590) [-1325.414] (-1342.655) (-1335.600) -- 0:02:32
408500 -- (-1349.426) (-1347.064) [-1333.526] (-1322.509) * (-1350.376) [-1332.566] (-1348.470) (-1352.104) -- 0:02:32
409000 -- (-1344.852) (-1343.345) [-1329.261] (-1334.222) * (-1348.001) [-1329.624] (-1339.456) (-1344.922) -- 0:02:31
409500 -- (-1336.948) (-1349.183) [-1328.258] (-1354.594) * (-1355.986) (-1353.572) [-1328.842] (-1342.806) -- 0:02:31
410000 -- [-1336.590] (-1330.464) (-1339.123) (-1341.104) * (-1344.416) (-1344.935) [-1330.833] (-1337.954) -- 0:02:31
Average standard deviation of split frequencies: 0.013520
410500 -- [-1336.869] (-1343.743) (-1348.352) (-1342.079) * (-1349.176) (-1344.066) [-1338.005] (-1346.261) -- 0:02:30
411000 -- (-1341.317) (-1350.847) (-1348.880) [-1325.328] * (-1350.133) (-1342.447) (-1328.858) [-1338.991] -- 0:02:30
411500 -- (-1347.670) (-1343.013) (-1342.294) [-1337.733] * (-1341.519) (-1342.058) [-1324.666] (-1337.817) -- 0:02:30
412000 -- (-1349.161) (-1356.008) (-1345.164) [-1326.705] * (-1341.606) (-1340.107) [-1323.835] (-1339.144) -- 0:02:31
412500 -- (-1347.120) (-1341.264) (-1341.954) [-1329.684] * (-1348.887) (-1343.733) [-1322.675] (-1348.965) -- 0:02:30
413000 -- [-1339.343] (-1344.862) (-1345.637) (-1343.377) * (-1355.414) (-1338.637) [-1313.927] (-1339.299) -- 0:02:30
413500 -- [-1328.234] (-1353.464) (-1338.293) (-1339.501) * (-1339.875) (-1345.907) [-1313.192] (-1337.507) -- 0:02:30
414000 -- [-1325.538] (-1345.625) (-1350.926) (-1346.124) * (-1339.210) [-1342.664] (-1332.511) (-1336.751) -- 0:02:30
414500 -- (-1332.303) (-1340.854) [-1342.716] (-1346.358) * (-1356.778) (-1338.358) [-1339.186] (-1344.781) -- 0:02:29
415000 -- [-1322.022] (-1340.182) (-1332.665) (-1342.238) * (-1356.628) (-1324.350) [-1333.648] (-1350.975) -- 0:02:29
Average standard deviation of split frequencies: 0.012048
415500 -- (-1345.893) (-1332.588) [-1337.378] (-1340.426) * [-1342.342] (-1334.139) (-1335.401) (-1347.806) -- 0:02:29
416000 -- (-1340.702) (-1345.920) (-1347.804) [-1342.756] * (-1343.153) [-1342.878] (-1344.194) (-1354.160) -- 0:02:30
416500 -- (-1348.080) (-1338.489) (-1348.715) [-1340.349] * (-1360.448) (-1337.617) [-1343.078] (-1348.013) -- 0:02:29
417000 -- (-1354.812) (-1349.716) [-1349.058] (-1346.416) * (-1340.474) [-1330.762] (-1348.310) (-1342.035) -- 0:02:29
417500 -- (-1352.602) (-1342.255) [-1339.173] (-1337.164) * (-1342.926) [-1338.019] (-1354.693) (-1336.550) -- 0:02:29
418000 -- (-1349.481) [-1342.213] (-1347.527) (-1346.438) * (-1339.521) [-1324.662] (-1360.966) (-1336.986) -- 0:02:28
418500 -- (-1344.818) (-1356.410) [-1335.856] (-1338.778) * (-1344.056) (-1333.068) (-1343.699) [-1320.360] -- 0:02:28
419000 -- (-1342.684) (-1343.264) (-1346.428) [-1345.576] * (-1340.393) (-1333.311) (-1347.746) [-1330.955] -- 0:02:28
419500 -- [-1338.706] (-1348.516) (-1338.298) (-1350.215) * (-1335.047) [-1336.749] (-1350.331) (-1338.503) -- 0:02:28
420000 -- (-1348.424) (-1344.725) [-1325.148] (-1342.323) * (-1334.586) [-1334.070] (-1354.831) (-1345.213) -- 0:02:29
Average standard deviation of split frequencies: 0.012150
420500 -- (-1342.827) (-1350.764) (-1341.472) [-1328.991] * [-1316.301] (-1338.976) (-1360.843) (-1351.187) -- 0:02:28
421000 -- (-1344.047) (-1340.224) (-1340.959) [-1335.678] * [-1324.870] (-1346.597) (-1343.191) (-1347.255) -- 0:02:28
421500 -- [-1345.773] (-1342.018) (-1338.790) (-1342.605) * [-1316.925] (-1344.932) (-1342.552) (-1338.316) -- 0:02:28
422000 -- (-1341.067) (-1343.026) [-1337.541] (-1352.394) * [-1308.757] (-1341.724) (-1343.778) (-1354.888) -- 0:02:27
422500 -- (-1346.461) (-1345.729) (-1350.831) [-1347.236] * [-1322.464] (-1345.765) (-1349.567) (-1344.507) -- 0:02:27
423000 -- (-1346.416) (-1337.938) (-1346.434) [-1335.595] * [-1334.478] (-1350.214) (-1348.288) (-1336.032) -- 0:02:27
423500 -- (-1352.498) (-1343.558) (-1355.736) [-1336.580] * [-1317.986] (-1349.852) (-1350.294) (-1354.423) -- 0:02:28
424000 -- (-1346.434) (-1344.554) (-1348.543) [-1332.599] * [-1343.988] (-1336.044) (-1347.965) (-1345.380) -- 0:02:28
424500 -- (-1350.119) (-1343.333) [-1333.767] (-1341.223) * (-1342.352) [-1314.173] (-1341.088) (-1347.699) -- 0:02:27
425000 -- (-1347.572) (-1340.447) [-1345.713] (-1341.000) * (-1349.303) [-1331.835] (-1345.217) (-1337.369) -- 0:02:27
Average standard deviation of split frequencies: 0.013163
425500 -- (-1352.766) [-1338.429] (-1352.166) (-1341.772) * (-1346.053) (-1335.166) (-1345.215) [-1309.731] -- 0:02:27
426000 -- (-1338.084) [-1335.165] (-1337.678) (-1339.037) * [-1324.448] (-1334.906) (-1345.700) (-1341.088) -- 0:02:26
426500 -- (-1343.293) (-1344.423) [-1343.769] (-1355.490) * (-1338.784) (-1341.962) (-1354.265) [-1323.414] -- 0:02:26
427000 -- (-1335.397) (-1349.404) [-1342.362] (-1361.408) * (-1344.350) (-1340.587) (-1344.935) [-1326.739] -- 0:02:26
427500 -- [-1331.582] (-1347.126) (-1350.496) (-1345.860) * (-1345.914) (-1333.572) (-1347.024) [-1321.996] -- 0:02:27
428000 -- [-1341.071] (-1347.393) (-1341.235) (-1349.445) * (-1343.916) (-1351.154) (-1352.406) [-1320.180] -- 0:02:27
428500 -- (-1344.024) [-1333.704] (-1345.559) (-1353.996) * (-1329.952) (-1333.002) (-1347.233) [-1317.779] -- 0:02:26
429000 -- (-1348.684) (-1342.433) [-1344.936] (-1348.308) * (-1339.770) (-1341.313) (-1349.347) [-1330.986] -- 0:02:26
429500 -- [-1340.874] (-1339.682) (-1341.651) (-1349.718) * (-1339.254) (-1343.510) (-1358.474) [-1337.467] -- 0:02:26
430000 -- [-1322.670] (-1348.933) (-1346.831) (-1350.868) * (-1331.818) [-1338.361] (-1358.505) (-1355.223) -- 0:02:25
Average standard deviation of split frequencies: 0.013596
430500 -- [-1326.000] (-1332.365) (-1346.047) (-1349.177) * (-1341.985) [-1343.290] (-1352.291) (-1341.288) -- 0:02:25
431000 -- [-1338.450] (-1340.159) (-1350.855) (-1338.992) * (-1346.912) [-1325.083] (-1346.604) (-1347.251) -- 0:02:25
431500 -- (-1340.807) [-1348.678] (-1342.832) (-1343.059) * (-1340.880) [-1331.602] (-1339.421) (-1347.465) -- 0:02:26
432000 -- (-1339.786) (-1336.463) (-1337.379) [-1340.001] * (-1344.442) [-1337.667] (-1332.867) (-1352.107) -- 0:02:25
432500 -- (-1352.279) (-1335.895) (-1344.372) [-1337.818] * [-1335.489] (-1328.190) (-1330.024) (-1346.734) -- 0:02:25
433000 -- (-1345.695) [-1314.760] (-1336.455) (-1345.206) * (-1343.562) (-1334.662) [-1326.706] (-1345.852) -- 0:02:25
433500 -- (-1352.862) [-1318.356] (-1351.085) (-1352.770) * (-1354.737) [-1332.798] (-1326.540) (-1348.674) -- 0:02:25
434000 -- [-1344.018] (-1344.630) (-1341.528) (-1333.840) * (-1352.262) [-1345.497] (-1337.149) (-1357.744) -- 0:02:24
434500 -- [-1322.167] (-1335.088) (-1349.903) (-1341.131) * [-1329.708] (-1347.211) (-1342.959) (-1341.383) -- 0:02:24
435000 -- (-1352.079) (-1346.489) (-1353.532) [-1342.240] * [-1311.219] (-1345.911) (-1348.930) (-1348.527) -- 0:02:24
Average standard deviation of split frequencies: 0.014454
435500 -- (-1345.043) (-1347.304) [-1346.073] (-1352.674) * [-1313.212] (-1341.465) (-1355.937) (-1349.086) -- 0:02:25
436000 -- (-1337.273) (-1355.546) (-1349.088) [-1334.199] * (-1335.110) (-1339.582) (-1351.308) [-1340.251] -- 0:02:24
436500 -- (-1336.011) [-1333.037] (-1352.871) (-1348.506) * (-1343.383) (-1347.155) (-1342.919) [-1321.743] -- 0:02:24
437000 -- [-1338.458] (-1339.225) (-1348.639) (-1338.818) * [-1331.770] (-1344.621) (-1343.950) (-1342.783) -- 0:02:24
437500 -- (-1346.705) (-1345.542) (-1334.380) [-1340.956] * (-1324.205) (-1339.736) [-1334.191] (-1349.090) -- 0:02:24
438000 -- (-1341.144) (-1343.148) [-1328.353] (-1349.589) * (-1345.102) (-1331.858) (-1344.991) [-1339.186] -- 0:02:23
438500 -- (-1345.699) (-1340.310) [-1328.475] (-1349.797) * (-1350.796) (-1341.415) [-1317.653] (-1340.897) -- 0:02:23
439000 -- (-1344.201) (-1340.582) [-1318.718] (-1336.238) * (-1345.910) (-1335.834) [-1318.012] (-1338.078) -- 0:02:24
439500 -- (-1341.312) (-1338.881) [-1319.552] (-1343.618) * (-1363.289) (-1338.354) (-1346.039) [-1338.846] -- 0:02:24
440000 -- (-1336.834) (-1344.542) (-1342.070) [-1323.817] * (-1339.569) (-1345.700) (-1342.501) [-1335.142] -- 0:02:23
Average standard deviation of split frequencies: 0.013400
440500 -- (-1337.960) (-1343.665) (-1339.182) [-1320.055] * (-1342.792) (-1341.469) (-1344.764) [-1331.888] -- 0:02:23
441000 -- (-1339.345) (-1341.844) (-1347.091) [-1324.064] * [-1341.552] (-1327.184) (-1355.823) (-1340.397) -- 0:02:23
441500 -- (-1340.205) (-1344.087) [-1324.337] (-1352.964) * (-1339.671) (-1339.812) (-1342.517) [-1345.018] -- 0:02:22
442000 -- (-1348.416) (-1345.639) [-1335.855] (-1347.441) * [-1336.739] (-1340.147) (-1342.526) (-1345.040) -- 0:02:22
442500 -- [-1340.217] (-1349.050) (-1337.562) (-1343.885) * (-1333.294) [-1351.788] (-1342.846) (-1350.584) -- 0:02:22
443000 -- (-1343.892) (-1354.544) [-1319.666] (-1349.457) * [-1332.677] (-1341.570) (-1341.237) (-1349.426) -- 0:02:23
443500 -- (-1350.123) (-1343.584) [-1328.205] (-1333.027) * [-1332.376] (-1348.939) (-1348.472) (-1348.622) -- 0:02:23
444000 -- (-1341.387) (-1346.199) (-1341.024) [-1336.726] * [-1336.944] (-1355.629) (-1344.459) (-1344.806) -- 0:02:22
444500 -- [-1339.806] (-1340.061) (-1340.386) (-1335.209) * [-1322.223] (-1345.477) (-1348.455) (-1351.834) -- 0:02:22
445000 -- (-1347.602) [-1343.095] (-1350.182) (-1338.782) * (-1328.514) (-1355.159) (-1346.531) [-1343.464] -- 0:02:22
Average standard deviation of split frequencies: 0.013240
445500 -- [-1337.625] (-1346.317) (-1350.954) (-1338.158) * (-1331.807) [-1339.476] (-1359.427) (-1352.155) -- 0:02:21
446000 -- (-1338.581) (-1363.382) (-1351.464) [-1333.332] * [-1330.364] (-1338.748) (-1349.732) (-1339.954) -- 0:02:21
446500 -- [-1345.729] (-1343.489) (-1347.395) (-1345.242) * [-1331.263] (-1352.962) (-1344.150) (-1344.768) -- 0:02:21
447000 -- (-1347.041) (-1339.816) [-1334.476] (-1340.246) * (-1346.164) (-1348.696) (-1342.429) [-1329.414] -- 0:02:22
447500 -- (-1340.563) (-1342.996) (-1345.378) [-1347.528] * (-1349.477) (-1351.487) (-1345.909) [-1333.125] -- 0:02:21
448000 -- (-1338.590) (-1352.312) [-1346.246] (-1345.615) * (-1355.167) (-1345.206) (-1334.508) [-1345.210] -- 0:02:21
448500 -- [-1341.684] (-1342.053) (-1347.634) (-1346.890) * [-1337.562] (-1360.711) (-1333.937) (-1342.809) -- 0:02:21
449000 -- [-1329.969] (-1347.972) (-1331.478) (-1336.398) * (-1346.066) (-1342.121) [-1337.144] (-1329.871) -- 0:02:21
449500 -- [-1305.246] (-1337.674) (-1341.844) (-1338.308) * (-1337.211) (-1355.735) [-1336.299] (-1338.903) -- 0:02:20
450000 -- [-1323.985] (-1338.067) (-1345.672) (-1348.150) * (-1341.738) [-1341.956] (-1344.027) (-1342.476) -- 0:02:20
Average standard deviation of split frequencies: 0.013598
450500 -- [-1324.545] (-1342.126) (-1334.757) (-1346.527) * (-1340.456) (-1343.524) [-1340.671] (-1336.945) -- 0:02:20
451000 -- (-1347.202) [-1330.688] (-1345.193) (-1339.536) * [-1336.258] (-1350.222) (-1323.618) (-1344.062) -- 0:02:21
451500 -- (-1341.023) (-1339.953) (-1348.846) [-1342.866] * (-1346.884) (-1347.504) [-1334.921] (-1336.184) -- 0:02:20
452000 -- (-1348.987) [-1307.966] (-1337.738) (-1335.945) * (-1342.552) (-1343.571) [-1322.516] (-1349.762) -- 0:02:20
452500 -- (-1345.532) [-1313.595] (-1343.107) (-1337.570) * (-1332.445) (-1345.226) [-1321.519] (-1335.899) -- 0:02:20
453000 -- (-1344.148) [-1314.560] (-1351.896) (-1339.697) * (-1326.238) (-1340.789) [-1342.489] (-1356.661) -- 0:02:20
453500 -- (-1363.149) [-1335.524] (-1341.070) (-1344.657) * (-1345.758) (-1349.523) [-1338.516] (-1336.741) -- 0:02:19
454000 -- (-1354.380) [-1327.763] (-1337.933) (-1340.515) * (-1354.007) (-1344.536) [-1337.285] (-1348.632) -- 0:02:19
454500 -- (-1346.513) [-1321.687] (-1350.934) (-1333.398) * (-1348.722) [-1325.903] (-1352.865) (-1350.432) -- 0:02:19
455000 -- [-1328.026] (-1336.399) (-1349.137) (-1344.156) * (-1331.146) [-1325.266] (-1344.049) (-1344.623) -- 0:02:20
Average standard deviation of split frequencies: 0.013841
455500 -- [-1325.595] (-1326.598) (-1349.854) (-1341.557) * [-1342.329] (-1323.640) (-1346.797) (-1350.759) -- 0:02:19
456000 -- (-1332.643) (-1331.198) (-1344.677) [-1328.878] * (-1352.066) [-1322.412] (-1340.363) (-1354.708) -- 0:02:19
456500 -- (-1347.286) (-1336.741) [-1338.706] (-1340.318) * (-1341.628) [-1326.535] (-1344.750) (-1349.539) -- 0:02:19
457000 -- [-1339.408] (-1343.501) (-1341.330) (-1351.425) * (-1341.551) [-1344.044] (-1342.672) (-1343.822) -- 0:02:19
457500 -- (-1337.731) [-1329.524] (-1340.149) (-1347.110) * (-1349.597) [-1340.993] (-1345.761) (-1344.446) -- 0:02:18
458000 -- [-1324.550] (-1340.045) (-1344.280) (-1347.600) * (-1339.880) [-1333.353] (-1343.093) (-1352.054) -- 0:02:18
458500 -- [-1323.732] (-1340.703) (-1347.010) (-1350.875) * (-1337.969) [-1338.162] (-1344.836) (-1353.694) -- 0:02:18
459000 -- (-1348.885) (-1333.448) [-1317.609] (-1327.075) * (-1347.472) (-1332.321) [-1338.911] (-1355.198) -- 0:02:19
459500 -- (-1340.642) (-1339.107) [-1326.303] (-1340.004) * (-1340.498) [-1338.232] (-1336.057) (-1352.181) -- 0:02:18
460000 -- (-1359.319) [-1329.066] (-1337.488) (-1330.252) * (-1337.225) (-1339.489) [-1334.396] (-1343.443) -- 0:02:18
Average standard deviation of split frequencies: 0.012740
460500 -- (-1349.662) [-1324.216] (-1343.375) (-1343.714) * (-1339.714) [-1332.191] (-1335.617) (-1349.304) -- 0:02:18
461000 -- (-1343.332) [-1324.889] (-1346.087) (-1341.316) * (-1336.007) [-1330.345] (-1349.067) (-1350.363) -- 0:02:17
461500 -- [-1320.346] (-1353.220) (-1342.865) (-1330.519) * (-1333.862) [-1322.316] (-1349.698) (-1360.450) -- 0:02:17
462000 -- (-1351.978) (-1331.785) (-1334.608) [-1325.455] * (-1342.081) [-1323.868] (-1346.650) (-1345.543) -- 0:02:17
462500 -- (-1338.581) (-1349.551) (-1346.402) [-1331.663] * (-1350.651) (-1340.194) (-1344.718) [-1341.672] -- 0:02:17
463000 -- (-1341.350) [-1337.100] (-1358.167) (-1336.257) * (-1351.411) [-1326.262] (-1343.099) (-1347.840) -- 0:02:18
463500 -- (-1343.500) (-1351.023) [-1322.476] (-1344.973) * (-1345.512) [-1341.227] (-1356.018) (-1347.183) -- 0:02:17
464000 -- (-1336.379) (-1350.638) (-1327.381) [-1327.918] * (-1355.103) (-1341.410) [-1341.307] (-1340.717) -- 0:02:17
464500 -- (-1341.462) [-1344.602] (-1342.836) (-1350.620) * (-1343.591) (-1351.414) [-1337.427] (-1343.186) -- 0:02:17
465000 -- (-1325.142) (-1361.352) [-1328.378] (-1350.115) * [-1320.590] (-1346.633) (-1335.356) (-1349.849) -- 0:02:16
Average standard deviation of split frequencies: 0.011886
465500 -- (-1341.011) [-1340.317] (-1331.731) (-1344.030) * (-1326.091) (-1342.284) [-1338.601] (-1348.939) -- 0:02:16
466000 -- (-1324.854) [-1313.500] (-1348.334) (-1339.556) * [-1333.844] (-1341.483) (-1330.931) (-1345.503) -- 0:02:16
466500 -- (-1357.254) [-1306.326] (-1339.926) (-1340.408) * (-1335.717) (-1346.836) (-1334.946) [-1339.139] -- 0:02:16
467000 -- (-1337.398) (-1335.098) [-1334.998] (-1344.174) * (-1345.346) (-1347.816) (-1349.263) [-1330.964] -- 0:02:16
467500 -- (-1347.090) (-1339.099) (-1337.256) [-1339.804] * (-1338.857) (-1353.134) (-1348.168) [-1341.963] -- 0:02:16
468000 -- (-1336.579) (-1340.189) [-1339.014] (-1343.419) * (-1352.779) (-1342.177) [-1333.028] (-1350.195) -- 0:02:16
468500 -- (-1340.311) (-1341.626) [-1326.978] (-1346.393) * (-1351.059) (-1354.718) (-1337.220) [-1334.700] -- 0:02:16
469000 -- (-1362.388) (-1328.262) [-1323.749] (-1338.110) * (-1341.830) (-1342.272) (-1336.526) [-1334.502] -- 0:02:15
469500 -- (-1348.707) (-1343.303) (-1340.458) [-1335.864] * (-1345.744) (-1343.870) (-1346.003) [-1332.633] -- 0:02:15
470000 -- [-1344.482] (-1345.996) (-1344.385) (-1345.528) * (-1355.414) (-1344.765) (-1343.317) [-1336.492] -- 0:02:15
Average standard deviation of split frequencies: 0.012388
470500 -- (-1347.887) [-1337.958] (-1345.722) (-1338.710) * (-1349.417) (-1350.826) [-1340.244] (-1342.191) -- 0:02:16
471000 -- (-1348.750) [-1332.493] (-1348.571) (-1346.011) * (-1340.393) (-1342.083) [-1335.176] (-1345.057) -- 0:02:15
471500 -- (-1345.492) [-1332.184] (-1341.123) (-1345.669) * (-1345.942) [-1338.908] (-1352.876) (-1345.105) -- 0:02:15
472000 -- (-1341.349) [-1328.706] (-1355.663) (-1337.682) * (-1346.915) [-1329.429] (-1349.062) (-1336.434) -- 0:02:15
472500 -- (-1348.959) (-1330.271) [-1325.472] (-1351.170) * (-1344.560) (-1342.692) (-1346.633) [-1321.904] -- 0:02:15
473000 -- (-1337.895) [-1335.258] (-1337.980) (-1349.085) * (-1339.706) [-1330.781] (-1354.783) (-1336.812) -- 0:02:14
473500 -- [-1326.801] (-1349.471) (-1343.549) (-1341.281) * (-1341.501) (-1347.014) [-1335.839] (-1339.202) -- 0:02:14
474000 -- [-1338.179] (-1341.214) (-1356.159) (-1340.966) * (-1346.089) (-1341.480) (-1345.342) [-1328.258] -- 0:02:14
474500 -- [-1344.242] (-1344.286) (-1347.567) (-1343.989) * (-1350.031) (-1337.254) (-1347.797) [-1318.932] -- 0:02:15
475000 -- (-1340.719) (-1350.715) (-1347.696) [-1344.609] * (-1341.620) (-1347.083) (-1338.043) [-1321.267] -- 0:02:14
Average standard deviation of split frequencies: 0.011994
475500 -- (-1351.772) (-1349.444) (-1348.423) [-1312.651] * (-1339.629) (-1344.003) (-1355.181) [-1319.954] -- 0:02:14
476000 -- (-1343.037) (-1356.413) (-1334.636) [-1323.544] * (-1345.718) [-1335.891] (-1344.030) (-1339.904) -- 0:02:14
476500 -- [-1330.177] (-1354.464) (-1333.421) (-1340.423) * (-1350.399) (-1348.947) [-1342.533] (-1351.175) -- 0:02:14
477000 -- [-1334.253] (-1339.936) (-1351.368) (-1326.745) * (-1344.369) (-1332.434) (-1343.763) [-1323.783] -- 0:02:13
477500 -- (-1314.601) (-1340.560) (-1351.167) [-1323.273] * (-1338.755) (-1345.053) (-1343.579) [-1323.020] -- 0:02:13
478000 -- [-1311.617] (-1327.623) (-1345.751) (-1332.612) * (-1338.239) (-1345.585) (-1344.537) [-1338.432] -- 0:02:13
478500 -- (-1329.502) (-1334.951) [-1326.959] (-1344.019) * [-1324.530] (-1345.111) (-1343.221) (-1350.429) -- 0:02:14
479000 -- [-1309.142] (-1339.337) (-1338.265) (-1343.412) * [-1323.689] (-1349.962) (-1346.460) (-1339.216) -- 0:02:13
479500 -- (-1333.503) (-1343.074) (-1339.130) [-1335.876] * (-1329.014) [-1339.434] (-1341.579) (-1332.527) -- 0:02:13
480000 -- [-1340.808] (-1347.275) (-1345.418) (-1334.117) * [-1329.464] (-1330.166) (-1344.071) (-1349.356) -- 0:02:13
Average standard deviation of split frequencies: 0.011562
480500 -- (-1351.024) (-1340.404) (-1356.353) [-1323.529] * [-1350.491] (-1341.751) (-1343.696) (-1334.825) -- 0:02:12
481000 -- [-1342.287] (-1349.182) (-1342.657) (-1344.709) * [-1334.384] (-1347.426) (-1344.966) (-1323.066) -- 0:02:12
481500 -- (-1345.787) [-1337.999] (-1326.325) (-1345.679) * (-1332.462) (-1348.260) (-1345.778) [-1320.268] -- 0:02:12
482000 -- (-1362.478) (-1351.267) (-1343.798) [-1340.853] * [-1334.508] (-1348.624) (-1353.302) (-1345.407) -- 0:02:12
482500 -- (-1347.606) (-1355.025) [-1335.504] (-1344.759) * (-1327.042) (-1347.343) (-1340.647) [-1330.690] -- 0:02:12
483000 -- (-1345.726) (-1336.498) (-1351.999) [-1327.642] * [-1327.238] (-1346.677) (-1349.856) (-1339.021) -- 0:02:12
483500 -- (-1337.981) [-1325.284] (-1357.587) (-1337.286) * (-1346.339) (-1343.600) (-1346.221) [-1345.668] -- 0:02:12
484000 -- (-1340.242) (-1335.725) (-1345.759) [-1334.220] * (-1344.842) (-1343.310) [-1338.300] (-1337.053) -- 0:02:12
484500 -- (-1337.843) [-1325.057] (-1341.122) (-1349.715) * (-1341.114) (-1344.468) [-1336.090] (-1340.526) -- 0:02:11
485000 -- (-1329.034) [-1328.968] (-1352.116) (-1342.210) * [-1334.327] (-1350.809) (-1346.017) (-1341.234) -- 0:02:11
Average standard deviation of split frequencies: 0.011180
485500 -- [-1336.176] (-1340.496) (-1338.652) (-1343.564) * (-1339.697) (-1342.393) [-1336.418] (-1342.898) -- 0:02:11
486000 -- (-1343.661) (-1346.490) [-1342.810] (-1344.331) * (-1343.800) (-1346.564) [-1329.753] (-1351.524) -- 0:02:11
486500 -- [-1334.700] (-1343.663) (-1338.397) (-1350.625) * (-1340.505) (-1348.449) [-1332.553] (-1352.796) -- 0:02:11
487000 -- (-1341.224) [-1345.196] (-1347.282) (-1335.763) * (-1347.901) (-1347.111) [-1329.652] (-1338.390) -- 0:02:11
487500 -- [-1321.259] (-1344.383) (-1354.240) (-1353.248) * (-1347.642) (-1345.383) [-1323.315] (-1332.044) -- 0:02:11
488000 -- [-1320.858] (-1343.484) (-1358.176) (-1341.329) * (-1351.187) (-1343.097) [-1333.865] (-1328.817) -- 0:02:11
488500 -- [-1318.586] (-1344.584) (-1341.713) (-1335.395) * (-1352.903) (-1340.507) [-1316.485] (-1336.899) -- 0:02:10
489000 -- [-1339.263] (-1345.402) (-1346.782) (-1353.283) * (-1337.060) (-1340.137) (-1332.623) [-1339.627] -- 0:02:10
489500 -- (-1333.910) (-1342.989) [-1335.884] (-1356.667) * (-1346.061) (-1344.160) (-1323.698) [-1338.565] -- 0:02:10
490000 -- [-1337.319] (-1341.969) (-1339.740) (-1353.787) * (-1329.954) (-1343.509) [-1329.916] (-1333.661) -- 0:02:10
Average standard deviation of split frequencies: 0.010973
490500 -- [-1336.398] (-1348.625) (-1351.745) (-1333.003) * (-1340.903) (-1334.645) (-1336.136) [-1325.635] -- 0:02:10
491000 -- (-1348.638) (-1337.308) (-1355.627) [-1340.749] * (-1337.953) (-1343.823) [-1333.132] (-1340.996) -- 0:02:10
491500 -- (-1342.164) (-1339.690) (-1348.034) [-1333.941] * (-1352.891) (-1336.293) [-1320.718] (-1337.056) -- 0:02:10
492000 -- (-1333.586) (-1346.597) (-1347.258) [-1327.790] * (-1345.912) (-1340.682) [-1316.435] (-1349.431) -- 0:02:10
492500 -- (-1338.373) (-1345.551) (-1344.920) [-1333.525] * (-1333.794) (-1343.574) (-1350.548) [-1342.917] -- 0:02:09
493000 -- (-1343.169) [-1334.494] (-1354.708) (-1333.308) * [-1313.679] (-1346.067) (-1351.529) (-1327.724) -- 0:02:09
493500 -- (-1349.630) (-1338.720) [-1346.994] (-1344.326) * [-1323.129] (-1341.206) (-1346.520) (-1343.234) -- 0:02:09
494000 -- (-1353.119) (-1343.956) (-1344.886) [-1339.931] * (-1344.593) (-1346.359) (-1335.378) [-1318.635] -- 0:02:10
494500 -- [-1342.890] (-1351.511) (-1347.027) (-1350.663) * [-1349.372] (-1354.441) (-1343.188) (-1350.377) -- 0:02:09
495000 -- (-1342.382) [-1330.223] (-1344.544) (-1354.472) * (-1353.609) [-1335.910] (-1347.214) (-1336.002) -- 0:02:09
Average standard deviation of split frequencies: 0.011405
495500 -- (-1349.019) (-1350.465) (-1352.868) [-1326.709] * (-1345.199) [-1337.813] (-1347.014) (-1334.489) -- 0:02:09
496000 -- (-1338.060) (-1343.750) (-1349.635) [-1328.804] * (-1355.107) (-1334.788) (-1351.102) [-1336.749] -- 0:02:09
496500 -- (-1344.900) [-1348.178] (-1336.300) (-1345.201) * (-1338.943) [-1339.364] (-1349.084) (-1344.448) -- 0:02:08
497000 -- (-1340.405) [-1336.512] (-1350.621) (-1316.140) * (-1342.108) (-1345.506) (-1334.395) [-1329.486] -- 0:02:08
497500 -- (-1350.551) (-1341.233) (-1348.547) [-1335.942] * [-1335.924] (-1341.922) (-1335.875) (-1345.832) -- 0:02:08
498000 -- (-1345.386) [-1337.115] (-1346.418) (-1337.819) * [-1334.425] (-1343.679) (-1335.516) (-1341.396) -- 0:02:09
498500 -- (-1337.008) [-1336.396] (-1343.673) (-1332.755) * (-1327.396) (-1335.651) [-1329.675] (-1340.072) -- 0:02:08
499000 -- (-1338.038) (-1346.269) (-1343.807) [-1339.971] * (-1346.974) [-1348.465] (-1331.423) (-1355.147) -- 0:02:08
499500 -- (-1350.058) (-1356.285) (-1349.280) [-1336.853] * [-1341.403] (-1345.411) (-1340.026) (-1341.781) -- 0:02:08
500000 -- (-1345.713) (-1347.118) (-1344.399) [-1333.828] * (-1348.459) [-1333.176] (-1339.805) (-1341.699) -- 0:02:08
Average standard deviation of split frequencies: 0.010828
500500 -- (-1344.146) (-1350.506) [-1344.462] (-1325.997) * (-1345.432) (-1349.105) [-1337.549] (-1338.921) -- 0:02:07
501000 -- (-1343.716) (-1345.944) (-1336.106) [-1326.314] * (-1351.113) [-1345.182] (-1333.476) (-1344.601) -- 0:02:07
501500 -- (-1350.866) (-1338.424) (-1332.792) [-1319.027] * [-1343.819] (-1338.537) (-1344.624) (-1355.015) -- 0:02:07
502000 -- (-1340.414) (-1344.292) [-1334.024] (-1328.361) * (-1356.564) (-1337.500) [-1338.595] (-1349.715) -- 0:02:07
502500 -- (-1342.591) (-1341.357) [-1332.505] (-1340.750) * (-1349.538) (-1345.328) [-1333.852] (-1341.116) -- 0:02:07
503000 -- (-1344.438) (-1335.583) [-1333.711] (-1341.094) * [-1323.372] (-1342.513) (-1338.117) (-1345.901) -- 0:02:07
503500 -- (-1339.897) (-1347.678) [-1341.658] (-1332.573) * [-1329.668] (-1340.934) (-1340.587) (-1343.446) -- 0:02:07
504000 -- [-1338.849] (-1347.614) (-1344.936) (-1337.684) * (-1335.995) (-1333.733) [-1333.712] (-1337.699) -- 0:02:06
504500 -- (-1343.867) [-1338.070] (-1355.177) (-1345.237) * (-1335.794) (-1344.708) (-1334.549) [-1319.441] -- 0:02:06
505000 -- (-1347.900) [-1338.201] (-1331.034) (-1340.069) * (-1335.475) (-1352.903) (-1338.705) [-1326.677] -- 0:02:06
Average standard deviation of split frequencies: 0.010765
505500 -- (-1355.526) (-1343.432) [-1345.009] (-1342.721) * (-1343.505) (-1341.876) (-1349.561) [-1316.530] -- 0:02:06
506000 -- (-1344.466) [-1342.185] (-1352.396) (-1351.551) * (-1346.769) (-1336.397) [-1338.841] (-1331.685) -- 0:02:06
506500 -- (-1336.615) (-1345.157) (-1344.866) [-1330.927] * (-1346.834) (-1346.952) (-1342.821) [-1323.178] -- 0:02:06
507000 -- [-1337.820] (-1343.695) (-1345.646) (-1354.179) * (-1366.919) (-1339.579) (-1349.211) [-1320.133] -- 0:02:06
507500 -- (-1333.526) (-1343.071) [-1334.941] (-1341.864) * (-1341.632) (-1337.606) (-1346.897) [-1317.434] -- 0:02:06
508000 -- [-1330.396] (-1350.475) (-1339.477) (-1345.002) * (-1339.779) (-1332.035) (-1344.672) [-1321.616] -- 0:02:05
508500 -- (-1340.613) [-1340.990] (-1347.942) (-1337.573) * (-1331.010) (-1341.877) (-1349.906) [-1322.414] -- 0:02:05
509000 -- (-1345.079) (-1338.401) (-1349.882) [-1332.384] * (-1346.272) (-1354.812) [-1327.382] (-1338.034) -- 0:02:05
509500 -- (-1331.154) (-1343.640) (-1348.358) [-1333.205] * (-1352.120) (-1330.685) [-1314.346] (-1341.813) -- 0:02:05
510000 -- [-1336.284] (-1344.809) (-1338.120) (-1323.951) * (-1343.671) (-1332.271) [-1325.843] (-1343.217) -- 0:02:05
Average standard deviation of split frequencies: 0.010462
510500 -- [-1343.831] (-1342.511) (-1347.019) (-1343.448) * (-1345.946) [-1326.184] (-1337.311) (-1351.049) -- 0:02:05
511000 -- (-1348.465) (-1348.362) (-1337.805) [-1333.807] * (-1348.843) [-1334.540] (-1344.288) (-1333.782) -- 0:02:05
511500 -- (-1353.967) (-1337.404) [-1340.388] (-1346.496) * (-1343.119) (-1342.882) (-1342.641) [-1323.518] -- 0:02:05
512000 -- [-1332.858] (-1329.904) (-1341.896) (-1351.500) * (-1367.122) (-1341.561) [-1331.043] (-1350.400) -- 0:02:04
512500 -- (-1348.748) [-1321.641] (-1344.535) (-1346.788) * (-1351.505) [-1331.499] (-1353.393) (-1338.912) -- 0:02:04
513000 -- (-1334.888) [-1327.137] (-1327.656) (-1357.148) * [-1352.751] (-1335.902) (-1344.819) (-1341.972) -- 0:02:04
513500 -- [-1336.888] (-1341.513) (-1343.808) (-1350.787) * (-1354.497) (-1335.915) (-1343.671) [-1330.479] -- 0:02:04
514000 -- [-1342.556] (-1343.830) (-1339.993) (-1355.979) * (-1350.160) (-1327.307) (-1351.013) [-1331.233] -- 0:02:04
514500 -- [-1318.172] (-1345.631) (-1353.905) (-1347.361) * (-1333.928) [-1318.937] (-1346.681) (-1341.576) -- 0:02:04
515000 -- [-1324.348] (-1332.779) (-1346.829) (-1348.685) * (-1343.407) [-1333.178] (-1342.469) (-1344.654) -- 0:02:04
Average standard deviation of split frequencies: 0.010405
515500 -- [-1325.631] (-1343.898) (-1337.982) (-1358.512) * (-1353.385) [-1326.692] (-1338.543) (-1353.253) -- 0:02:04
516000 -- [-1334.442] (-1345.392) (-1342.369) (-1341.437) * (-1343.953) (-1336.325) (-1332.122) [-1327.995] -- 0:02:03
516500 -- [-1330.763] (-1348.674) (-1347.947) (-1338.829) * (-1345.717) (-1339.106) (-1350.817) [-1336.148] -- 0:02:03
517000 -- (-1335.440) (-1340.620) (-1348.343) [-1319.544] * (-1350.079) [-1346.405] (-1351.040) (-1341.942) -- 0:02:03
517500 -- (-1337.569) (-1342.957) (-1346.354) [-1329.966] * (-1343.122) [-1346.331] (-1341.973) (-1347.606) -- 0:02:04
518000 -- (-1347.644) [-1330.994] (-1352.916) (-1345.189) * (-1359.149) (-1340.320) (-1353.055) [-1321.993] -- 0:02:03
518500 -- (-1354.224) [-1338.529] (-1345.067) (-1336.210) * (-1345.469) [-1340.538] (-1347.569) (-1346.548) -- 0:02:03
519000 -- (-1351.886) (-1339.553) (-1347.599) [-1314.330] * (-1343.163) [-1338.686] (-1343.172) (-1341.878) -- 0:02:03
519500 -- (-1346.928) [-1342.239] (-1351.198) (-1337.034) * (-1342.215) [-1334.838] (-1342.129) (-1339.525) -- 0:02:03
520000 -- (-1332.964) [-1322.435] (-1350.091) (-1341.033) * (-1356.557) [-1335.401] (-1346.928) (-1353.136) -- 0:02:02
Average standard deviation of split frequencies: 0.010764
520500 -- (-1350.184) (-1333.554) [-1337.360] (-1342.805) * (-1341.181) [-1343.839] (-1345.950) (-1347.040) -- 0:02:02
521000 -- [-1336.947] (-1343.927) (-1347.454) (-1339.191) * (-1349.444) (-1343.793) [-1335.110] (-1349.152) -- 0:02:02
521500 -- (-1351.220) [-1313.949] (-1351.348) (-1346.072) * (-1348.082) [-1343.312] (-1342.789) (-1343.071) -- 0:02:02
522000 -- (-1351.167) [-1327.853] (-1345.190) (-1352.571) * [-1339.633] (-1346.266) (-1343.479) (-1343.000) -- 0:02:02
522500 -- (-1348.350) [-1337.149] (-1356.145) (-1343.163) * (-1343.526) (-1345.513) [-1338.715] (-1343.521) -- 0:02:02
523000 -- (-1349.792) [-1337.583] (-1343.533) (-1345.185) * (-1356.634) (-1342.565) (-1334.927) [-1328.134] -- 0:02:02
523500 -- (-1349.546) (-1336.977) [-1344.177] (-1341.298) * (-1347.610) (-1347.190) [-1336.645] (-1331.351) -- 0:02:01
524000 -- (-1334.279) (-1348.132) [-1314.929] (-1340.805) * (-1344.550) (-1343.241) (-1344.850) [-1349.250] -- 0:02:01
524500 -- (-1340.785) (-1331.700) [-1330.767] (-1352.274) * (-1337.175) (-1348.733) (-1352.590) [-1333.725] -- 0:02:01
525000 -- (-1327.545) [-1330.470] (-1367.142) (-1343.178) * (-1345.927) (-1354.558) [-1327.016] (-1339.127) -- 0:02:01
Average standard deviation of split frequencies: 0.011103
525500 -- (-1351.917) (-1342.490) (-1351.416) [-1336.977] * [-1337.083] (-1350.624) (-1345.586) (-1330.600) -- 0:02:01
526000 -- (-1350.076) [-1342.496] (-1342.627) (-1345.973) * (-1342.510) (-1345.040) [-1327.355] (-1336.878) -- 0:02:01
526500 -- (-1338.370) [-1338.694] (-1352.975) (-1340.334) * (-1345.504) (-1350.061) [-1327.530] (-1348.297) -- 0:02:01
527000 -- (-1343.214) [-1333.045] (-1334.248) (-1337.470) * (-1350.455) (-1343.625) [-1323.182] (-1352.100) -- 0:02:01
527500 -- (-1335.250) (-1348.969) [-1328.968] (-1346.257) * (-1349.047) (-1343.681) [-1321.025] (-1347.891) -- 0:02:00
528000 -- (-1342.070) [-1339.660] (-1336.851) (-1344.356) * (-1355.382) [-1322.426] (-1341.836) (-1342.812) -- 0:02:00
528500 -- [-1331.437] (-1337.904) (-1351.321) (-1351.093) * [-1331.305] (-1343.054) (-1339.271) (-1336.250) -- 0:02:00
529000 -- (-1341.452) [-1322.240] (-1344.446) (-1350.009) * [-1329.318] (-1343.511) (-1344.545) (-1330.695) -- 0:02:00
529500 -- [-1336.819] (-1323.263) (-1349.790) (-1344.340) * (-1333.273) (-1349.815) (-1339.703) [-1326.949] -- 0:02:00
530000 -- [-1327.514] (-1345.044) (-1341.241) (-1334.399) * (-1337.370) (-1347.887) [-1329.712] (-1356.067) -- 0:02:00
Average standard deviation of split frequencies: 0.011252
530500 -- (-1340.956) (-1326.931) [-1340.834] (-1351.839) * (-1333.179) (-1337.796) [-1327.292] (-1344.919) -- 0:02:00
531000 -- (-1342.168) [-1334.921] (-1342.201) (-1351.555) * (-1348.313) (-1343.600) [-1337.516] (-1350.258) -- 0:02:00
531500 -- (-1342.654) [-1336.271] (-1347.738) (-1350.688) * (-1350.418) (-1338.811) [-1329.510] (-1338.472) -- 0:01:59
532000 -- [-1324.788] (-1332.538) (-1333.470) (-1348.697) * (-1344.147) (-1345.338) [-1323.672] (-1340.977) -- 0:01:59
532500 -- (-1331.497) [-1328.942] (-1339.916) (-1347.044) * (-1332.883) (-1350.934) [-1321.341] (-1345.254) -- 0:01:59
533000 -- (-1344.785) [-1333.270] (-1343.038) (-1353.349) * (-1336.605) (-1348.348) [-1332.045] (-1333.324) -- 0:01:59
533500 -- (-1350.962) [-1328.225] (-1331.898) (-1343.891) * (-1324.007) [-1335.956] (-1355.593) (-1353.648) -- 0:01:59
534000 -- [-1339.264] (-1340.067) (-1336.276) (-1348.225) * [-1312.140] (-1348.106) (-1347.561) (-1343.354) -- 0:01:59
534500 -- (-1337.825) (-1334.180) [-1338.516] (-1357.947) * [-1326.145] (-1355.421) (-1339.764) (-1359.896) -- 0:01:59
535000 -- (-1328.359) [-1332.284] (-1345.423) (-1343.442) * [-1332.882] (-1344.350) (-1342.445) (-1339.079) -- 0:01:59
Average standard deviation of split frequencies: 0.011336
535500 -- (-1341.587) [-1326.170] (-1349.275) (-1340.459) * [-1334.524] (-1353.757) (-1336.575) (-1341.990) -- 0:01:58
536000 -- [-1337.650] (-1339.162) (-1341.373) (-1335.778) * (-1345.728) (-1352.415) (-1342.841) [-1342.139] -- 0:01:58
536500 -- (-1333.339) (-1343.586) (-1347.333) [-1338.586] * (-1336.222) (-1348.400) [-1325.430] (-1341.082) -- 0:01:58
537000 -- (-1343.980) [-1337.303] (-1342.595) (-1346.925) * (-1343.724) (-1343.289) [-1335.578] (-1337.926) -- 0:01:58
537500 -- (-1342.211) [-1331.004] (-1352.706) (-1336.989) * [-1334.499] (-1339.289) (-1346.383) (-1341.976) -- 0:01:58
538000 -- (-1348.082) [-1336.584] (-1348.764) (-1322.219) * (-1338.042) [-1345.989] (-1346.052) (-1341.002) -- 0:01:58
538500 -- [-1319.249] (-1331.983) (-1342.297) (-1345.818) * (-1337.733) (-1342.782) [-1330.298] (-1351.203) -- 0:01:58
539000 -- [-1326.975] (-1344.207) (-1343.367) (-1325.815) * (-1333.934) (-1360.872) [-1318.007] (-1345.563) -- 0:01:58
539500 -- (-1349.853) (-1334.778) (-1339.481) [-1324.537] * (-1348.233) (-1342.808) [-1338.966] (-1344.559) -- 0:01:57
540000 -- (-1341.739) [-1321.052] (-1341.185) (-1344.047) * (-1349.688) (-1351.252) [-1317.839] (-1342.312) -- 0:01:57
Average standard deviation of split frequencies: 0.010608
540500 -- (-1346.167) [-1322.322] (-1340.492) (-1337.450) * (-1348.855) [-1348.919] (-1326.778) (-1336.756) -- 0:01:57
541000 -- (-1333.062) [-1333.542] (-1336.419) (-1339.388) * (-1345.952) (-1343.406) [-1326.555] (-1350.769) -- 0:01:57
541500 -- (-1341.157) [-1332.599] (-1348.681) (-1333.764) * (-1346.811) (-1345.420) [-1322.391] (-1346.616) -- 0:01:57
542000 -- (-1342.140) (-1339.295) [-1341.404] (-1342.909) * (-1336.851) (-1358.775) [-1337.211] (-1340.787) -- 0:01:57
542500 -- [-1348.445] (-1333.319) (-1343.343) (-1346.918) * (-1343.140) (-1346.716) (-1341.045) [-1329.939] -- 0:01:57
543000 -- (-1351.249) [-1336.629] (-1345.101) (-1343.887) * (-1331.676) (-1351.904) (-1347.191) [-1321.723] -- 0:01:56
543500 -- (-1342.531) (-1330.788) (-1338.356) [-1341.560] * (-1352.073) (-1343.596) (-1344.133) [-1331.475] -- 0:01:56
544000 -- (-1343.812) [-1323.609] (-1349.705) (-1329.196) * (-1346.292) (-1351.542) [-1321.103] (-1325.265) -- 0:01:56
544500 -- [-1336.966] (-1354.506) (-1341.500) (-1340.182) * [-1342.802] (-1354.024) (-1347.137) (-1319.264) -- 0:01:56
545000 -- (-1332.151) (-1349.517) [-1328.268] (-1345.315) * (-1338.658) (-1352.754) (-1345.443) [-1314.831] -- 0:01:56
Average standard deviation of split frequencies: 0.010552
545500 -- (-1343.625) (-1347.470) [-1326.009] (-1346.704) * (-1350.692) (-1355.188) (-1337.496) [-1310.295] -- 0:01:56
546000 -- (-1356.261) [-1337.418] (-1347.293) (-1349.726) * (-1337.564) (-1348.629) (-1352.587) [-1317.213] -- 0:01:56
546500 -- (-1343.579) (-1351.405) [-1344.213] (-1351.115) * (-1336.098) (-1355.399) [-1341.857] (-1323.017) -- 0:01:56
547000 -- (-1336.730) (-1348.762) (-1341.117) [-1315.432] * (-1328.806) (-1346.886) (-1342.393) [-1317.751] -- 0:01:55
547500 -- (-1340.150) [-1332.815] (-1339.782) (-1341.766) * (-1343.119) (-1353.187) (-1353.528) [-1322.242] -- 0:01:55
548000 -- [-1335.450] (-1339.892) (-1345.083) (-1342.791) * (-1338.367) [-1347.674] (-1344.525) (-1344.108) -- 0:01:55
548500 -- (-1337.787) (-1351.816) [-1339.218] (-1346.893) * [-1334.897] (-1342.315) (-1339.341) (-1347.335) -- 0:01:55
549000 -- [-1329.403] (-1344.868) (-1340.037) (-1334.852) * [-1345.421] (-1352.062) (-1336.528) (-1348.375) -- 0:01:55
549500 -- [-1333.499] (-1339.173) (-1341.388) (-1345.153) * (-1343.532) [-1338.505] (-1340.293) (-1350.017) -- 0:01:55
550000 -- [-1325.938] (-1344.427) (-1345.242) (-1348.702) * (-1354.993) [-1336.341] (-1346.617) (-1345.928) -- 0:01:55
Average standard deviation of split frequencies: 0.010368
550500 -- [-1324.367] (-1345.110) (-1356.531) (-1338.313) * [-1330.772] (-1344.237) (-1350.054) (-1340.449) -- 0:01:55
551000 -- [-1311.099] (-1346.053) (-1345.992) (-1341.441) * [-1331.054] (-1345.036) (-1346.357) (-1328.253) -- 0:01:54
551500 -- [-1318.390] (-1345.701) (-1345.633) (-1328.436) * (-1332.580) (-1345.085) (-1354.066) [-1330.624] -- 0:01:54
552000 -- (-1353.548) [-1335.226] (-1344.582) (-1349.688) * (-1343.746) (-1339.845) [-1330.444] (-1334.527) -- 0:01:54
552500 -- [-1327.223] (-1334.719) (-1338.068) (-1351.635) * (-1336.722) (-1349.292) [-1321.378] (-1345.836) -- 0:01:54
553000 -- (-1336.989) [-1334.448] (-1346.957) (-1345.347) * (-1345.694) (-1340.097) [-1319.932] (-1344.440) -- 0:01:54
553500 -- (-1343.030) [-1332.520] (-1348.526) (-1355.113) * (-1328.478) (-1342.312) [-1316.813] (-1342.109) -- 0:01:54
554000 -- (-1344.729) [-1329.927] (-1341.920) (-1354.097) * [-1343.117] (-1345.133) (-1338.938) (-1347.954) -- 0:01:54
554500 -- (-1346.273) (-1332.098) [-1332.492] (-1353.658) * [-1345.822] (-1344.127) (-1346.962) (-1345.726) -- 0:01:54
555000 -- (-1351.965) (-1340.749) [-1336.440] (-1346.367) * [-1337.346] (-1339.061) (-1345.873) (-1353.923) -- 0:01:53
Average standard deviation of split frequencies: 0.010692
555500 -- [-1332.365] (-1340.355) (-1345.582) (-1346.668) * [-1338.501] (-1342.579) (-1347.382) (-1335.008) -- 0:01:53
556000 -- [-1339.119] (-1340.168) (-1354.598) (-1340.839) * (-1346.686) (-1357.839) (-1337.952) [-1327.517] -- 0:01:53
556500 -- [-1320.549] (-1348.773) (-1356.391) (-1327.739) * (-1331.129) (-1344.732) (-1339.814) [-1337.223] -- 0:01:53
557000 -- [-1327.419] (-1350.856) (-1341.730) (-1333.363) * (-1350.687) (-1336.366) (-1342.188) [-1336.957] -- 0:01:53
557500 -- (-1338.293) (-1347.906) (-1339.450) [-1333.858] * [-1335.692] (-1339.824) (-1335.827) (-1350.752) -- 0:01:53
558000 -- [-1319.384] (-1350.467) (-1336.665) (-1335.188) * [-1320.157] (-1337.199) (-1349.121) (-1341.364) -- 0:01:53
558500 -- [-1334.662] (-1349.331) (-1354.283) (-1339.368) * [-1328.853] (-1344.785) (-1338.756) (-1353.224) -- 0:01:53
559000 -- (-1344.514) (-1346.928) (-1346.121) [-1327.382] * [-1312.807] (-1345.882) (-1347.216) (-1356.738) -- 0:01:52
559500 -- (-1338.386) (-1339.526) [-1333.796] (-1342.624) * [-1328.882] (-1344.270) (-1341.648) (-1344.448) -- 0:01:52
560000 -- [-1337.452] (-1345.572) (-1339.886) (-1353.465) * [-1324.445] (-1343.789) (-1344.092) (-1340.725) -- 0:01:52
Average standard deviation of split frequencies: 0.010930
560500 -- (-1348.836) (-1354.221) [-1329.499] (-1347.892) * [-1322.296] (-1341.937) (-1355.537) (-1348.239) -- 0:01:52
561000 -- (-1344.806) [-1333.438] (-1355.991) (-1345.411) * [-1335.980] (-1326.718) (-1349.680) (-1333.419) -- 0:01:52
561500 -- (-1362.254) (-1339.756) (-1353.557) [-1333.066] * (-1349.722) [-1329.737] (-1344.195) (-1347.127) -- 0:01:52
562000 -- (-1349.423) (-1350.619) [-1327.812] (-1338.010) * (-1343.804) [-1334.446] (-1351.503) (-1349.685) -- 0:01:52
562500 -- (-1350.825) (-1346.830) [-1341.593] (-1346.026) * (-1341.889) [-1325.286] (-1348.046) (-1343.128) -- 0:01:52
563000 -- (-1344.170) (-1340.112) [-1325.148] (-1344.652) * (-1350.878) (-1328.726) (-1344.265) [-1341.998] -- 0:01:51
563500 -- (-1352.464) (-1319.817) (-1348.732) [-1325.850] * (-1348.106) (-1339.361) [-1332.902] (-1338.724) -- 0:01:51
564000 -- (-1346.880) [-1342.136] (-1337.740) (-1322.961) * (-1343.864) (-1343.647) [-1336.236] (-1351.311) -- 0:01:51
564500 -- (-1344.870) (-1353.560) (-1343.911) [-1333.427] * (-1340.322) (-1347.127) [-1330.017] (-1347.206) -- 0:01:51
565000 -- [-1341.176] (-1357.138) (-1339.963) (-1340.962) * (-1349.110) [-1328.033] (-1346.422) (-1347.119) -- 0:01:51
Average standard deviation of split frequencies: 0.010966
565500 -- [-1332.282] (-1351.783) (-1342.297) (-1335.635) * (-1340.551) (-1346.860) [-1336.364] (-1336.959) -- 0:01:51
566000 -- [-1322.830] (-1341.233) (-1344.946) (-1344.797) * (-1339.923) (-1342.692) (-1350.026) [-1333.947] -- 0:01:51
566500 -- (-1340.815) [-1342.858] (-1339.261) (-1337.975) * [-1335.209] (-1347.843) (-1341.513) (-1339.573) -- 0:01:50
567000 -- (-1346.116) (-1346.233) (-1332.554) [-1335.314] * [-1336.707] (-1343.563) (-1349.495) (-1334.622) -- 0:01:50
567500 -- (-1339.159) (-1350.297) [-1335.044] (-1339.861) * (-1335.249) (-1346.617) [-1329.836] (-1342.523) -- 0:01:50
568000 -- (-1341.200) [-1337.755] (-1344.237) (-1343.491) * [-1326.077] (-1342.441) (-1352.193) (-1342.646) -- 0:01:50
568500 -- (-1349.035) (-1353.236) (-1334.009) [-1341.854] * (-1335.943) (-1338.437) (-1343.345) [-1338.839] -- 0:01:50
569000 -- (-1341.949) (-1344.488) [-1317.576] (-1337.549) * (-1335.209) [-1332.389] (-1343.381) (-1328.975) -- 0:01:50
569500 -- (-1345.005) (-1349.826) [-1337.592] (-1342.997) * (-1340.900) (-1343.365) (-1343.304) [-1325.907] -- 0:01:50
570000 -- (-1335.168) (-1340.902) [-1330.844] (-1346.087) * (-1338.058) [-1340.826] (-1339.112) (-1331.014) -- 0:01:50
Average standard deviation of split frequencies: 0.010593
570500 -- (-1350.548) (-1349.981) [-1314.616] (-1338.989) * (-1346.305) (-1336.383) (-1340.209) [-1332.916] -- 0:01:49
571000 -- [-1332.755] (-1350.470) (-1338.046) (-1350.298) * (-1351.014) [-1339.764] (-1340.305) (-1313.087) -- 0:01:49
571500 -- (-1335.265) (-1342.412) [-1338.773] (-1350.621) * (-1342.389) (-1347.293) [-1336.224] (-1348.031) -- 0:01:49
572000 -- [-1332.014] (-1344.447) (-1348.876) (-1336.738) * (-1338.301) (-1349.551) [-1340.486] (-1342.418) -- 0:01:49
572500 -- (-1340.030) (-1335.833) (-1329.253) [-1335.952] * [-1342.934] (-1348.796) (-1323.544) (-1337.559) -- 0:01:49
573000 -- (-1324.300) (-1344.663) [-1314.772] (-1342.892) * [-1330.702] (-1347.641) (-1348.671) (-1345.570) -- 0:01:49
573500 -- [-1330.467] (-1347.509) (-1341.870) (-1344.084) * [-1336.554] (-1344.089) (-1347.104) (-1339.161) -- 0:01:49
574000 -- (-1333.408) [-1337.637] (-1350.332) (-1340.299) * (-1337.045) (-1345.546) (-1352.448) [-1327.199] -- 0:01:49
574500 -- [-1333.278] (-1348.842) (-1340.898) (-1344.723) * (-1337.099) (-1341.390) (-1344.056) [-1329.965] -- 0:01:48
575000 -- [-1321.904] (-1348.567) (-1329.674) (-1338.764) * (-1340.410) (-1335.923) (-1344.902) [-1330.240] -- 0:01:48
Average standard deviation of split frequencies: 0.010495
575500 -- [-1330.224] (-1339.315) (-1346.832) (-1346.704) * [-1344.114] (-1341.751) (-1338.693) (-1333.494) -- 0:01:48
576000 -- (-1338.989) [-1348.462] (-1348.358) (-1344.398) * (-1345.750) (-1346.803) [-1331.551] (-1344.525) -- 0:01:48
576500 -- (-1343.240) (-1349.081) (-1346.837) [-1332.561] * (-1348.491) [-1327.284] (-1347.579) (-1340.206) -- 0:01:48
577000 -- (-1346.895) (-1343.638) [-1335.021] (-1350.116) * (-1347.724) [-1318.775] (-1343.515) (-1345.424) -- 0:01:48
577500 -- (-1344.755) (-1343.030) [-1333.056] (-1349.694) * (-1336.120) [-1324.954] (-1357.251) (-1335.218) -- 0:01:48
578000 -- (-1335.545) (-1347.018) (-1337.902) [-1335.847] * (-1352.791) (-1327.752) (-1344.925) [-1325.333] -- 0:01:48
578500 -- (-1334.316) (-1349.677) (-1341.504) [-1331.124] * (-1346.313) (-1342.074) (-1344.161) [-1323.018] -- 0:01:47
579000 -- (-1339.992) (-1346.549) (-1333.765) [-1344.979] * (-1348.314) [-1336.041] (-1340.618) (-1350.102) -- 0:01:47
579500 -- [-1329.489] (-1354.143) (-1336.157) (-1357.277) * (-1344.535) [-1340.529] (-1338.627) (-1336.875) -- 0:01:47
580000 -- (-1311.903) (-1349.880) [-1316.794] (-1350.938) * (-1358.042) (-1341.168) [-1345.601] (-1344.319) -- 0:01:47
Average standard deviation of split frequencies: 0.010029
580500 -- [-1311.597] (-1347.834) (-1333.434) (-1347.888) * (-1351.211) [-1335.638] (-1330.316) (-1342.146) -- 0:01:47
581000 -- (-1337.150) (-1358.523) (-1347.925) [-1333.819] * (-1350.131) [-1333.579] (-1346.497) (-1348.449) -- 0:01:47
581500 -- (-1343.513) (-1344.597) (-1350.831) [-1330.795] * (-1340.129) (-1343.549) [-1333.469] (-1349.975) -- 0:01:47
582000 -- (-1345.818) (-1347.705) (-1347.949) [-1323.572] * (-1338.148) (-1340.323) [-1342.255] (-1345.830) -- 0:01:47
582500 -- (-1343.198) (-1340.072) [-1318.094] (-1329.962) * (-1341.071) (-1341.833) [-1343.090] (-1354.223) -- 0:01:46
583000 -- (-1346.175) (-1342.695) [-1314.244] (-1332.646) * (-1345.715) (-1340.656) (-1337.953) [-1343.887] -- 0:01:46
583500 -- (-1350.461) [-1340.104] (-1334.659) (-1347.312) * (-1349.079) (-1346.704) [-1336.039] (-1354.499) -- 0:01:46
584000 -- (-1342.500) (-1347.490) [-1337.063] (-1349.450) * (-1343.027) (-1342.343) (-1336.699) [-1330.016] -- 0:01:46
584500 -- (-1329.805) (-1345.528) (-1345.614) [-1332.464] * (-1346.675) (-1342.170) (-1355.622) [-1339.366] -- 0:01:46
585000 -- (-1342.664) (-1339.672) (-1342.671) [-1348.956] * (-1355.694) (-1348.585) (-1349.398) [-1333.365] -- 0:01:46
Average standard deviation of split frequencies: 0.010127
585500 -- [-1331.491] (-1352.771) (-1328.116) (-1343.039) * (-1349.927) [-1344.046] (-1339.352) (-1348.688) -- 0:01:46
586000 -- [-1337.308] (-1342.295) (-1341.922) (-1340.353) * (-1336.955) [-1341.745] (-1342.401) (-1341.314) -- 0:01:45
586500 -- (-1340.564) (-1341.352) (-1335.512) [-1347.839] * (-1357.372) (-1339.970) [-1329.454] (-1344.464) -- 0:01:45
587000 -- (-1341.438) (-1351.126) (-1340.477) [-1313.750] * [-1330.557] (-1347.772) (-1337.829) (-1358.353) -- 0:01:45
587500 -- (-1340.690) (-1344.938) (-1337.505) [-1307.970] * (-1343.293) (-1334.856) [-1329.409] (-1337.878) -- 0:01:45
588000 -- (-1332.334) (-1360.485) (-1339.822) [-1302.463] * (-1346.544) (-1329.065) (-1323.621) [-1324.696] -- 0:01:45
588500 -- (-1352.222) (-1347.634) (-1349.798) [-1319.380] * (-1349.184) (-1342.419) [-1317.963] (-1317.844) -- 0:01:45
589000 -- [-1336.635] (-1343.761) (-1333.086) (-1338.702) * (-1342.772) [-1311.594] (-1326.628) (-1339.521) -- 0:01:45
589500 -- (-1331.971) [-1332.017] (-1344.993) (-1344.492) * (-1346.817) (-1343.338) [-1331.763] (-1348.388) -- 0:01:45
590000 -- [-1336.043] (-1343.676) (-1336.033) (-1342.194) * (-1345.831) (-1348.571) [-1322.207] (-1334.047) -- 0:01:44
Average standard deviation of split frequencies: 0.009906
590500 -- (-1344.271) (-1341.632) (-1343.312) [-1321.465] * (-1344.642) (-1343.532) [-1332.904] (-1338.521) -- 0:01:44
591000 -- [-1337.474] (-1344.039) (-1340.427) (-1319.999) * [-1330.936] (-1344.221) (-1338.579) (-1349.187) -- 0:01:44
591500 -- (-1357.417) (-1347.919) [-1336.643] (-1330.842) * [-1343.002] (-1351.763) (-1352.561) (-1338.217) -- 0:01:44
592000 -- (-1342.676) [-1340.452] (-1343.456) (-1330.678) * (-1328.959) (-1348.373) (-1343.765) [-1344.018] -- 0:01:44
592500 -- (-1343.015) (-1342.823) (-1342.469) [-1319.537] * (-1343.681) (-1351.860) [-1327.359] (-1352.519) -- 0:01:44
593000 -- (-1342.264) (-1347.870) (-1341.556) [-1324.550] * (-1349.285) (-1344.411) (-1328.351) [-1337.552] -- 0:01:44
593500 -- (-1345.523) (-1343.786) [-1317.175] (-1344.504) * (-1340.367) [-1337.590] (-1335.960) (-1326.026) -- 0:01:44
594000 -- [-1325.366] (-1334.962) (-1334.073) (-1346.600) * (-1343.797) (-1340.303) (-1347.059) [-1326.377] -- 0:01:43
594500 -- (-1345.325) (-1348.340) (-1343.592) [-1339.530] * [-1336.378] (-1341.564) (-1342.475) (-1342.823) -- 0:01:43
595000 -- (-1358.233) (-1346.178) [-1335.264] (-1346.644) * (-1340.609) [-1336.780] (-1346.015) (-1345.896) -- 0:01:43
Average standard deviation of split frequencies: 0.009771
595500 -- (-1341.626) (-1347.461) [-1340.664] (-1338.398) * [-1337.772] (-1341.251) (-1326.040) (-1352.442) -- 0:01:43
596000 -- (-1356.078) [-1330.014] (-1321.126) (-1339.658) * [-1318.648] (-1343.473) (-1341.797) (-1346.667) -- 0:01:43
596500 -- (-1340.002) (-1339.119) [-1324.559] (-1344.859) * [-1318.422] (-1346.495) (-1345.512) (-1344.962) -- 0:01:43
597000 -- (-1339.900) [-1327.846] (-1341.767) (-1355.848) * [-1325.240] (-1343.088) (-1346.062) (-1354.034) -- 0:01:43
597500 -- (-1343.013) (-1332.311) [-1340.693] (-1354.460) * [-1318.962] (-1335.011) (-1341.527) (-1346.688) -- 0:01:43
598000 -- (-1349.192) [-1338.996] (-1344.052) (-1342.953) * [-1324.915] (-1336.983) (-1348.369) (-1344.870) -- 0:01:42
598500 -- [-1344.395] (-1349.109) (-1350.831) (-1329.279) * [-1321.579] (-1356.562) (-1337.638) (-1350.051) -- 0:01:42
599000 -- (-1342.491) [-1338.116] (-1347.398) (-1334.240) * [-1322.163] (-1350.984) (-1341.827) (-1343.003) -- 0:01:42
599500 -- (-1342.168) (-1349.812) (-1365.029) [-1328.947] * [-1319.629] (-1355.767) (-1342.196) (-1349.845) -- 0:01:42
600000 -- (-1352.791) (-1353.320) [-1346.235] (-1342.597) * [-1341.473] (-1344.334) (-1338.348) (-1345.281) -- 0:01:42
Average standard deviation of split frequencies: 0.009741
600500 -- (-1353.383) (-1352.917) (-1344.498) [-1334.980] * (-1355.170) (-1354.266) (-1344.763) [-1320.443] -- 0:01:42
601000 -- (-1347.792) [-1337.817] (-1339.635) (-1349.386) * (-1341.862) (-1343.669) (-1354.308) [-1325.138] -- 0:01:42
601500 -- (-1345.059) (-1349.077) (-1357.552) [-1336.311] * (-1341.600) (-1345.570) (-1340.940) [-1322.347] -- 0:01:42
602000 -- [-1337.281] (-1350.492) (-1331.253) (-1339.289) * (-1335.742) (-1348.838) (-1345.134) [-1314.895] -- 0:01:41
602500 -- (-1345.346) (-1337.831) (-1346.187) [-1322.636] * (-1333.823) (-1355.782) (-1352.716) [-1315.783] -- 0:01:41
603000 -- (-1349.214) (-1341.715) (-1347.306) [-1320.636] * (-1340.959) (-1346.471) (-1343.915) [-1339.289] -- 0:01:41
603500 -- (-1351.494) (-1343.259) (-1336.749) [-1330.133] * (-1344.128) (-1345.070) [-1340.208] (-1340.638) -- 0:01:41
604000 -- (-1346.651) (-1343.315) (-1340.389) [-1337.172] * [-1348.549] (-1341.805) (-1348.040) (-1336.093) -- 0:01:41
604500 -- [-1328.321] (-1343.279) (-1348.727) (-1345.920) * (-1346.836) [-1332.466] (-1342.769) (-1351.289) -- 0:01:41
605000 -- [-1333.512] (-1342.712) (-1337.624) (-1324.110) * [-1343.350] (-1342.628) (-1344.889) (-1339.822) -- 0:01:41
Average standard deviation of split frequencies: 0.009609
605500 -- (-1344.817) [-1333.469] (-1338.814) (-1333.962) * (-1338.262) [-1335.907] (-1335.299) (-1333.896) -- 0:01:40
606000 -- (-1348.831) [-1329.608] (-1341.832) (-1333.919) * (-1346.609) (-1347.823) [-1338.796] (-1339.325) -- 0:01:40
606500 -- (-1351.323) (-1329.881) (-1338.065) [-1336.747] * (-1342.201) (-1337.060) (-1346.745) [-1338.913] -- 0:01:40
607000 -- (-1345.250) (-1337.410) (-1342.283) [-1328.242] * (-1347.609) (-1337.503) (-1339.420) [-1330.846] -- 0:01:40
607500 -- (-1340.220) (-1338.752) [-1328.545] (-1336.507) * [-1341.363] (-1331.712) (-1351.451) (-1345.015) -- 0:01:40
608000 -- (-1356.669) [-1316.494] (-1321.474) (-1345.399) * (-1344.286) (-1339.265) (-1350.536) [-1333.468] -- 0:01:40
608500 -- (-1340.929) [-1325.192] (-1338.595) (-1348.502) * (-1341.265) (-1339.183) (-1344.736) [-1332.353] -- 0:01:40
609000 -- (-1346.076) [-1334.843] (-1339.452) (-1341.012) * (-1344.223) (-1343.536) (-1349.964) [-1334.334] -- 0:01:40
609500 -- (-1346.875) (-1325.636) (-1334.421) [-1339.656] * (-1346.919) (-1348.488) [-1331.832] (-1347.981) -- 0:01:39
610000 -- (-1341.531) [-1311.040] (-1344.651) (-1346.066) * (-1352.012) (-1339.945) (-1360.212) [-1340.571] -- 0:01:39
Average standard deviation of split frequencies: 0.009490
610500 -- (-1350.769) [-1315.096] (-1339.937) (-1343.875) * (-1352.825) [-1337.713] (-1347.051) (-1341.558) -- 0:01:39
611000 -- (-1340.420) [-1307.972] (-1348.845) (-1337.415) * (-1346.142) [-1325.153] (-1343.290) (-1339.697) -- 0:01:39
611500 -- (-1335.067) [-1343.478] (-1340.375) (-1346.025) * [-1334.530] (-1344.985) (-1345.856) (-1341.686) -- 0:01:39
612000 -- (-1347.681) (-1342.413) [-1335.608] (-1332.998) * [-1320.530] (-1348.524) (-1362.184) (-1333.142) -- 0:01:39
612500 -- (-1350.599) [-1339.762] (-1314.010) (-1341.262) * (-1345.076) (-1346.822) (-1341.645) [-1338.464] -- 0:01:39
613000 -- (-1333.775) (-1348.753) (-1333.151) [-1336.677] * (-1343.893) (-1344.679) (-1355.666) [-1336.116] -- 0:01:39
613500 -- (-1349.374) (-1348.074) [-1329.551] (-1335.812) * (-1349.478) [-1335.438] (-1343.712) (-1347.461) -- 0:01:38
614000 -- (-1339.798) (-1339.331) (-1331.383) [-1318.825] * [-1348.730] (-1340.489) (-1346.247) (-1336.919) -- 0:01:38
614500 -- (-1342.016) (-1353.073) (-1343.170) [-1343.258] * [-1335.075] (-1348.634) (-1350.173) (-1348.243) -- 0:01:38
615000 -- (-1339.223) (-1342.334) (-1330.052) [-1342.850] * [-1335.613] (-1342.825) (-1351.552) (-1337.420) -- 0:01:38
Average standard deviation of split frequencies: 0.009813
615500 -- (-1342.790) (-1346.541) [-1317.831] (-1336.190) * (-1339.773) [-1342.915] (-1348.291) (-1345.961) -- 0:01:38
616000 -- (-1346.999) [-1332.619] (-1324.736) (-1349.785) * [-1349.767] (-1346.531) (-1363.714) (-1344.650) -- 0:01:38
616500 -- (-1333.571) [-1328.942] (-1337.368) (-1336.054) * (-1337.696) [-1332.886] (-1346.618) (-1356.889) -- 0:01:38
617000 -- [-1325.286] (-1344.983) (-1334.839) (-1338.745) * [-1335.865] (-1345.015) (-1350.470) (-1341.802) -- 0:01:38
617500 -- (-1328.951) (-1344.596) (-1350.804) [-1324.705] * (-1342.708) [-1349.643] (-1341.158) (-1328.093) -- 0:01:37
618000 -- (-1341.772) (-1341.282) (-1345.935) [-1323.952] * (-1348.292) (-1345.574) [-1336.423] (-1339.564) -- 0:01:37
618500 -- (-1350.053) [-1320.395] (-1351.984) (-1344.836) * [-1335.929] (-1345.955) (-1337.915) (-1343.921) -- 0:01:37
619000 -- (-1343.439) [-1317.578] (-1339.345) (-1355.275) * [-1323.176] (-1345.609) (-1335.025) (-1337.568) -- 0:01:37
619500 -- (-1347.084) [-1314.722] (-1331.537) (-1351.931) * [-1314.241] (-1349.385) (-1337.313) (-1331.015) -- 0:01:37
620000 -- (-1339.962) [-1332.733] (-1348.108) (-1354.780) * [-1310.862] (-1360.529) (-1346.322) (-1341.567) -- 0:01:37
Average standard deviation of split frequencies: 0.010142
620500 -- (-1356.252) [-1341.218] (-1351.518) (-1350.003) * [-1321.276] (-1351.234) (-1344.953) (-1344.660) -- 0:01:37
621000 -- [-1331.190] (-1343.984) (-1352.001) (-1345.915) * (-1328.126) (-1347.807) [-1340.461] (-1347.994) -- 0:01:37
621500 -- [-1346.370] (-1339.307) (-1341.293) (-1337.490) * [-1332.687] (-1352.875) (-1344.664) (-1340.103) -- 0:01:36
622000 -- (-1345.218) (-1343.805) (-1344.609) [-1338.870] * (-1333.614) (-1343.658) [-1332.341] (-1342.836) -- 0:01:36
622500 -- [-1340.126] (-1347.423) (-1333.946) (-1337.721) * [-1329.752] (-1348.304) (-1346.643) (-1332.370) -- 0:01:36
623000 -- [-1335.799] (-1342.344) (-1333.272) (-1344.170) * (-1344.856) (-1337.260) (-1347.563) [-1324.547] -- 0:01:36
623500 -- (-1354.956) (-1334.555) (-1345.718) [-1323.707] * [-1342.826] (-1355.095) (-1343.835) (-1356.251) -- 0:01:36
624000 -- (-1335.650) (-1340.696) (-1346.679) [-1333.645] * [-1331.381] (-1356.592) (-1337.803) (-1342.417) -- 0:01:36
624500 -- (-1351.980) [-1328.988] (-1344.984) (-1332.094) * (-1335.036) (-1348.717) (-1352.703) [-1337.496] -- 0:01:36
625000 -- (-1345.612) [-1330.566] (-1346.812) (-1350.504) * (-1343.827) (-1349.746) (-1347.433) [-1338.645] -- 0:01:36
Average standard deviation of split frequencies: 0.010188
625500 -- (-1352.576) [-1332.839] (-1353.788) (-1344.604) * [-1339.463] (-1357.960) (-1355.795) (-1347.291) -- 0:01:35
626000 -- (-1350.812) [-1321.746] (-1344.496) (-1343.301) * [-1326.481] (-1350.187) (-1350.945) (-1348.018) -- 0:01:35
626500 -- (-1355.008) [-1326.866] (-1344.237) (-1351.456) * [-1322.909] (-1351.844) (-1340.240) (-1343.464) -- 0:01:35
627000 -- [-1336.495] (-1332.238) (-1348.132) (-1342.083) * (-1338.317) (-1358.381) [-1330.711] (-1354.051) -- 0:01:35
627500 -- (-1317.258) (-1354.103) (-1338.947) [-1339.025] * [-1338.908] (-1342.424) (-1344.203) (-1348.834) -- 0:01:35
628000 -- (-1344.581) (-1340.264) [-1349.214] (-1344.410) * (-1341.626) (-1352.971) [-1342.813] (-1341.364) -- 0:01:35
628500 -- (-1347.879) [-1321.890] (-1336.583) (-1342.473) * (-1330.660) (-1352.489) (-1333.645) [-1335.435] -- 0:01:35
629000 -- (-1346.219) (-1340.409) [-1334.421] (-1346.940) * [-1322.645] (-1342.983) (-1327.534) (-1357.653) -- 0:01:34
629500 -- (-1344.651) (-1342.288) (-1333.177) [-1345.379] * (-1330.657) (-1341.854) [-1321.712] (-1346.772) -- 0:01:34
630000 -- (-1353.093) [-1325.081] (-1358.872) (-1344.398) * (-1349.344) (-1344.577) [-1313.446] (-1345.086) -- 0:01:34
Average standard deviation of split frequencies: 0.008882
630500 -- (-1336.104) [-1341.909] (-1340.419) (-1340.191) * (-1344.239) [-1333.758] (-1345.074) (-1341.896) -- 0:01:34
631000 -- (-1352.177) [-1340.556] (-1333.640) (-1345.453) * [-1336.118] (-1343.882) (-1344.201) (-1338.460) -- 0:01:34
631500 -- [-1337.366] (-1342.483) (-1347.283) (-1350.746) * [-1327.460] (-1346.432) (-1336.889) (-1352.851) -- 0:01:34
632000 -- (-1339.634) (-1344.866) [-1335.059] (-1350.400) * (-1329.559) (-1348.934) (-1344.470) [-1335.054] -- 0:01:34
632500 -- (-1336.728) (-1333.703) (-1341.420) [-1334.790] * (-1339.735) (-1345.175) [-1340.038] (-1354.196) -- 0:01:34
633000 -- [-1340.973] (-1333.511) (-1347.741) (-1348.294) * [-1316.442] (-1360.410) (-1342.219) (-1343.656) -- 0:01:33
633500 -- (-1337.633) [-1333.226] (-1363.093) (-1342.986) * [-1310.678] (-1344.470) (-1348.961) (-1351.667) -- 0:01:33
634000 -- (-1350.160) [-1331.595] (-1355.495) (-1335.306) * [-1313.870] (-1338.560) (-1338.130) (-1346.768) -- 0:01:33
634500 -- (-1335.922) (-1331.876) (-1355.306) [-1339.027] * (-1336.700) [-1339.783] (-1340.634) (-1341.466) -- 0:01:33
635000 -- [-1332.341] (-1320.406) (-1356.829) (-1348.369) * (-1345.155) [-1339.299] (-1338.316) (-1342.136) -- 0:01:33
Average standard deviation of split frequencies: 0.007804
635500 -- [-1335.374] (-1326.920) (-1349.057) (-1338.989) * (-1345.932) [-1330.480] (-1344.167) (-1341.478) -- 0:01:33
636000 -- (-1345.337) (-1336.976) [-1327.085] (-1347.234) * (-1344.676) [-1329.576] (-1349.608) (-1335.817) -- 0:01:33
636500 -- (-1340.414) (-1346.241) [-1314.611] (-1343.249) * [-1347.611] (-1345.030) (-1359.568) (-1348.451) -- 0:01:33
637000 -- [-1335.843] (-1363.447) (-1355.748) (-1343.587) * (-1351.680) (-1326.796) (-1349.749) [-1336.058] -- 0:01:32
637500 -- [-1324.900] (-1346.046) (-1344.948) (-1338.644) * (-1352.016) (-1332.868) (-1349.444) [-1332.602] -- 0:01:32
638000 -- [-1314.549] (-1332.308) (-1362.187) (-1331.812) * (-1345.063) [-1324.613] (-1340.820) (-1339.965) -- 0:01:32
638500 -- [-1341.618] (-1327.120) (-1351.564) (-1329.331) * (-1334.935) (-1345.564) [-1321.027] (-1339.640) -- 0:01:32
639000 -- (-1339.733) [-1329.919] (-1345.865) (-1339.962) * (-1333.220) (-1337.551) [-1321.588] (-1349.378) -- 0:01:32
639500 -- (-1340.598) (-1340.168) [-1337.971] (-1347.181) * (-1340.775) (-1328.572) [-1328.874] (-1345.298) -- 0:01:32
640000 -- [-1339.818] (-1334.896) (-1343.455) (-1344.510) * (-1347.950) (-1337.867) [-1339.693] (-1346.425) -- 0:01:32
Average standard deviation of split frequencies: 0.008180
640500 -- (-1339.122) [-1329.828] (-1358.738) (-1342.029) * (-1339.729) (-1341.387) [-1321.787] (-1340.324) -- 0:01:32
641000 -- (-1340.866) (-1331.495) [-1334.784] (-1346.048) * (-1345.190) (-1344.903) [-1317.469] (-1342.674) -- 0:01:31
641500 -- [-1345.007] (-1353.968) (-1331.491) (-1348.468) * (-1342.983) (-1336.500) [-1322.732] (-1340.360) -- 0:01:31
642000 -- (-1352.580) [-1334.943] (-1323.239) (-1344.967) * (-1341.300) (-1342.322) (-1345.406) [-1344.048] -- 0:01:31
642500 -- (-1340.987) (-1344.540) (-1347.636) [-1341.700] * (-1349.989) (-1334.750) [-1330.388] (-1342.676) -- 0:01:31
643000 -- (-1345.754) [-1347.002] (-1344.759) (-1342.461) * (-1343.316) (-1344.742) [-1328.933] (-1342.155) -- 0:01:31
643500 -- [-1323.543] (-1336.773) (-1344.551) (-1357.113) * (-1332.231) [-1338.087] (-1325.015) (-1354.081) -- 0:01:31
644000 -- (-1329.586) (-1344.011) [-1329.843] (-1353.109) * (-1343.699) (-1342.551) [-1315.224] (-1339.029) -- 0:01:31
644500 -- (-1330.651) (-1347.064) [-1324.382] (-1334.135) * (-1353.081) [-1331.236] (-1334.454) (-1346.057) -- 0:01:31
645000 -- (-1341.663) (-1345.892) [-1323.590] (-1338.494) * (-1345.254) (-1335.982) [-1331.151] (-1346.605) -- 0:01:30
Average standard deviation of split frequencies: 0.007898
645500 -- (-1356.058) [-1340.365] (-1341.604) (-1334.367) * (-1338.794) (-1344.584) [-1342.314] (-1345.984) -- 0:01:30
646000 -- (-1337.888) (-1340.997) (-1336.837) [-1342.638] * (-1344.415) [-1334.733] (-1346.835) (-1350.417) -- 0:01:30
646500 -- (-1344.667) (-1343.135) [-1329.192] (-1344.460) * (-1346.270) [-1327.063] (-1334.591) (-1336.172) -- 0:01:30
647000 -- (-1345.146) (-1338.221) [-1332.766] (-1343.824) * (-1346.517) (-1338.748) (-1342.047) [-1344.368] -- 0:01:30
647500 -- (-1335.083) (-1341.256) [-1334.043] (-1345.497) * (-1346.753) [-1334.735] (-1336.277) (-1352.606) -- 0:01:30
648000 -- (-1334.066) (-1343.947) [-1323.218] (-1350.560) * (-1332.795) (-1341.244) [-1329.498] (-1344.022) -- 0:01:30
648500 -- (-1336.602) (-1338.819) [-1331.956] (-1344.606) * [-1334.995] (-1351.477) (-1342.270) (-1336.761) -- 0:01:29
649000 -- (-1334.752) (-1340.106) [-1331.349] (-1348.765) * (-1347.679) (-1337.613) [-1340.454] (-1340.662) -- 0:01:29
649500 -- (-1354.799) [-1329.781] (-1345.075) (-1344.944) * (-1348.856) [-1336.779] (-1335.906) (-1348.583) -- 0:01:29
650000 -- (-1337.845) (-1353.261) [-1325.790] (-1335.378) * (-1346.355) (-1325.475) (-1337.794) [-1335.243] -- 0:01:29
Average standard deviation of split frequencies: 0.007245
650500 -- (-1352.140) (-1346.747) (-1341.455) [-1316.527] * (-1347.158) (-1325.131) (-1339.217) [-1321.040] -- 0:01:29
651000 -- (-1341.435) (-1339.042) (-1339.675) [-1334.766] * (-1339.573) (-1334.468) (-1341.706) [-1327.090] -- 0:01:29
651500 -- (-1341.940) (-1341.980) (-1347.454) [-1339.783] * (-1340.903) (-1332.405) (-1335.371) [-1330.599] -- 0:01:29
652000 -- (-1338.638) (-1342.442) (-1339.014) [-1335.060] * (-1339.136) (-1337.037) [-1341.748] (-1350.780) -- 0:01:29
652500 -- (-1345.976) [-1335.654] (-1356.103) (-1346.990) * (-1345.202) (-1322.364) [-1338.522] (-1343.555) -- 0:01:28
653000 -- (-1334.075) (-1334.587) (-1337.129) [-1341.274] * (-1346.818) (-1330.803) [-1328.365] (-1345.061) -- 0:01:28
653500 -- (-1333.026) (-1327.469) [-1319.790] (-1342.589) * (-1340.086) [-1332.272] (-1340.323) (-1343.688) -- 0:01:28
654000 -- (-1341.714) (-1339.611) (-1343.198) [-1338.791] * (-1334.158) [-1333.045] (-1345.599) (-1346.559) -- 0:01:28
654500 -- (-1339.312) (-1337.276) (-1337.144) [-1328.990] * [-1343.124] (-1335.286) (-1342.786) (-1342.782) -- 0:01:28
655000 -- (-1339.677) [-1333.833] (-1347.514) (-1347.137) * (-1347.052) (-1342.519) [-1342.016] (-1341.493) -- 0:01:28
Average standard deviation of split frequencies: 0.007144
655500 -- (-1337.651) [-1330.179] (-1345.584) (-1353.741) * [-1321.532] (-1333.456) (-1346.446) (-1346.852) -- 0:01:28
656000 -- (-1342.429) (-1338.855) [-1339.800] (-1347.746) * (-1334.932) [-1341.104] (-1339.343) (-1350.627) -- 0:01:28
656500 -- (-1348.670) [-1327.250] (-1331.979) (-1345.260) * (-1346.998) (-1334.791) (-1347.055) [-1337.338] -- 0:01:27
657000 -- (-1336.502) [-1342.957] (-1342.306) (-1339.975) * (-1348.946) [-1330.594] (-1345.861) (-1337.425) -- 0:01:27
657500 -- [-1320.338] (-1345.347) (-1345.137) (-1337.649) * (-1341.137) [-1323.662] (-1334.401) (-1353.581) -- 0:01:27
658000 -- (-1334.143) (-1344.536) [-1334.032] (-1351.640) * (-1343.880) [-1333.411] (-1340.087) (-1344.257) -- 0:01:27
658500 -- [-1330.368] (-1345.197) (-1324.430) (-1346.221) * (-1335.385) (-1343.433) (-1345.316) [-1336.333] -- 0:01:27
659000 -- (-1324.131) (-1349.898) [-1326.345] (-1342.366) * (-1336.363) (-1347.688) (-1341.340) [-1328.639] -- 0:01:27
659500 -- (-1347.050) (-1339.715) [-1334.955] (-1343.030) * (-1351.083) (-1344.198) (-1335.153) [-1330.591] -- 0:01:27
660000 -- [-1343.819] (-1346.722) (-1338.711) (-1343.427) * (-1358.923) (-1339.195) [-1334.506] (-1342.499) -- 0:01:27
Average standard deviation of split frequencies: 0.007093
660500 -- (-1343.506) (-1347.125) (-1343.903) [-1342.864] * [-1341.666] (-1343.624) (-1342.369) (-1336.513) -- 0:01:26
661000 -- (-1347.078) (-1345.638) [-1341.001] (-1340.137) * (-1347.640) (-1348.721) (-1345.076) [-1335.994] -- 0:01:26
661500 -- (-1342.514) (-1338.694) [-1313.262] (-1343.914) * (-1351.285) (-1333.181) (-1355.360) [-1318.750] -- 0:01:26
662000 -- (-1353.005) (-1338.195) [-1313.348] (-1352.772) * (-1342.238) (-1346.653) (-1341.379) [-1322.266] -- 0:01:26
662500 -- (-1352.063) (-1352.373) [-1317.866] (-1349.841) * (-1346.738) (-1344.486) (-1341.069) [-1328.767] -- 0:01:26
663000 -- [-1328.158] (-1349.778) (-1323.579) (-1350.732) * (-1344.196) (-1343.020) (-1342.385) [-1332.801] -- 0:01:26
663500 -- (-1337.502) (-1340.307) [-1329.067] (-1341.445) * (-1346.668) (-1332.603) [-1327.782] (-1341.315) -- 0:01:26
664000 -- (-1340.084) (-1330.441) [-1329.238] (-1345.432) * (-1340.650) [-1344.560] (-1347.562) (-1334.839) -- 0:01:26
664500 -- (-1341.572) [-1334.622] (-1328.877) (-1350.284) * (-1345.735) (-1356.281) (-1345.402) [-1326.199] -- 0:01:25
665000 -- (-1343.136) (-1344.946) [-1320.582] (-1338.483) * (-1337.233) [-1334.276] (-1353.010) (-1347.966) -- 0:01:25
Average standard deviation of split frequencies: 0.007370
665500 -- (-1343.435) (-1341.664) [-1327.914] (-1349.778) * (-1344.672) (-1339.081) (-1344.797) [-1338.650] -- 0:01:25
666000 -- (-1350.753) (-1352.341) [-1325.076] (-1347.923) * (-1350.889) [-1330.494] (-1333.399) (-1348.746) -- 0:01:25
666500 -- [-1335.368] (-1345.694) (-1341.784) (-1344.514) * (-1342.375) [-1320.086] (-1344.870) (-1328.767) -- 0:01:25
667000 -- (-1340.750) [-1331.135] (-1333.671) (-1346.864) * (-1347.066) [-1335.625] (-1338.586) (-1352.662) -- 0:01:25
667500 -- (-1345.229) (-1338.180) [-1341.237] (-1352.998) * (-1350.817) (-1339.323) [-1321.336] (-1346.077) -- 0:01:25
668000 -- [-1336.632] (-1347.828) (-1334.433) (-1349.770) * (-1349.791) (-1352.858) [-1318.093] (-1343.949) -- 0:01:24
668500 -- (-1353.401) (-1347.003) [-1343.268] (-1362.874) * (-1349.732) (-1334.033) [-1309.309] (-1343.119) -- 0:01:24
669000 -- [-1337.160] (-1352.880) (-1349.449) (-1343.816) * (-1350.027) (-1339.176) [-1311.100] (-1338.093) -- 0:01:24
669500 -- (-1347.872) (-1344.049) [-1340.014] (-1347.117) * (-1332.918) (-1331.170) (-1306.658) [-1336.436] -- 0:01:24
670000 -- (-1350.685) (-1351.316) (-1349.781) [-1344.991] * (-1350.455) (-1336.876) [-1321.989] (-1347.229) -- 0:01:24
Average standard deviation of split frequencies: 0.007360
670500 -- (-1354.876) [-1348.848] (-1344.721) (-1339.898) * (-1344.833) (-1337.573) [-1339.573] (-1335.823) -- 0:01:24
671000 -- (-1351.349) (-1351.328) (-1345.783) [-1338.948] * (-1336.886) (-1337.490) [-1332.840] (-1347.443) -- 0:01:24
671500 -- (-1321.043) (-1349.708) [-1338.146] (-1345.277) * (-1334.123) (-1338.179) [-1317.345] (-1349.038) -- 0:01:24
672000 -- (-1326.527) [-1323.649] (-1344.884) (-1338.747) * (-1343.521) (-1331.298) [-1327.797] (-1340.090) -- 0:01:23
672500 -- [-1325.643] (-1345.329) (-1347.149) (-1328.584) * (-1339.300) [-1321.941] (-1351.180) (-1334.219) -- 0:01:23
673000 -- (-1328.338) [-1343.798] (-1343.999) (-1341.803) * (-1344.725) [-1332.927] (-1343.704) (-1345.778) -- 0:01:23
673500 -- (-1331.449) (-1332.114) (-1356.998) [-1343.166] * [-1325.248] (-1344.000) (-1338.678) (-1344.582) -- 0:01:23
674000 -- [-1335.443] (-1348.175) (-1349.394) (-1342.754) * (-1339.783) (-1353.229) (-1337.995) [-1328.788] -- 0:01:23
674500 -- (-1333.545) [-1337.688] (-1335.627) (-1347.595) * (-1345.885) (-1342.331) (-1336.668) [-1318.060] -- 0:01:23
675000 -- (-1332.916) [-1333.057] (-1347.190) (-1350.786) * (-1331.522) (-1340.559) [-1340.364] (-1340.231) -- 0:01:23
Average standard deviation of split frequencies: 0.007794
675500 -- (-1340.702) (-1342.972) (-1342.967) [-1337.866] * (-1342.493) [-1344.375] (-1339.163) (-1353.828) -- 0:01:23
676000 -- (-1340.651) [-1337.465] (-1356.808) (-1343.823) * [-1323.994] (-1347.266) (-1335.620) (-1340.301) -- 0:01:22
676500 -- (-1341.129) (-1344.732) (-1340.836) [-1338.812] * [-1326.533] (-1348.431) (-1339.480) (-1334.972) -- 0:01:22
677000 -- (-1338.633) (-1341.009) (-1353.035) [-1334.611] * [-1336.376] (-1341.418) (-1352.494) (-1336.500) -- 0:01:22
677500 -- (-1343.754) (-1352.310) (-1331.634) [-1322.907] * (-1347.667) (-1337.174) [-1328.504] (-1342.940) -- 0:01:22
678000 -- (-1346.318) (-1334.716) (-1340.246) [-1338.058] * (-1343.472) (-1341.223) [-1328.344] (-1344.779) -- 0:01:22
678500 -- (-1337.417) [-1339.837] (-1341.580) (-1349.080) * [-1327.757] (-1340.450) (-1341.861) (-1357.228) -- 0:01:22
679000 -- (-1345.683) (-1354.199) [-1341.073] (-1349.797) * [-1317.101] (-1338.324) (-1351.405) (-1342.581) -- 0:01:22
679500 -- (-1356.404) [-1333.917] (-1335.162) (-1340.093) * (-1316.443) (-1343.752) (-1348.103) [-1308.194] -- 0:01:22
680000 -- (-1345.315) [-1315.759] (-1342.048) (-1341.318) * (-1332.151) (-1325.004) (-1336.904) [-1329.458] -- 0:01:21
Average standard deviation of split frequencies: 0.008189
680500 -- (-1343.743) [-1326.226] (-1340.548) (-1346.120) * (-1347.449) (-1344.515) (-1337.428) [-1325.488] -- 0:01:21
681000 -- (-1359.366) [-1333.895] (-1331.811) (-1345.477) * (-1349.479) (-1350.669) [-1332.304] (-1339.584) -- 0:01:21
681500 -- (-1337.790) (-1340.307) [-1340.572] (-1340.993) * (-1341.821) (-1352.559) (-1340.903) [-1332.280] -- 0:01:21
682000 -- (-1337.306) (-1347.785) [-1330.724] (-1345.103) * (-1346.554) (-1354.296) [-1332.736] (-1343.279) -- 0:01:21
682500 -- (-1333.456) (-1350.371) (-1342.685) [-1341.768] * (-1347.652) (-1360.459) [-1329.205] (-1336.166) -- 0:01:21
683000 -- (-1327.094) (-1350.120) [-1344.833] (-1345.588) * (-1346.249) (-1341.056) [-1338.714] (-1336.673) -- 0:01:21
683500 -- (-1334.899) [-1328.589] (-1351.182) (-1348.069) * (-1340.636) (-1340.043) (-1332.981) [-1318.850] -- 0:01:21
684000 -- [-1333.959] (-1341.193) (-1349.792) (-1353.834) * (-1351.652) (-1350.450) (-1345.481) [-1334.834] -- 0:01:20
684500 -- (-1337.574) (-1341.148) [-1342.060] (-1345.629) * (-1348.406) (-1341.336) (-1339.677) [-1325.673] -- 0:01:20
685000 -- [-1340.001] (-1337.736) (-1346.479) (-1342.067) * (-1350.113) (-1346.323) (-1343.394) [-1325.913] -- 0:01:20
Average standard deviation of split frequencies: 0.007438
685500 -- (-1346.378) [-1334.590] (-1343.748) (-1353.889) * (-1343.217) (-1341.632) (-1333.449) [-1317.939] -- 0:01:20
686000 -- (-1335.114) [-1343.684] (-1339.232) (-1343.162) * (-1327.896) (-1349.090) [-1329.517] (-1339.661) -- 0:01:20
686500 -- [-1344.010] (-1347.355) (-1354.542) (-1340.849) * [-1335.542] (-1344.942) (-1333.379) (-1330.655) -- 0:01:20
687000 -- [-1344.798] (-1341.666) (-1342.374) (-1348.439) * (-1337.208) (-1341.873) (-1340.818) [-1342.052] -- 0:01:20
687500 -- (-1347.767) [-1337.127] (-1340.993) (-1347.614) * (-1340.730) (-1359.028) [-1334.265] (-1350.362) -- 0:01:20
688000 -- (-1345.344) [-1336.271] (-1348.034) (-1345.114) * (-1358.566) (-1354.327) [-1329.047] (-1343.972) -- 0:01:19
688500 -- [-1323.081] (-1342.593) (-1347.979) (-1351.212) * (-1339.994) (-1335.452) [-1323.176] (-1344.707) -- 0:01:19
689000 -- (-1332.619) [-1325.467] (-1349.834) (-1347.246) * (-1331.993) (-1336.577) [-1318.121] (-1353.320) -- 0:01:19
689500 -- [-1339.240] (-1339.801) (-1347.251) (-1349.095) * (-1334.164) (-1343.103) [-1322.987] (-1344.660) -- 0:01:19
690000 -- (-1347.073) [-1343.624] (-1342.646) (-1348.377) * (-1338.275) (-1346.295) [-1323.974] (-1339.782) -- 0:01:19
Average standard deviation of split frequencies: 0.007106
690500 -- (-1345.877) [-1337.900] (-1347.609) (-1344.316) * (-1345.337) (-1340.392) [-1312.334] (-1359.033) -- 0:01:19
691000 -- (-1345.301) [-1329.325] (-1334.250) (-1342.823) * (-1334.000) (-1352.800) [-1311.802] (-1340.674) -- 0:01:19
691500 -- [-1334.306] (-1335.664) (-1349.390) (-1348.998) * [-1328.493] (-1355.792) (-1330.300) (-1357.992) -- 0:01:18
692000 -- [-1347.275] (-1332.031) (-1346.078) (-1357.953) * (-1336.039) [-1336.870] (-1343.669) (-1338.982) -- 0:01:18
692500 -- [-1337.621] (-1338.316) (-1333.866) (-1354.022) * (-1348.000) (-1346.456) [-1341.562] (-1345.103) -- 0:01:18
693000 -- (-1357.128) (-1330.190) [-1313.880] (-1343.969) * (-1348.847) (-1341.228) (-1351.076) [-1331.020] -- 0:01:18
693500 -- (-1343.889) (-1329.681) [-1327.615] (-1343.611) * (-1358.751) (-1337.856) (-1338.817) [-1329.825] -- 0:01:18
694000 -- (-1340.550) [-1308.299] (-1347.600) (-1348.317) * (-1354.492) (-1345.171) (-1343.473) [-1340.568] -- 0:01:18
694500 -- (-1350.188) [-1329.883] (-1349.770) (-1350.748) * (-1351.570) (-1361.771) (-1350.607) [-1335.864] -- 0:01:18
695000 -- [-1339.783] (-1341.425) (-1339.126) (-1341.963) * (-1337.784) [-1347.642] (-1349.926) (-1341.620) -- 0:01:18
Average standard deviation of split frequencies: 0.007490
695500 -- (-1350.790) [-1347.674] (-1347.626) (-1347.971) * (-1338.669) (-1326.386) [-1322.074] (-1348.173) -- 0:01:17
696000 -- (-1350.773) (-1346.266) [-1316.811] (-1349.388) * (-1348.208) [-1318.963] (-1336.722) (-1333.434) -- 0:01:17
696500 -- (-1355.893) (-1341.610) [-1323.609] (-1346.744) * (-1335.244) (-1329.546) (-1344.414) [-1339.951] -- 0:01:17
697000 -- (-1347.192) (-1344.259) [-1334.750] (-1344.795) * (-1343.676) [-1330.145] (-1343.697) (-1354.855) -- 0:01:17
697500 -- (-1339.009) (-1347.813) [-1327.980] (-1350.390) * (-1341.279) [-1316.877] (-1347.474) (-1347.486) -- 0:01:17
698000 -- [-1337.202] (-1354.843) (-1343.108) (-1346.321) * (-1340.910) [-1335.080] (-1358.128) (-1352.911) -- 0:01:17
698500 -- [-1338.482] (-1351.045) (-1343.239) (-1350.009) * (-1356.704) [-1321.779] (-1347.307) (-1343.844) -- 0:01:17
699000 -- (-1344.338) (-1347.145) [-1345.249] (-1353.005) * (-1342.858) [-1329.535] (-1354.867) (-1344.519) -- 0:01:17
699500 -- [-1341.452] (-1350.748) (-1340.115) (-1348.610) * (-1339.328) (-1335.157) (-1355.332) [-1343.988] -- 0:01:16
700000 -- [-1331.849] (-1335.647) (-1346.494) (-1348.391) * (-1352.643) [-1333.538] (-1345.635) (-1338.202) -- 0:01:16
Average standard deviation of split frequencies: 0.006807
700500 -- [-1338.198] (-1344.755) (-1350.675) (-1342.511) * [-1340.252] (-1344.215) (-1345.858) (-1341.944) -- 0:01:16
701000 -- [-1336.234] (-1346.139) (-1338.006) (-1342.485) * (-1339.928) [-1320.759] (-1343.225) (-1333.082) -- 0:01:16
701500 -- (-1345.434) [-1341.120] (-1346.634) (-1347.377) * (-1345.995) [-1320.299] (-1347.031) (-1344.849) -- 0:01:16
702000 -- (-1343.388) (-1352.872) (-1354.654) [-1343.882] * (-1342.007) (-1344.225) [-1329.571] (-1337.388) -- 0:01:16
702500 -- (-1345.120) (-1358.335) [-1347.912] (-1343.152) * (-1350.258) [-1325.003] (-1349.858) (-1350.010) -- 0:01:16
703000 -- (-1346.571) (-1358.416) (-1333.979) [-1343.277] * (-1334.819) (-1349.760) [-1350.663] (-1341.425) -- 0:01:16
703500 -- (-1350.695) (-1346.964) [-1340.202] (-1349.693) * (-1338.925) (-1340.746) (-1352.856) [-1339.198] -- 0:01:15
704000 -- (-1351.609) (-1346.415) [-1339.957] (-1354.345) * (-1338.805) [-1334.913] (-1337.363) (-1343.445) -- 0:01:15
704500 -- (-1343.367) (-1356.619) (-1341.545) [-1335.382] * (-1351.560) [-1329.805] (-1343.369) (-1334.656) -- 0:01:15
705000 -- [-1336.649] (-1346.121) (-1338.634) (-1346.732) * (-1333.571) (-1328.657) (-1341.099) [-1332.925] -- 0:01:15
Average standard deviation of split frequencies: 0.007679
705500 -- [-1333.934] (-1354.444) (-1326.998) (-1348.023) * (-1341.979) [-1331.744] (-1346.370) (-1352.427) -- 0:01:15
706000 -- (-1332.686) (-1347.823) [-1319.798] (-1349.443) * (-1347.231) (-1339.640) (-1341.063) [-1327.793] -- 0:01:15
706500 -- (-1338.002) (-1349.666) [-1338.472] (-1363.525) * (-1344.621) (-1343.047) (-1343.316) [-1336.829] -- 0:01:15
707000 -- (-1349.125) (-1341.073) [-1330.914] (-1343.131) * [-1333.797] (-1342.192) (-1339.786) (-1342.279) -- 0:01:15
707500 -- (-1337.461) (-1342.512) [-1324.120] (-1346.055) * (-1339.960) [-1343.951] (-1349.957) (-1346.385) -- 0:01:14
708000 -- (-1345.587) (-1339.546) [-1314.656] (-1357.124) * (-1337.957) (-1344.837) (-1339.559) [-1323.567] -- 0:01:14
708500 -- (-1342.482) (-1344.821) [-1304.345] (-1340.018) * (-1343.905) (-1337.645) [-1336.591] (-1336.920) -- 0:01:14
709000 -- (-1350.974) (-1346.562) [-1314.600] (-1334.981) * [-1331.227] (-1336.323) (-1339.750) (-1348.707) -- 0:01:14
709500 -- (-1350.259) (-1339.387) [-1325.978] (-1336.122) * [-1317.314] (-1350.228) (-1344.814) (-1335.996) -- 0:01:14
710000 -- (-1345.780) (-1344.936) [-1323.140] (-1343.518) * (-1343.526) (-1343.336) (-1337.201) [-1324.946] -- 0:01:14
Average standard deviation of split frequencies: 0.007921
710500 -- (-1350.877) (-1358.055) [-1316.243] (-1343.237) * (-1337.286) (-1343.174) [-1321.341] (-1345.108) -- 0:01:14
711000 -- (-1341.422) (-1340.396) [-1334.973] (-1344.288) * (-1342.614) (-1342.038) [-1317.164] (-1339.669) -- 0:01:13
711500 -- (-1344.247) [-1342.963] (-1343.710) (-1334.578) * (-1345.908) (-1358.769) [-1321.608] (-1349.720) -- 0:01:13
712000 -- (-1337.655) [-1334.070] (-1346.728) (-1337.591) * (-1363.557) (-1350.702) [-1336.703] (-1325.893) -- 0:01:13
712500 -- (-1339.893) (-1334.547) (-1347.408) [-1342.057] * (-1342.109) (-1345.101) (-1349.022) [-1328.419] -- 0:01:13
713000 -- (-1337.048) (-1339.284) (-1349.731) [-1326.248] * (-1349.206) [-1333.436] (-1348.992) (-1336.685) -- 0:01:13
713500 -- (-1341.868) [-1331.524] (-1344.390) (-1337.163) * (-1346.392) (-1331.791) [-1339.931] (-1324.048) -- 0:01:13
714000 -- (-1344.223) [-1331.894] (-1354.432) (-1339.861) * (-1343.611) [-1328.028] (-1347.385) (-1343.556) -- 0:01:13
714500 -- (-1345.065) [-1322.574] (-1350.876) (-1351.894) * (-1341.218) (-1349.562) [-1344.446] (-1347.304) -- 0:01:13
715000 -- (-1350.768) (-1342.153) [-1344.139] (-1340.024) * [-1337.061] (-1344.282) (-1334.297) (-1336.344) -- 0:01:12
Average standard deviation of split frequencies: 0.008133
715500 -- (-1337.659) (-1341.594) (-1351.569) [-1340.505] * [-1334.498] (-1342.874) (-1340.862) (-1339.748) -- 0:01:12
716000 -- [-1325.799] (-1329.691) (-1345.460) (-1343.680) * [-1328.296] (-1339.768) (-1341.467) (-1354.223) -- 0:01:12
716500 -- [-1342.415] (-1334.827) (-1348.014) (-1352.251) * [-1329.350] (-1356.075) (-1340.953) (-1343.462) -- 0:01:12
717000 -- [-1321.750] (-1331.812) (-1343.338) (-1342.302) * [-1328.687] (-1349.577) (-1342.327) (-1319.916) -- 0:01:12
717500 -- (-1337.346) [-1327.630] (-1350.343) (-1330.424) * (-1364.198) (-1345.643) (-1341.530) [-1325.975] -- 0:01:12
718000 -- (-1349.055) (-1342.135) (-1336.574) [-1320.528] * (-1343.697) (-1340.761) (-1341.514) [-1337.744] -- 0:01:12
718500 -- (-1344.686) (-1349.360) (-1332.553) [-1329.194] * (-1340.886) (-1342.981) [-1342.108] (-1333.238) -- 0:01:12
719000 -- (-1355.047) (-1343.067) [-1337.165] (-1340.602) * (-1345.687) (-1349.429) [-1342.101] (-1338.842) -- 0:01:11
719500 -- (-1338.031) (-1349.537) [-1328.424] (-1346.376) * [-1323.139] (-1341.563) (-1341.327) (-1344.068) -- 0:01:11
720000 -- (-1339.866) (-1350.762) [-1314.594] (-1343.186) * (-1342.269) [-1321.241] (-1345.729) (-1343.427) -- 0:01:11
Average standard deviation of split frequencies: 0.007696
720500 -- [-1340.604] (-1346.464) (-1341.606) (-1349.938) * (-1345.228) (-1348.160) [-1340.679] (-1338.796) -- 0:01:11
721000 -- (-1341.792) (-1348.592) (-1322.058) [-1340.493] * (-1349.905) (-1341.471) (-1343.329) [-1343.755] -- 0:01:11
721500 -- (-1345.421) (-1359.814) [-1312.812] (-1337.512) * (-1346.014) [-1335.211] (-1340.905) (-1334.821) -- 0:01:11
722000 -- (-1339.170) (-1348.086) [-1317.707] (-1341.365) * (-1339.486) (-1316.467) [-1343.204] (-1341.637) -- 0:01:11
722500 -- (-1348.559) (-1351.776) [-1338.066] (-1346.776) * (-1347.405) [-1336.894] (-1338.106) (-1354.930) -- 0:01:11
723000 -- [-1338.736] (-1338.597) (-1341.079) (-1344.079) * (-1346.529) [-1334.885] (-1351.964) (-1335.941) -- 0:01:10
723500 -- [-1339.239] (-1340.644) (-1349.500) (-1347.982) * (-1339.498) [-1341.477] (-1347.750) (-1344.443) -- 0:01:10
724000 -- [-1336.620] (-1343.702) (-1341.872) (-1348.492) * (-1352.416) [-1321.378] (-1345.579) (-1344.999) -- 0:01:10
724500 -- [-1341.155] (-1349.890) (-1347.796) (-1337.607) * (-1351.299) [-1324.537] (-1341.807) (-1348.788) -- 0:01:10
725000 -- (-1338.540) [-1345.173] (-1339.247) (-1338.637) * (-1343.262) (-1337.945) [-1343.060] (-1346.681) -- 0:01:10
Average standard deviation of split frequencies: 0.007868
725500 -- [-1339.290] (-1344.865) (-1342.421) (-1341.969) * (-1350.257) [-1337.435] (-1335.802) (-1340.244) -- 0:01:10
726000 -- [-1336.169] (-1355.378) (-1344.988) (-1343.224) * (-1338.625) (-1353.566) [-1329.601] (-1342.144) -- 0:01:10
726500 -- [-1325.395] (-1340.023) (-1347.157) (-1349.349) * (-1344.812) (-1349.831) (-1336.865) [-1327.158] -- 0:01:10
727000 -- (-1340.338) (-1347.525) (-1339.517) [-1331.315] * (-1354.344) (-1352.726) (-1347.448) [-1324.331] -- 0:01:09
727500 -- (-1351.960) [-1335.535] (-1349.338) (-1319.988) * (-1349.756) (-1338.341) (-1338.029) [-1328.312] -- 0:01:09
728000 -- (-1350.170) (-1341.041) (-1343.404) [-1331.320] * [-1335.441] (-1340.356) (-1343.476) (-1318.219) -- 0:01:09
728500 -- (-1340.923) (-1348.518) (-1350.418) [-1339.981] * [-1331.955] (-1352.128) (-1343.750) (-1328.606) -- 0:01:09
729000 -- (-1349.077) [-1339.802] (-1338.158) (-1341.574) * (-1349.371) [-1347.463] (-1341.859) (-1327.057) -- 0:01:09
729500 -- (-1345.850) (-1339.102) (-1337.661) [-1326.183] * (-1340.669) [-1338.636] (-1341.719) (-1353.716) -- 0:01:09
730000 -- [-1337.246] (-1350.794) (-1341.766) (-1335.776) * (-1345.732) [-1340.170] (-1349.062) (-1348.056) -- 0:01:09
Average standard deviation of split frequencies: 0.007970
730500 -- (-1330.803) (-1345.828) (-1356.475) [-1326.060] * (-1341.822) [-1337.984] (-1355.411) (-1343.982) -- 0:01:08
731000 -- (-1339.394) [-1329.633] (-1350.260) (-1320.219) * (-1340.685) (-1347.093) [-1334.071] (-1343.409) -- 0:01:08
731500 -- (-1348.330) [-1323.800] (-1358.897) (-1326.379) * (-1346.158) [-1337.844] (-1347.893) (-1348.726) -- 0:01:08
732000 -- (-1349.436) [-1326.331] (-1354.130) (-1328.238) * (-1357.350) [-1319.797] (-1348.271) (-1361.266) -- 0:01:08
732500 -- (-1346.325) (-1336.131) (-1348.176) [-1314.512] * (-1346.308) [-1340.950] (-1345.218) (-1352.741) -- 0:01:08
733000 -- (-1344.729) (-1341.149) [-1340.020] (-1313.896) * (-1344.584) [-1326.325] (-1336.716) (-1345.727) -- 0:01:08
733500 -- (-1337.445) (-1356.048) (-1348.952) [-1325.849] * (-1340.871) [-1332.845] (-1343.173) (-1351.355) -- 0:01:08
734000 -- (-1331.561) (-1348.129) (-1351.365) [-1313.655] * (-1345.492) [-1341.340] (-1347.968) (-1346.071) -- 0:01:08
734500 -- (-1339.403) (-1351.770) (-1360.377) [-1325.536] * (-1337.744) [-1325.752] (-1344.372) (-1340.998) -- 0:01:07
735000 -- (-1347.234) (-1341.582) (-1335.443) [-1323.451] * (-1346.852) (-1346.084) [-1341.269] (-1363.935) -- 0:01:07
Average standard deviation of split frequencies: 0.008176
735500 -- (-1352.796) (-1351.535) (-1336.671) [-1333.166] * [-1338.175] (-1344.080) (-1358.741) (-1352.720) -- 0:01:07
736000 -- (-1342.505) [-1337.656] (-1345.564) (-1353.829) * [-1324.830] (-1340.703) (-1342.781) (-1357.752) -- 0:01:07
736500 -- (-1354.293) (-1339.049) (-1342.925) [-1340.768] * [-1340.674] (-1345.493) (-1336.525) (-1357.858) -- 0:01:07
737000 -- (-1351.782) (-1339.750) [-1342.368] (-1345.603) * (-1344.654) [-1339.716] (-1341.912) (-1350.486) -- 0:01:07
737500 -- (-1349.654) [-1337.672] (-1352.897) (-1347.201) * (-1356.685) [-1337.586] (-1344.432) (-1338.743) -- 0:01:07
738000 -- (-1343.862) [-1323.535] (-1342.827) (-1338.671) * (-1335.374) [-1329.139] (-1339.840) (-1345.627) -- 0:01:07
738500 -- (-1343.323) [-1326.307] (-1355.811) (-1351.550) * (-1348.304) [-1323.448] (-1339.896) (-1350.320) -- 0:01:06
739000 -- (-1336.474) (-1336.974) [-1343.156] (-1348.952) * [-1344.707] (-1348.647) (-1344.319) (-1340.050) -- 0:01:06
739500 -- (-1338.232) [-1337.376] (-1347.191) (-1332.301) * (-1342.187) [-1337.264] (-1338.131) (-1348.934) -- 0:01:06
740000 -- (-1333.916) (-1354.491) (-1350.933) [-1332.763] * [-1336.709] (-1347.867) (-1328.898) (-1336.962) -- 0:01:06
Average standard deviation of split frequencies: 0.008087
740500 -- (-1345.194) (-1346.065) (-1342.679) [-1322.522] * (-1344.005) (-1346.220) [-1316.510] (-1347.284) -- 0:01:06
741000 -- (-1337.653) (-1334.090) (-1335.526) [-1328.455] * [-1326.693] (-1341.253) (-1338.587) (-1346.062) -- 0:01:06
741500 -- (-1346.978) (-1342.279) (-1340.563) [-1332.680] * [-1314.171] (-1357.817) (-1345.822) (-1351.931) -- 0:01:06
742000 -- (-1343.242) [-1330.245] (-1338.242) (-1346.656) * [-1316.505] (-1348.203) (-1336.692) (-1341.443) -- 0:01:06
742500 -- (-1353.972) [-1323.233] (-1338.052) (-1338.672) * [-1314.618] (-1343.662) (-1336.430) (-1346.121) -- 0:01:05
743000 -- (-1334.421) (-1352.982) [-1335.962] (-1343.947) * [-1339.972] (-1354.914) (-1330.705) (-1347.500) -- 0:01:05
743500 -- (-1341.054) [-1347.355] (-1349.914) (-1353.329) * [-1328.978] (-1345.132) (-1335.067) (-1346.657) -- 0:01:05
744000 -- [-1327.968] (-1345.303) (-1343.744) (-1346.217) * [-1333.478] (-1345.787) (-1337.031) (-1343.501) -- 0:01:05
744500 -- (-1339.551) (-1341.670) [-1330.485] (-1343.374) * (-1353.357) [-1340.431] (-1339.739) (-1352.490) -- 0:01:05
745000 -- (-1337.658) (-1343.576) [-1329.672] (-1346.739) * [-1335.614] (-1348.382) (-1338.504) (-1344.648) -- 0:01:05
Average standard deviation of split frequencies: 0.007546
745500 -- [-1340.045] (-1344.799) (-1337.950) (-1345.329) * (-1338.428) (-1348.279) [-1337.046] (-1346.454) -- 0:01:05
746000 -- [-1345.100] (-1348.170) (-1345.116) (-1344.718) * [-1327.622] (-1345.423) (-1333.211) (-1349.343) -- 0:01:05
746500 -- (-1340.660) [-1326.543] (-1353.265) (-1345.162) * (-1339.261) (-1331.396) [-1317.703] (-1342.272) -- 0:01:04
747000 -- (-1342.807) [-1307.302] (-1344.504) (-1340.396) * (-1345.396) (-1344.137) [-1328.808] (-1353.705) -- 0:01:04
747500 -- [-1339.710] (-1323.061) (-1335.237) (-1328.087) * (-1354.052) [-1339.204] (-1340.420) (-1345.273) -- 0:01:04
748000 -- (-1345.631) (-1338.654) (-1340.636) [-1331.973] * [-1334.126] (-1346.959) (-1347.308) (-1344.401) -- 0:01:04
748500 -- (-1343.007) (-1346.379) [-1327.732] (-1341.280) * [-1343.784] (-1340.018) (-1352.145) (-1345.820) -- 0:01:04
749000 -- (-1340.494) (-1350.997) (-1342.373) [-1338.572] * (-1345.485) (-1338.283) (-1355.788) [-1333.901] -- 0:01:04
749500 -- (-1330.943) (-1345.549) [-1344.362] (-1340.980) * (-1341.858) (-1349.094) (-1344.075) [-1333.267] -- 0:01:04
750000 -- (-1334.401) (-1352.385) (-1342.473) [-1331.249] * (-1344.801) (-1342.159) (-1347.878) [-1331.857] -- 0:01:04
Average standard deviation of split frequencies: 0.007573
750500 -- (-1341.418) (-1343.700) (-1346.419) [-1329.581] * (-1352.419) (-1341.000) (-1351.928) [-1326.154] -- 0:01:03
751000 -- [-1323.361] (-1347.635) (-1339.879) (-1338.343) * (-1353.028) (-1342.216) (-1350.588) [-1325.341] -- 0:01:03
751500 -- (-1353.486) (-1341.465) [-1334.944] (-1343.640) * (-1346.423) [-1336.633] (-1342.111) (-1330.146) -- 0:01:03
752000 -- (-1346.687) (-1337.827) [-1343.484] (-1343.786) * (-1341.147) [-1341.760] (-1351.456) (-1333.297) -- 0:01:03
752500 -- (-1362.720) (-1336.729) [-1318.474] (-1330.604) * (-1344.561) (-1346.505) (-1336.977) [-1327.904] -- 0:01:03
753000 -- (-1350.699) (-1349.220) [-1325.811] (-1340.115) * (-1339.966) (-1343.489) (-1349.670) [-1326.344] -- 0:01:03
753500 -- (-1339.311) (-1350.206) [-1312.692] (-1336.902) * [-1338.108] (-1348.732) (-1348.444) (-1343.926) -- 0:01:03
754000 -- (-1342.230) (-1340.156) [-1330.698] (-1330.898) * [-1326.291] (-1351.011) (-1344.168) (-1339.856) -- 0:01:02
754500 -- (-1339.990) (-1360.355) [-1318.335] (-1344.197) * [-1328.479] (-1350.586) (-1334.422) (-1348.626) -- 0:01:02
755000 -- (-1336.974) (-1352.590) (-1323.997) [-1335.644] * [-1315.278] (-1357.729) (-1344.260) (-1344.619) -- 0:01:02
Average standard deviation of split frequencies: 0.007006
755500 -- (-1336.248) (-1351.791) (-1338.793) [-1333.692] * [-1323.594] (-1350.134) (-1347.379) (-1342.565) -- 0:01:02
756000 -- [-1320.715] (-1355.098) (-1331.144) (-1338.872) * [-1308.612] (-1356.115) (-1342.979) (-1340.152) -- 0:01:02
756500 -- [-1339.746] (-1342.509) (-1352.565) (-1330.449) * [-1311.149] (-1330.599) (-1338.106) (-1352.338) -- 0:01:02
757000 -- (-1329.096) (-1346.067) (-1336.937) [-1343.827] * [-1323.463] (-1329.838) (-1342.267) (-1346.227) -- 0:01:02
757500 -- [-1329.753] (-1351.709) (-1340.756) (-1346.440) * (-1348.940) [-1332.770] (-1340.597) (-1338.536) -- 0:01:02
758000 -- [-1330.439] (-1346.128) (-1349.651) (-1341.307) * (-1342.258) (-1344.975) [-1337.198] (-1346.156) -- 0:01:01
758500 -- (-1342.004) [-1334.739] (-1330.979) (-1344.813) * [-1348.849] (-1345.794) (-1345.530) (-1337.004) -- 0:01:01
759000 -- (-1343.127) (-1338.083) (-1336.676) [-1338.858] * (-1348.954) [-1336.620] (-1347.845) (-1339.397) -- 0:01:01
759500 -- (-1349.566) (-1337.728) (-1335.278) [-1320.903] * [-1327.079] (-1347.540) (-1340.541) (-1336.202) -- 0:01:01
760000 -- (-1335.473) (-1343.593) (-1341.268) [-1315.466] * [-1333.935] (-1342.880) (-1340.684) (-1341.688) -- 0:01:01
Average standard deviation of split frequencies: 0.006598
760500 -- (-1327.629) (-1340.978) [-1330.148] (-1331.277) * [-1332.892] (-1345.602) (-1329.506) (-1340.553) -- 0:01:01
761000 -- (-1346.571) (-1347.865) (-1342.863) [-1313.925] * [-1336.967] (-1333.837) (-1332.179) (-1349.542) -- 0:01:01
761500 -- [-1318.224] (-1349.963) (-1348.762) (-1329.612) * (-1340.717) [-1324.578] (-1339.406) (-1356.848) -- 0:01:01
762000 -- [-1313.901] (-1353.938) (-1334.718) (-1329.970) * (-1352.621) [-1321.250] (-1351.660) (-1342.886) -- 0:01:00
762500 -- [-1325.502] (-1345.648) (-1341.412) (-1340.011) * (-1345.326) [-1348.360] (-1350.449) (-1343.734) -- 0:01:00
763000 -- [-1317.771] (-1346.432) (-1344.043) (-1339.190) * [-1335.341] (-1344.525) (-1343.964) (-1353.921) -- 0:01:00
763500 -- (-1340.324) [-1332.146] (-1347.605) (-1354.871) * [-1325.810] (-1342.476) (-1345.176) (-1341.433) -- 0:01:00
764000 -- [-1335.933] (-1345.999) (-1325.932) (-1349.159) * [-1338.627] (-1337.404) (-1347.278) (-1343.665) -- 0:01:00
764500 -- (-1347.810) [-1324.653] (-1332.940) (-1345.310) * [-1334.729] (-1337.015) (-1355.987) (-1350.171) -- 0:01:00
765000 -- (-1344.747) [-1319.281] (-1332.324) (-1345.377) * (-1342.637) (-1344.471) (-1359.755) [-1331.446] -- 0:01:00
Average standard deviation of split frequencies: 0.006444
765500 -- (-1342.460) [-1313.020] (-1323.170) (-1339.600) * [-1328.796] (-1344.949) (-1339.507) (-1353.353) -- 0:01:00
766000 -- (-1337.575) (-1310.354) [-1327.401] (-1344.532) * [-1329.126] (-1347.152) (-1339.477) (-1341.913) -- 0:00:59
766500 -- (-1352.125) [-1326.401] (-1341.532) (-1338.704) * (-1352.744) (-1351.464) [-1325.417] (-1333.422) -- 0:00:59
767000 -- (-1345.414) (-1352.818) (-1336.937) [-1341.321] * (-1345.026) [-1341.028] (-1343.674) (-1341.819) -- 0:00:59
767500 -- (-1349.646) (-1348.169) [-1337.788] (-1337.302) * (-1342.056) (-1342.689) (-1344.242) [-1330.875] -- 0:00:59
768000 -- (-1337.867) (-1350.241) [-1323.111] (-1341.184) * (-1351.320) (-1345.977) (-1346.311) [-1337.943] -- 0:00:59
768500 -- [-1333.836] (-1345.092) (-1333.009) (-1345.163) * (-1342.472) (-1350.616) (-1340.775) [-1325.949] -- 0:00:59
769000 -- (-1337.798) (-1340.570) [-1321.811] (-1345.466) * (-1336.913) (-1346.000) (-1339.534) [-1324.166] -- 0:00:59
769500 -- (-1344.975) (-1345.779) [-1317.706] (-1352.858) * (-1343.083) (-1347.310) (-1342.744) [-1324.805] -- 0:00:59
770000 -- (-1347.367) (-1338.367) [-1333.811] (-1341.631) * (-1343.023) (-1345.761) (-1357.754) [-1331.377] -- 0:00:58
Average standard deviation of split frequencies: 0.006980
770500 -- (-1349.365) (-1349.824) [-1324.823] (-1338.662) * (-1345.254) (-1340.930) (-1346.794) [-1318.162] -- 0:00:58
771000 -- (-1352.118) (-1349.573) (-1340.229) [-1340.919] * (-1339.687) (-1335.510) (-1354.538) [-1338.930] -- 0:00:58
771500 -- [-1329.973] (-1349.614) (-1335.501) (-1350.295) * (-1339.741) (-1341.477) (-1341.131) [-1333.044] -- 0:00:58
772000 -- [-1320.021] (-1345.007) (-1341.911) (-1338.414) * (-1343.718) (-1341.191) (-1340.940) [-1333.412] -- 0:00:58
772500 -- [-1317.534] (-1340.129) (-1337.874) (-1358.109) * (-1338.948) [-1334.815] (-1350.533) (-1337.184) -- 0:00:58
773000 -- [-1318.879] (-1340.890) (-1346.864) (-1345.362) * (-1347.986) (-1341.734) (-1343.379) [-1328.047] -- 0:00:58
773500 -- (-1330.379) [-1335.924] (-1345.566) (-1342.141) * (-1340.675) [-1322.364] (-1343.303) (-1336.510) -- 0:00:57
774000 -- (-1341.728) (-1332.345) [-1346.089] (-1339.383) * (-1343.842) [-1321.565] (-1339.666) (-1351.289) -- 0:00:57
774500 -- (-1353.879) (-1333.557) [-1338.367] (-1337.655) * (-1343.296) [-1329.455] (-1340.729) (-1343.140) -- 0:00:57
775000 -- (-1342.458) (-1338.393) (-1340.630) [-1337.748] * [-1331.489] (-1335.698) (-1356.914) (-1327.223) -- 0:00:57
Average standard deviation of split frequencies: 0.006825
775500 -- (-1347.610) (-1332.950) (-1347.597) [-1341.115] * (-1353.035) (-1344.542) (-1347.014) [-1328.689] -- 0:00:57
776000 -- (-1351.506) [-1334.922] (-1347.174) (-1335.392) * (-1353.528) (-1342.351) (-1359.070) [-1319.532] -- 0:00:57
776500 -- (-1335.565) (-1345.970) (-1352.703) [-1325.828] * (-1340.628) (-1335.513) (-1336.447) [-1337.229] -- 0:00:57
777000 -- (-1349.058) (-1342.541) (-1333.591) [-1331.675] * (-1343.058) (-1345.894) (-1348.256) [-1330.297] -- 0:00:57
777500 -- (-1347.725) (-1345.227) [-1326.684] (-1350.720) * (-1344.105) (-1336.577) (-1347.259) [-1340.551] -- 0:00:56
778000 -- (-1347.090) (-1345.238) (-1339.312) [-1327.506] * (-1346.922) (-1338.750) [-1344.422] (-1334.598) -- 0:00:56
778500 -- (-1340.283) (-1342.083) (-1329.839) [-1324.101] * (-1338.546) (-1350.479) [-1342.105] (-1350.936) -- 0:00:56
779000 -- (-1343.050) (-1344.387) [-1327.466] (-1349.183) * (-1340.099) (-1345.262) [-1334.952] (-1344.103) -- 0:00:56
779500 -- (-1351.556) (-1339.230) [-1329.657] (-1343.430) * (-1347.543) (-1341.829) [-1338.987] (-1343.011) -- 0:00:56
780000 -- (-1343.684) [-1327.632] (-1339.253) (-1343.214) * [-1334.432] (-1349.545) (-1323.376) (-1353.890) -- 0:00:56
Average standard deviation of split frequencies: 0.007211
780500 -- (-1345.325) [-1336.438] (-1343.670) (-1350.991) * (-1341.367) (-1348.269) (-1330.184) [-1331.714] -- 0:00:56
781000 -- (-1346.808) (-1347.333) [-1327.865] (-1340.694) * (-1336.516) (-1342.337) [-1324.100] (-1342.056) -- 0:00:56
781500 -- (-1342.958) (-1343.584) [-1343.363] (-1351.072) * (-1344.986) (-1340.123) [-1332.455] (-1344.738) -- 0:00:55
782000 -- [-1343.967] (-1343.542) (-1352.599) (-1341.789) * (-1342.046) [-1329.795] (-1349.541) (-1335.048) -- 0:00:55
782500 -- [-1338.772] (-1338.101) (-1348.220) (-1344.135) * (-1325.064) (-1341.755) [-1322.052] (-1341.419) -- 0:00:55
783000 -- [-1332.061] (-1355.835) (-1348.264) (-1349.938) * [-1322.579] (-1349.565) (-1339.467) (-1340.399) -- 0:00:55
783500 -- (-1335.357) (-1346.198) (-1351.165) [-1350.473] * (-1329.854) (-1351.186) (-1341.394) [-1326.958] -- 0:00:55
784000 -- (-1340.388) (-1347.727) (-1339.919) [-1319.348] * [-1325.722] (-1340.385) (-1340.404) (-1332.038) -- 0:00:55
784500 -- (-1344.557) (-1346.431) (-1350.619) [-1342.582] * (-1341.639) (-1338.187) (-1331.548) [-1322.517] -- 0:00:55
785000 -- (-1333.051) (-1350.594) (-1347.590) [-1333.837] * (-1341.699) [-1327.832] (-1346.443) (-1340.108) -- 0:00:55
Average standard deviation of split frequencies: 0.007303
785500 -- (-1337.069) (-1343.455) (-1345.610) [-1339.280] * (-1350.014) (-1336.880) [-1324.755] (-1344.091) -- 0:00:54
786000 -- (-1331.755) (-1344.870) (-1354.997) [-1335.284] * [-1325.715] (-1336.207) (-1331.261) (-1344.169) -- 0:00:54
786500 -- (-1340.973) (-1344.707) (-1357.331) [-1333.518] * [-1322.095] (-1332.851) (-1346.031) (-1345.979) -- 0:00:54
787000 -- (-1337.747) (-1353.537) (-1347.285) [-1329.142] * (-1330.013) (-1343.105) [-1339.060] (-1347.762) -- 0:00:54
787500 -- (-1341.125) (-1348.730) (-1340.382) [-1325.680] * [-1333.485] (-1345.060) (-1348.296) (-1344.322) -- 0:00:54
788000 -- (-1348.954) (-1340.164) (-1337.924) [-1333.207] * [-1334.888] (-1347.052) (-1337.428) (-1340.772) -- 0:00:54
788500 -- (-1354.430) (-1354.049) (-1346.267) [-1323.624] * (-1329.486) (-1345.360) [-1333.241] (-1337.895) -- 0:00:54
789000 -- (-1341.556) [-1331.644] (-1343.107) (-1344.915) * [-1332.550] (-1328.469) (-1330.988) (-1351.814) -- 0:00:54
789500 -- (-1343.756) [-1334.999] (-1345.835) (-1341.675) * (-1349.784) (-1347.054) [-1333.865] (-1345.491) -- 0:00:53
790000 -- (-1348.569) [-1336.264] (-1339.960) (-1339.377) * (-1349.522) [-1334.090] (-1343.272) (-1340.347) -- 0:00:53
Average standard deviation of split frequencies: 0.007435
790500 -- [-1334.227] (-1352.416) (-1341.118) (-1345.688) * (-1344.756) (-1344.864) [-1321.742] (-1347.128) -- 0:00:53
791000 -- (-1341.051) (-1347.367) [-1337.358] (-1345.925) * (-1352.896) [-1330.649] (-1342.441) (-1340.877) -- 0:00:53
791500 -- (-1351.759) (-1342.533) [-1334.569] (-1352.441) * (-1342.747) (-1338.583) (-1341.396) [-1334.763] -- 0:00:53
792000 -- (-1351.407) (-1348.122) [-1335.955] (-1343.368) * (-1336.479) (-1339.335) [-1340.628] (-1338.818) -- 0:00:53
792500 -- (-1342.972) (-1340.743) [-1341.598] (-1343.631) * (-1335.452) [-1336.435] (-1339.568) (-1340.631) -- 0:00:53
793000 -- [-1340.203] (-1346.862) (-1346.059) (-1340.122) * (-1340.076) (-1342.195) [-1328.145] (-1354.049) -- 0:00:52
793500 -- (-1344.812) (-1354.227) (-1351.128) [-1331.490] * (-1355.050) (-1345.920) [-1326.406] (-1344.488) -- 0:00:52
794000 -- (-1335.175) (-1340.785) [-1356.273] (-1343.950) * (-1341.711) [-1325.073] (-1346.810) (-1342.948) -- 0:00:52
794500 -- (-1342.632) [-1344.856] (-1340.906) (-1346.585) * (-1335.390) [-1341.297] (-1348.212) (-1347.290) -- 0:00:52
795000 -- [-1339.528] (-1341.498) (-1331.323) (-1346.948) * (-1334.361) [-1340.916] (-1322.850) (-1354.947) -- 0:00:52
Average standard deviation of split frequencies: 0.007246
795500 -- (-1343.284) [-1331.201] (-1345.633) (-1357.510) * (-1346.385) (-1349.052) [-1327.068] (-1343.514) -- 0:00:52
796000 -- [-1339.206] (-1353.380) (-1338.889) (-1351.911) * (-1343.903) (-1340.446) (-1333.326) [-1325.007] -- 0:00:52
796500 -- (-1332.696) [-1336.173] (-1337.105) (-1355.824) * (-1338.390) (-1336.531) (-1350.340) [-1310.003] -- 0:00:52
797000 -- (-1342.488) [-1336.477] (-1344.523) (-1350.014) * (-1353.729) (-1332.018) (-1340.884) [-1320.433] -- 0:00:51
797500 -- (-1338.729) [-1336.401] (-1341.519) (-1336.152) * (-1348.973) (-1345.343) (-1323.337) [-1344.076] -- 0:00:51
798000 -- (-1338.750) (-1349.164) [-1326.837] (-1346.073) * (-1335.523) (-1346.079) [-1331.225] (-1337.044) -- 0:00:51
798500 -- [-1337.834] (-1348.215) (-1339.039) (-1355.766) * (-1327.980) (-1344.248) (-1346.112) [-1320.562] -- 0:00:51
799000 -- [-1345.638] (-1347.403) (-1350.211) (-1340.936) * (-1340.552) [-1344.144] (-1349.801) (-1338.890) -- 0:00:51
799500 -- [-1333.704] (-1348.304) (-1340.280) (-1356.560) * [-1345.349] (-1358.424) (-1340.137) (-1345.536) -- 0:00:51
800000 -- (-1340.564) (-1346.628) [-1322.566] (-1350.711) * (-1337.880) (-1333.072) (-1343.822) [-1341.454] -- 0:00:51
Average standard deviation of split frequencies: 0.007689
800500 -- (-1348.096) (-1347.204) [-1321.989] (-1345.370) * (-1337.883) [-1333.465] (-1339.393) (-1341.192) -- 0:00:51
801000 -- (-1342.524) (-1343.019) (-1342.587) [-1337.359] * (-1342.218) [-1329.410] (-1343.615) (-1331.680) -- 0:00:50
801500 -- (-1353.738) (-1343.217) [-1330.467] (-1335.297) * (-1352.134) (-1337.204) (-1354.145) [-1337.346] -- 0:00:50
802000 -- (-1337.747) (-1343.761) [-1334.069] (-1342.073) * (-1362.681) (-1336.901) (-1350.759) [-1334.755] -- 0:00:50
802500 -- (-1343.560) (-1339.427) (-1345.926) [-1333.700] * (-1338.237) [-1315.115] (-1339.890) (-1355.013) -- 0:00:50
803000 -- (-1354.991) (-1340.109) (-1336.067) [-1321.354] * (-1347.492) [-1324.454] (-1335.115) (-1347.104) -- 0:00:50
803500 -- (-1350.542) (-1344.892) (-1342.218) [-1321.506] * [-1328.734] (-1341.833) (-1346.901) (-1350.440) -- 0:00:50
804000 -- (-1363.156) (-1345.550) [-1335.262] (-1321.355) * [-1312.082] (-1334.494) (-1345.239) (-1345.090) -- 0:00:50
804500 -- (-1349.820) (-1343.264) [-1330.196] (-1346.713) * [-1332.750] (-1323.040) (-1340.521) (-1350.793) -- 0:00:50
805000 -- (-1348.161) (-1346.599) [-1320.080] (-1352.605) * (-1325.199) [-1321.683] (-1353.664) (-1345.571) -- 0:00:49
Average standard deviation of split frequencies: 0.007638
805500 -- (-1345.098) (-1334.725) [-1334.585] (-1344.417) * (-1336.357) [-1336.125] (-1348.332) (-1347.948) -- 0:00:49
806000 -- (-1340.731) (-1343.786) [-1337.207] (-1352.536) * [-1326.027] (-1337.638) (-1354.163) (-1351.922) -- 0:00:49
806500 -- (-1338.611) (-1350.664) [-1315.737] (-1350.516) * (-1343.669) (-1329.327) [-1341.213] (-1356.946) -- 0:00:49
807000 -- (-1340.890) (-1341.883) [-1329.002] (-1355.468) * (-1349.105) [-1330.754] (-1342.847) (-1347.410) -- 0:00:49
807500 -- (-1338.630) (-1340.525) [-1323.856] (-1352.881) * (-1342.737) (-1339.649) [-1318.762] (-1347.808) -- 0:00:49
808000 -- (-1345.349) (-1341.389) [-1342.127] (-1347.243) * [-1336.363] (-1338.940) (-1344.735) (-1344.814) -- 0:00:49
808500 -- (-1343.057) (-1345.366) [-1332.715] (-1353.453) * (-1345.349) (-1348.467) [-1339.323] (-1343.600) -- 0:00:49
809000 -- [-1329.575] (-1346.087) (-1340.366) (-1344.024) * [-1348.915] (-1335.971) (-1338.615) (-1342.694) -- 0:00:48
809500 -- [-1330.777] (-1349.002) (-1338.590) (-1341.637) * (-1342.461) [-1338.248] (-1339.606) (-1345.619) -- 0:00:48
810000 -- (-1344.644) (-1346.661) (-1338.801) [-1332.825] * [-1323.490] (-1335.708) (-1350.141) (-1349.368) -- 0:00:48
Average standard deviation of split frequencies: 0.007662
810500 -- (-1357.763) (-1355.268) [-1323.497] (-1345.094) * [-1329.261] (-1349.427) (-1347.636) (-1343.118) -- 0:00:48
811000 -- (-1339.891) (-1362.649) [-1317.127] (-1334.775) * [-1326.962] (-1344.343) (-1341.785) (-1342.442) -- 0:00:48
811500 -- (-1345.530) (-1352.045) [-1321.706] (-1340.357) * [-1329.003] (-1340.367) (-1361.333) (-1342.608) -- 0:00:48
812000 -- (-1349.585) (-1348.717) (-1332.032) [-1344.880] * [-1317.927] (-1320.886) (-1343.143) (-1336.975) -- 0:00:48
812500 -- (-1345.008) (-1347.216) [-1344.774] (-1342.419) * (-1348.109) [-1315.213] (-1343.175) (-1334.708) -- 0:00:48
813000 -- [-1346.228] (-1343.579) (-1352.398) (-1339.961) * (-1345.185) [-1313.195] (-1348.856) (-1324.601) -- 0:00:47
813500 -- [-1336.418] (-1345.372) (-1347.698) (-1340.191) * [-1349.225] (-1345.070) (-1356.125) (-1342.998) -- 0:00:47
814000 -- [-1329.263] (-1337.709) (-1346.435) (-1341.588) * (-1347.031) [-1343.656] (-1341.315) (-1345.095) -- 0:00:47
814500 -- (-1334.527) [-1331.921] (-1343.929) (-1350.198) * (-1348.572) [-1336.194] (-1347.520) (-1356.766) -- 0:00:47
815000 -- [-1327.206] (-1341.729) (-1341.536) (-1334.319) * (-1344.165) (-1339.518) [-1345.442] (-1357.377) -- 0:00:47
Average standard deviation of split frequencies: 0.008156
815500 -- (-1350.287) [-1343.627] (-1348.416) (-1344.572) * (-1353.605) (-1353.844) (-1341.312) [-1337.751] -- 0:00:47
816000 -- [-1329.239] (-1333.595) (-1348.306) (-1351.682) * [-1340.051] (-1349.047) (-1336.313) (-1337.110) -- 0:00:47
816500 -- (-1326.073) (-1347.292) (-1337.650) [-1335.214] * (-1358.226) (-1341.850) (-1340.345) [-1323.525] -- 0:00:46
817000 -- [-1322.236] (-1342.795) (-1342.358) (-1349.222) * (-1348.938) [-1340.254] (-1355.111) (-1332.977) -- 0:00:46
817500 -- (-1338.140) (-1338.372) (-1347.286) [-1324.938] * (-1348.187) [-1328.549] (-1352.927) (-1339.583) -- 0:00:46
818000 -- (-1339.690) (-1341.015) [-1325.487] (-1350.000) * (-1335.246) (-1341.405) [-1344.989] (-1348.342) -- 0:00:46
818500 -- (-1347.776) (-1345.209) [-1327.700] (-1341.422) * [-1331.564] (-1348.427) (-1343.358) (-1352.934) -- 0:00:46
819000 -- (-1344.133) (-1346.479) (-1336.515) [-1348.711] * [-1325.382] (-1356.141) (-1349.326) (-1333.132) -- 0:00:46
819500 -- (-1351.452) [-1341.218] (-1342.221) (-1338.044) * (-1328.930) (-1341.392) (-1334.315) [-1330.364] -- 0:00:46
820000 -- (-1344.120) [-1332.562] (-1344.654) (-1338.589) * [-1326.441] (-1355.279) (-1342.513) (-1336.248) -- 0:00:46
Average standard deviation of split frequencies: 0.008211
820500 -- (-1341.973) [-1335.345] (-1352.663) (-1344.125) * [-1335.794] (-1347.968) (-1342.739) (-1345.537) -- 0:00:45
821000 -- (-1336.953) (-1351.585) [-1337.009] (-1338.783) * (-1340.017) (-1347.870) [-1336.895] (-1345.912) -- 0:00:45
821500 -- (-1343.226) (-1351.772) (-1336.232) [-1339.662] * (-1342.751) (-1339.174) (-1341.912) [-1338.686] -- 0:00:45
822000 -- (-1352.480) (-1348.163) (-1351.181) [-1340.968] * (-1343.124) (-1343.891) (-1331.717) [-1331.521] -- 0:00:45
822500 -- (-1340.107) (-1347.677) (-1355.849) [-1341.478] * (-1354.697) (-1348.180) [-1331.714] (-1341.756) -- 0:00:45
823000 -- (-1346.995) (-1349.822) (-1362.678) [-1316.836] * (-1352.836) [-1343.054] (-1352.974) (-1345.548) -- 0:00:45
823500 -- (-1354.367) (-1364.469) (-1332.613) [-1329.710] * (-1347.136) (-1354.408) (-1336.699) [-1319.263] -- 0:00:45
824000 -- [-1339.034] (-1335.048) (-1360.239) (-1329.305) * (-1345.653) (-1339.151) [-1340.055] (-1346.399) -- 0:00:45
824500 -- [-1329.151] (-1344.339) (-1352.182) (-1342.056) * [-1329.038] (-1347.098) (-1342.329) (-1344.120) -- 0:00:44
825000 -- (-1352.258) [-1342.335] (-1346.438) (-1336.845) * [-1336.644] (-1335.990) (-1345.073) (-1348.259) -- 0:00:44
Average standard deviation of split frequencies: 0.008258
825500 -- (-1347.964) (-1349.594) (-1334.534) [-1341.829] * [-1342.111] (-1338.375) (-1334.390) (-1349.736) -- 0:00:44
826000 -- [-1329.051] (-1348.599) (-1346.071) (-1346.214) * (-1340.649) (-1341.221) [-1340.635] (-1350.828) -- 0:00:44
826500 -- (-1335.019) (-1349.960) [-1333.082] (-1347.103) * (-1340.701) (-1344.526) [-1341.756] (-1341.784) -- 0:00:44
827000 -- (-1338.777) (-1361.023) [-1335.936] (-1340.013) * (-1341.182) (-1345.060) (-1340.177) [-1335.147] -- 0:00:44
827500 -- [-1319.431] (-1346.080) (-1347.369) (-1347.663) * (-1341.923) (-1343.443) (-1345.607) [-1340.000] -- 0:00:44
828000 -- (-1338.211) (-1345.871) [-1333.773] (-1347.697) * [-1331.440] (-1346.462) (-1348.970) (-1347.245) -- 0:00:44
828500 -- [-1340.854] (-1346.693) (-1343.284) (-1340.444) * (-1338.649) (-1345.126) [-1335.527] (-1347.676) -- 0:00:43
829000 -- (-1354.349) [-1338.697] (-1349.408) (-1342.052) * [-1335.754] (-1345.306) (-1343.836) (-1336.312) -- 0:00:43
829500 -- (-1344.606) [-1337.771] (-1337.525) (-1345.522) * (-1346.235) (-1353.452) [-1345.984] (-1348.745) -- 0:00:43
830000 -- (-1338.569) (-1346.568) (-1347.711) [-1342.590] * (-1345.725) (-1345.140) [-1350.036] (-1348.804) -- 0:00:43
Average standard deviation of split frequencies: 0.008346
830500 -- [-1333.689] (-1342.003) (-1345.457) (-1345.676) * (-1333.018) (-1351.155) (-1342.600) [-1342.539] -- 0:00:43
831000 -- [-1338.210] (-1350.857) (-1345.168) (-1347.842) * (-1337.778) (-1353.774) [-1326.378] (-1346.436) -- 0:00:43
831500 -- (-1339.137) (-1341.888) [-1328.945] (-1341.713) * [-1338.817] (-1348.436) (-1341.593) (-1347.428) -- 0:00:43
832000 -- [-1321.872] (-1352.363) (-1331.030) (-1347.615) * [-1336.530] (-1339.069) (-1348.944) (-1346.045) -- 0:00:43
832500 -- (-1338.413) [-1345.734] (-1344.882) (-1348.232) * (-1331.226) (-1350.390) [-1308.406] (-1351.035) -- 0:00:42
833000 -- (-1347.098) [-1334.686] (-1354.353) (-1348.321) * (-1330.602) (-1345.795) (-1338.018) [-1332.760] -- 0:00:42
833500 -- [-1340.372] (-1344.689) (-1353.237) (-1339.070) * (-1332.163) (-1340.373) (-1340.115) [-1330.753] -- 0:00:42
834000 -- [-1336.724] (-1335.565) (-1358.751) (-1337.988) * (-1350.731) (-1348.147) (-1333.896) [-1335.524] -- 0:00:42
834500 -- (-1336.874) (-1334.144) (-1346.693) [-1343.854] * (-1337.036) (-1340.432) [-1341.269] (-1350.501) -- 0:00:42
835000 -- (-1335.787) [-1332.821] (-1335.888) (-1347.030) * (-1350.921) (-1339.452) [-1334.424] (-1343.006) -- 0:00:42
Average standard deviation of split frequencies: 0.008558
835500 -- [-1323.922] (-1347.732) (-1339.858) (-1347.361) * (-1351.258) [-1341.407] (-1350.233) (-1344.978) -- 0:00:42
836000 -- (-1325.806) (-1350.236) [-1323.811] (-1342.556) * (-1353.388) (-1343.463) (-1340.211) [-1336.318] -- 0:00:41
836500 -- (-1337.575) [-1342.450] (-1349.849) (-1341.122) * (-1349.992) (-1340.505) [-1336.256] (-1342.994) -- 0:00:41
837000 -- (-1333.394) (-1341.371) (-1349.659) [-1334.610] * (-1358.507) (-1343.486) [-1337.765] (-1349.580) -- 0:00:41
837500 -- [-1330.396] (-1350.028) (-1342.742) (-1344.683) * (-1349.770) (-1339.095) (-1338.379) [-1328.972] -- 0:00:41
838000 -- (-1346.900) [-1337.193] (-1331.452) (-1348.032) * (-1340.022) (-1334.312) (-1341.892) [-1343.612] -- 0:00:41
838500 -- (-1344.751) [-1338.075] (-1348.039) (-1354.096) * (-1328.083) (-1343.902) (-1344.164) [-1332.368] -- 0:00:41
839000 -- [-1326.880] (-1336.365) (-1344.098) (-1347.447) * [-1340.624] (-1361.431) (-1332.909) (-1335.172) -- 0:00:41
839500 -- (-1338.297) (-1350.777) (-1336.268) [-1329.094] * (-1365.511) (-1347.778) [-1339.517] (-1339.508) -- 0:00:41
840000 -- (-1340.914) (-1346.750) [-1336.882] (-1339.112) * (-1345.296) (-1340.075) [-1321.671] (-1347.891) -- 0:00:40
Average standard deviation of split frequencies: 0.008114
840500 -- [-1332.880] (-1343.264) (-1350.661) (-1347.550) * [-1332.525] (-1344.586) (-1342.096) (-1330.585) -- 0:00:40
841000 -- (-1338.016) [-1342.454] (-1351.682) (-1339.612) * (-1336.570) (-1349.321) (-1345.515) [-1330.587] -- 0:00:40
841500 -- (-1339.388) (-1342.886) (-1342.061) [-1323.724] * [-1327.356] (-1346.986) (-1341.989) (-1340.196) -- 0:00:40
842000 -- (-1348.138) (-1338.906) [-1340.236] (-1322.474) * (-1342.273) [-1336.777] (-1338.025) (-1336.429) -- 0:00:40
842500 -- (-1353.231) (-1347.725) [-1332.320] (-1328.602) * (-1328.009) [-1336.210] (-1343.187) (-1350.680) -- 0:00:40
843000 -- [-1336.890] (-1347.543) (-1344.840) (-1341.076) * [-1333.065] (-1336.380) (-1334.159) (-1361.931) -- 0:00:40
843500 -- [-1332.307] (-1349.885) (-1336.771) (-1351.108) * (-1337.009) (-1333.968) [-1329.104] (-1350.741) -- 0:00:40
844000 -- (-1340.587) (-1345.805) (-1349.467) [-1331.654] * [-1328.872] (-1339.232) (-1348.231) (-1345.392) -- 0:00:39
844500 -- (-1349.758) (-1341.441) (-1340.449) [-1343.681] * (-1340.703) [-1331.528] (-1335.255) (-1347.695) -- 0:00:39
845000 -- [-1345.381] (-1349.375) (-1342.372) (-1333.693) * (-1337.795) (-1343.134) [-1326.341] (-1346.297) -- 0:00:39
Average standard deviation of split frequencies: 0.008293
845500 -- (-1337.406) (-1352.613) (-1350.687) [-1333.284] * [-1327.673] (-1346.981) (-1357.759) (-1338.930) -- 0:00:39
846000 -- (-1347.078) (-1358.834) (-1338.700) [-1338.034] * (-1328.609) (-1342.692) [-1329.886] (-1348.814) -- 0:00:39
846500 -- [-1337.487] (-1347.294) (-1347.615) (-1338.813) * (-1336.345) [-1333.536] (-1356.512) (-1345.622) -- 0:00:39
847000 -- (-1337.286) (-1348.174) [-1342.156] (-1352.626) * (-1325.910) (-1349.605) [-1348.540] (-1345.727) -- 0:00:39
847500 -- (-1335.976) (-1346.019) (-1345.867) [-1339.794] * [-1335.878] (-1355.018) (-1340.970) (-1336.101) -- 0:00:39
848000 -- (-1343.533) [-1339.532] (-1336.477) (-1341.689) * [-1340.618] (-1351.194) (-1349.664) (-1345.101) -- 0:00:38
848500 -- [-1330.771] (-1332.330) (-1353.433) (-1338.440) * (-1341.415) [-1334.297] (-1355.785) (-1347.422) -- 0:00:38
849000 -- (-1341.820) (-1332.189) (-1355.621) [-1334.704] * [-1323.677] (-1344.664) (-1350.488) (-1346.680) -- 0:00:38
849500 -- [-1340.489] (-1332.476) (-1359.016) (-1342.002) * (-1340.765) (-1350.650) (-1351.269) [-1337.609] -- 0:00:38
850000 -- (-1331.283) (-1346.579) (-1346.497) [-1343.927] * [-1319.051] (-1350.305) (-1345.331) (-1339.886) -- 0:00:38
Average standard deviation of split frequencies: 0.008182
850500 -- [-1336.887] (-1340.885) (-1355.383) (-1321.132) * [-1320.807] (-1343.180) (-1340.874) (-1331.717) -- 0:00:38
851000 -- [-1331.115] (-1361.700) (-1338.635) (-1346.941) * [-1332.752] (-1346.164) (-1344.230) (-1344.931) -- 0:00:38
851500 -- (-1345.541) [-1343.482] (-1342.860) (-1338.616) * [-1339.819] (-1331.500) (-1347.204) (-1347.447) -- 0:00:38
852000 -- (-1351.889) [-1318.269] (-1348.326) (-1352.465) * (-1338.781) [-1331.513] (-1346.395) (-1346.625) -- 0:00:37
852500 -- [-1340.797] (-1321.149) (-1339.065) (-1347.244) * (-1338.316) [-1335.354] (-1344.444) (-1347.510) -- 0:00:37
853000 -- (-1336.073) [-1323.234] (-1347.705) (-1345.401) * (-1329.211) (-1350.127) (-1350.176) [-1341.504] -- 0:00:37
853500 -- (-1341.927) (-1344.542) [-1321.042] (-1345.184) * [-1333.462] (-1351.789) (-1349.488) (-1337.553) -- 0:00:37
854000 -- (-1341.540) (-1352.546) [-1332.580] (-1335.755) * [-1324.102] (-1358.965) (-1351.894) (-1340.368) -- 0:00:37
854500 -- (-1343.241) (-1349.898) [-1343.884] (-1348.043) * (-1335.621) (-1340.100) (-1348.166) [-1343.344] -- 0:00:37
855000 -- [-1333.266] (-1344.625) (-1354.075) (-1344.359) * [-1320.665] (-1346.584) (-1341.866) (-1354.549) -- 0:00:37
Average standard deviation of split frequencies: 0.008131
855500 -- (-1329.910) (-1340.811) [-1336.231] (-1346.326) * [-1319.190] (-1349.069) (-1350.907) (-1342.097) -- 0:00:36
856000 -- [-1337.421] (-1335.673) (-1351.846) (-1333.641) * (-1328.529) (-1353.297) [-1343.233] (-1342.388) -- 0:00:36
856500 -- [-1338.143] (-1348.599) (-1361.292) (-1351.651) * (-1335.703) [-1342.655] (-1347.509) (-1350.059) -- 0:00:36
857000 -- [-1320.738] (-1323.606) (-1352.695) (-1343.919) * [-1337.980] (-1350.896) (-1346.856) (-1352.158) -- 0:00:36
857500 -- (-1342.724) [-1338.511] (-1342.099) (-1338.492) * [-1335.535] (-1340.806) (-1356.700) (-1339.634) -- 0:00:36
858000 -- [-1332.230] (-1339.138) (-1343.188) (-1342.574) * [-1330.490] (-1352.469) (-1350.017) (-1341.305) -- 0:00:36
858500 -- (-1347.792) (-1345.522) (-1356.190) [-1329.257] * [-1326.136] (-1349.156) (-1345.028) (-1342.658) -- 0:00:36
859000 -- (-1347.739) (-1341.491) (-1352.607) [-1328.069] * [-1309.854] (-1344.408) (-1343.339) (-1360.832) -- 0:00:36
859500 -- [-1339.587] (-1336.217) (-1349.868) (-1349.337) * (-1345.514) (-1341.586) [-1339.918] (-1341.018) -- 0:00:35
860000 -- (-1337.319) (-1342.415) [-1335.696] (-1343.564) * (-1341.736) [-1336.850] (-1339.388) (-1345.858) -- 0:00:35
Average standard deviation of split frequencies: 0.008151
860500 -- (-1358.345) (-1353.192) (-1334.418) [-1343.380] * [-1347.045] (-1336.614) (-1349.273) (-1347.366) -- 0:00:35
861000 -- (-1344.220) (-1334.194) [-1327.920] (-1341.919) * (-1347.338) [-1329.256] (-1341.586) (-1350.291) -- 0:00:35
861500 -- [-1333.059] (-1339.334) (-1337.218) (-1354.313) * (-1352.685) [-1336.262] (-1348.597) (-1343.144) -- 0:00:35
862000 -- [-1327.518] (-1345.280) (-1341.592) (-1340.226) * (-1344.588) (-1326.470) (-1352.815) [-1334.910] -- 0:00:35
862500 -- [-1325.375] (-1333.297) (-1351.103) (-1339.488) * (-1345.740) (-1339.570) (-1336.720) [-1343.681] -- 0:00:35
863000 -- (-1337.184) [-1330.157] (-1352.904) (-1334.580) * (-1339.689) (-1338.378) [-1336.896] (-1346.009) -- 0:00:35
863500 -- (-1342.298) [-1321.762] (-1349.655) (-1339.325) * (-1340.479) (-1346.021) [-1326.962] (-1347.601) -- 0:00:34
864000 -- [-1340.625] (-1339.397) (-1341.207) (-1341.121) * (-1335.626) [-1348.972] (-1349.846) (-1353.789) -- 0:00:34
864500 -- (-1343.618) (-1337.631) (-1344.169) [-1343.390] * (-1339.761) [-1345.907] (-1356.640) (-1349.004) -- 0:00:34
865000 -- (-1341.437) [-1310.427] (-1351.776) (-1350.239) * (-1345.302) [-1341.110] (-1342.173) (-1344.737) -- 0:00:34
Average standard deviation of split frequencies: 0.008485
865500 -- (-1345.116) [-1323.642] (-1356.022) (-1339.418) * (-1348.991) [-1333.735] (-1341.316) (-1346.534) -- 0:00:34
866000 -- (-1346.836) (-1324.131) (-1350.724) [-1320.057] * (-1332.960) [-1343.699] (-1353.315) (-1348.148) -- 0:00:34
866500 -- (-1352.654) (-1331.093) (-1351.543) [-1322.806] * [-1330.446] (-1344.059) (-1343.969) (-1352.915) -- 0:00:34
867000 -- (-1349.344) [-1341.246] (-1346.929) (-1340.978) * (-1338.908) (-1344.470) (-1349.739) [-1343.297] -- 0:00:34
867500 -- (-1349.458) [-1341.905] (-1341.452) (-1340.552) * (-1336.364) (-1346.908) [-1328.723] (-1347.211) -- 0:00:33
868000 -- (-1353.053) (-1353.468) (-1343.827) [-1338.996] * [-1303.539] (-1341.727) (-1350.687) (-1341.745) -- 0:00:33
868500 -- (-1340.706) [-1337.511] (-1348.369) (-1338.637) * [-1340.098] (-1345.403) (-1348.017) (-1344.841) -- 0:00:33
869000 -- (-1342.480) [-1311.947] (-1341.904) (-1342.168) * [-1323.283] (-1335.459) (-1344.696) (-1351.617) -- 0:00:33
869500 -- (-1342.891) (-1318.658) [-1326.233] (-1351.952) * (-1322.902) [-1341.976] (-1353.555) (-1341.392) -- 0:00:33
870000 -- (-1346.008) [-1311.518] (-1343.946) (-1339.922) * (-1347.007) [-1347.612] (-1343.430) (-1342.980) -- 0:00:33
Average standard deviation of split frequencies: 0.008408
870500 -- (-1338.603) [-1341.190] (-1352.719) (-1329.525) * (-1333.298) (-1337.116) [-1344.741] (-1335.204) -- 0:00:33
871000 -- (-1350.540) [-1340.527] (-1339.681) (-1331.140) * (-1338.776) [-1333.049] (-1341.601) (-1341.350) -- 0:00:33
871500 -- (-1344.458) (-1334.943) (-1349.615) [-1335.041] * (-1339.617) [-1340.562] (-1343.163) (-1346.843) -- 0:00:32
872000 -- (-1338.124) (-1343.689) (-1341.480) [-1325.088] * (-1337.430) (-1349.831) [-1340.246] (-1323.579) -- 0:00:32
872500 -- (-1341.322) (-1333.843) (-1332.279) [-1324.573] * (-1338.788) (-1347.744) (-1341.068) [-1325.291] -- 0:00:32
873000 -- (-1362.750) (-1338.097) (-1342.334) [-1324.178] * [-1334.284] (-1346.586) (-1334.838) (-1341.309) -- 0:00:32
873500 -- (-1351.175) (-1346.862) [-1345.974] (-1332.776) * [-1336.443] (-1353.090) (-1345.899) (-1348.916) -- 0:00:32
874000 -- (-1346.355) [-1332.364] (-1345.553) (-1340.500) * [-1338.488] (-1348.176) (-1336.644) (-1340.523) -- 0:00:32
874500 -- (-1349.509) [-1332.100] (-1350.180) (-1350.138) * (-1345.364) [-1338.103] (-1335.877) (-1341.998) -- 0:00:32
875000 -- (-1347.337) (-1336.288) (-1341.605) [-1346.364] * [-1348.272] (-1349.943) (-1338.784) (-1340.313) -- 0:00:32
Average standard deviation of split frequencies: 0.008262
875500 -- (-1346.120) (-1340.950) [-1339.816] (-1355.394) * (-1345.067) (-1355.839) [-1328.431] (-1348.908) -- 0:00:31
876000 -- (-1335.217) (-1340.636) [-1334.104] (-1351.507) * (-1332.540) (-1358.453) [-1318.118] (-1344.305) -- 0:00:31
876500 -- (-1332.976) (-1348.790) (-1344.281) [-1334.879] * (-1344.229) (-1353.205) [-1333.926] (-1340.140) -- 0:00:31
877000 -- (-1344.649) (-1345.037) [-1338.774] (-1336.973) * (-1343.962) (-1340.356) [-1339.081] (-1347.283) -- 0:00:31
877500 -- (-1345.659) (-1336.942) [-1328.497] (-1350.651) * (-1346.976) (-1342.598) [-1326.667] (-1338.281) -- 0:00:31
878000 -- (-1347.523) (-1345.445) [-1309.333] (-1344.617) * (-1344.566) (-1337.528) [-1322.213] (-1350.056) -- 0:00:31
878500 -- (-1335.186) [-1338.352] (-1348.954) (-1350.391) * (-1342.589) [-1342.356] (-1323.843) (-1347.426) -- 0:00:31
879000 -- [-1342.799] (-1340.443) (-1335.469) (-1345.662) * (-1346.920) (-1353.369) [-1323.252] (-1332.517) -- 0:00:30
879500 -- (-1336.321) (-1352.532) [-1331.189] (-1344.134) * (-1351.299) (-1333.328) [-1325.776] (-1343.853) -- 0:00:30
880000 -- (-1331.059) (-1347.874) (-1339.894) [-1336.833] * (-1350.011) (-1352.132) [-1321.798] (-1350.491) -- 0:00:30
Average standard deviation of split frequencies: 0.007683
880500 -- (-1334.901) [-1338.202] (-1346.640) (-1340.438) * (-1340.913) (-1342.286) (-1348.353) [-1336.422] -- 0:00:30
881000 -- [-1322.457] (-1340.801) (-1331.618) (-1341.166) * (-1343.069) (-1341.229) (-1349.088) [-1331.476] -- 0:00:30
881500 -- [-1345.495] (-1342.507) (-1362.403) (-1344.904) * (-1350.510) (-1344.493) (-1345.046) [-1322.194] -- 0:00:30
882000 -- (-1341.015) [-1330.214] (-1350.465) (-1340.128) * (-1352.617) (-1337.295) (-1344.294) [-1342.614] -- 0:00:30
882500 -- (-1336.360) [-1315.081] (-1341.134) (-1343.029) * (-1346.248) (-1348.874) (-1345.008) [-1332.639] -- 0:00:30
883000 -- [-1345.578] (-1321.835) (-1354.053) (-1341.737) * (-1339.250) (-1341.661) (-1343.708) [-1346.255] -- 0:00:29
883500 -- (-1340.010) [-1331.518] (-1340.511) (-1341.297) * (-1344.274) (-1358.485) [-1343.373] (-1350.068) -- 0:00:29
884000 -- (-1345.272) (-1336.200) (-1351.475) [-1336.840] * (-1345.064) (-1348.125) [-1329.750] (-1347.396) -- 0:00:29
884500 -- [-1338.232] (-1344.072) (-1347.399) (-1338.339) * (-1342.389) (-1345.799) [-1314.568] (-1332.553) -- 0:00:29
885000 -- [-1339.900] (-1341.196) (-1346.099) (-1345.666) * (-1341.459) (-1334.684) (-1343.757) [-1334.608] -- 0:00:29
Average standard deviation of split frequencies: 0.007105
885500 -- [-1333.767] (-1343.107) (-1349.789) (-1329.757) * [-1331.394] (-1340.295) (-1349.823) (-1356.550) -- 0:00:29
886000 -- [-1321.243] (-1354.485) (-1355.854) (-1333.200) * [-1337.101] (-1329.959) (-1349.459) (-1346.589) -- 0:00:29
886500 -- (-1335.215) [-1355.891] (-1351.299) (-1346.525) * [-1338.089] (-1346.328) (-1350.497) (-1346.033) -- 0:00:29
887000 -- (-1347.292) (-1339.177) (-1360.517) [-1331.372] * (-1348.361) [-1326.316] (-1359.014) (-1352.958) -- 0:00:28
887500 -- (-1335.303) (-1337.092) (-1355.795) [-1331.804] * (-1346.908) [-1323.104] (-1353.575) (-1348.474) -- 0:00:28
888000 -- (-1342.654) [-1335.609] (-1344.566) (-1345.608) * (-1341.086) [-1324.490] (-1361.647) (-1346.381) -- 0:00:28
888500 -- (-1333.653) [-1322.224] (-1345.128) (-1336.247) * (-1347.354) [-1330.460] (-1347.128) (-1349.719) -- 0:00:28
889000 -- (-1346.662) (-1349.496) (-1352.545) [-1328.155] * [-1340.925] (-1351.178) (-1337.811) (-1346.582) -- 0:00:28
889500 -- (-1342.777) (-1337.086) (-1346.221) [-1324.234] * (-1331.243) [-1342.197] (-1345.827) (-1345.974) -- 0:00:28
890000 -- (-1350.305) (-1320.856) (-1337.772) [-1336.607] * (-1340.252) (-1342.394) [-1322.105] (-1340.338) -- 0:00:28
Average standard deviation of split frequencies: 0.006787
890500 -- (-1338.148) [-1344.011] (-1331.503) (-1342.885) * [-1335.465] (-1337.808) (-1327.314) (-1346.567) -- 0:00:28
891000 -- (-1344.968) [-1340.603] (-1346.972) (-1348.104) * [-1320.440] (-1346.295) (-1351.543) (-1346.764) -- 0:00:27
891500 -- (-1349.411) (-1350.118) (-1344.568) [-1335.337] * [-1316.302] (-1341.868) (-1346.988) (-1339.353) -- 0:00:27
892000 -- (-1342.091) (-1364.440) (-1341.644) [-1332.366] * [-1324.496] (-1335.735) (-1349.603) (-1351.872) -- 0:00:27
892500 -- (-1344.600) (-1344.125) (-1337.508) [-1328.150] * [-1329.285] (-1343.162) (-1342.826) (-1362.106) -- 0:00:27
893000 -- [-1332.882] (-1349.935) (-1341.653) (-1334.334) * (-1334.172) (-1345.469) [-1342.818] (-1351.174) -- 0:00:27
893500 -- (-1346.918) (-1342.339) (-1349.552) [-1319.089] * [-1331.911] (-1349.989) (-1338.453) (-1348.095) -- 0:00:27
894000 -- (-1342.176) (-1345.282) (-1337.011) [-1326.214] * [-1333.938] (-1344.179) (-1347.230) (-1346.353) -- 0:00:27
894500 -- (-1355.298) (-1353.828) (-1339.474) [-1323.164] * (-1340.250) (-1351.257) [-1337.275] (-1340.331) -- 0:00:27
895000 -- (-1347.131) (-1336.911) (-1344.903) [-1315.144] * (-1341.727) [-1344.092] (-1347.353) (-1341.081) -- 0:00:26
Average standard deviation of split frequencies: 0.007118
895500 -- [-1349.185] (-1353.767) (-1355.387) (-1341.205) * [-1325.854] (-1347.872) (-1343.214) (-1345.131) -- 0:00:26
896000 -- [-1343.665] (-1349.773) (-1345.557) (-1338.397) * [-1330.810] (-1339.379) (-1337.234) (-1348.595) -- 0:00:26
896500 -- (-1335.923) (-1347.540) (-1339.111) [-1330.311] * (-1334.168) (-1349.652) [-1319.491] (-1350.845) -- 0:00:26
897000 -- (-1339.256) (-1338.558) (-1354.961) [-1328.315] * (-1320.564) (-1353.278) [-1325.505] (-1346.940) -- 0:00:26
897500 -- [-1326.070] (-1354.243) (-1345.953) (-1327.613) * [-1335.125] (-1331.768) (-1346.107) (-1345.710) -- 0:00:26
898000 -- (-1353.074) (-1345.181) [-1332.466] (-1337.963) * (-1350.865) [-1332.192] (-1354.371) (-1334.432) -- 0:00:26
898500 -- (-1339.666) (-1350.649) [-1314.580] (-1335.690) * (-1333.379) (-1326.578) (-1336.262) [-1332.164] -- 0:00:25
899000 -- (-1338.045) (-1355.853) [-1326.760] (-1343.668) * (-1347.266) (-1343.702) (-1339.558) [-1324.025] -- 0:00:25
899500 -- (-1348.041) (-1329.935) [-1327.659] (-1335.500) * (-1340.875) (-1340.322) [-1335.188] (-1343.631) -- 0:00:25
900000 -- (-1352.241) (-1333.805) [-1338.005] (-1353.946) * (-1344.156) (-1336.982) [-1331.382] (-1355.067) -- 0:00:25
Average standard deviation of split frequencies: 0.007328
900500 -- [-1344.558] (-1347.672) (-1335.182) (-1336.167) * (-1345.119) (-1350.241) [-1334.274] (-1336.335) -- 0:00:25
901000 -- (-1340.761) (-1346.026) [-1320.921] (-1344.734) * (-1351.378) (-1339.888) [-1329.747] (-1328.308) -- 0:00:25
901500 -- (-1345.221) (-1340.464) [-1328.185] (-1348.300) * (-1332.317) (-1350.804) [-1330.924] (-1334.197) -- 0:00:25
902000 -- (-1347.987) (-1342.093) [-1328.831] (-1346.418) * (-1348.785) (-1341.536) (-1330.893) [-1331.666] -- 0:00:25
902500 -- (-1343.009) [-1320.646] (-1334.267) (-1344.905) * (-1347.539) (-1344.586) [-1332.756] (-1342.117) -- 0:00:24
903000 -- (-1334.932) [-1315.402] (-1332.409) (-1344.929) * (-1341.272) (-1337.510) [-1344.793] (-1352.365) -- 0:00:24
903500 -- (-1343.835) (-1327.204) [-1339.656] (-1339.123) * (-1342.053) [-1338.644] (-1360.444) (-1339.275) -- 0:00:24
904000 -- (-1350.344) (-1344.657) [-1318.985] (-1326.797) * (-1346.740) (-1343.153) (-1357.373) [-1325.479] -- 0:00:24
904500 -- [-1347.160] (-1325.268) (-1358.166) (-1332.056) * (-1345.296) (-1332.435) (-1343.727) [-1325.309] -- 0:00:24
905000 -- (-1352.811) (-1326.625) (-1344.556) [-1331.401] * (-1349.591) (-1349.950) (-1333.879) [-1331.154] -- 0:00:24
Average standard deviation of split frequencies: 0.007193
905500 -- (-1354.288) (-1345.391) [-1340.179] (-1348.179) * (-1341.298) (-1357.339) (-1337.090) [-1322.943] -- 0:00:24
906000 -- (-1343.925) (-1337.894) [-1324.089] (-1340.419) * (-1345.237) (-1345.402) (-1338.610) [-1326.440] -- 0:00:24
906500 -- (-1352.817) (-1333.385) [-1328.583] (-1359.620) * (-1338.342) (-1345.221) [-1335.697] (-1341.061) -- 0:00:23
907000 -- (-1353.206) (-1338.299) [-1334.836] (-1344.957) * (-1336.340) (-1340.024) [-1323.303] (-1338.670) -- 0:00:23
907500 -- (-1350.409) (-1335.239) [-1331.477] (-1359.295) * (-1346.156) (-1328.972) [-1314.795] (-1349.767) -- 0:00:23
908000 -- (-1346.297) (-1341.216) [-1321.142] (-1346.679) * (-1344.126) (-1347.819) [-1316.748] (-1344.405) -- 0:00:23
908500 -- (-1347.125) (-1334.750) [-1331.967] (-1335.921) * (-1347.269) (-1343.628) [-1345.122] (-1337.520) -- 0:00:23
909000 -- (-1343.561) [-1329.172] (-1325.557) (-1352.645) * [-1344.347] (-1343.572) (-1347.591) (-1341.131) -- 0:00:23
909500 -- (-1346.757) [-1324.796] (-1339.433) (-1344.885) * (-1342.116) (-1349.243) (-1348.261) [-1341.261] -- 0:00:23
910000 -- (-1341.287) [-1321.554] (-1341.506) (-1348.881) * (-1340.196) (-1340.041) (-1339.884) [-1337.001] -- 0:00:23
Average standard deviation of split frequencies: 0.006699
910500 -- (-1348.163) [-1341.499] (-1328.580) (-1342.194) * [-1313.634] (-1347.760) (-1342.735) (-1323.183) -- 0:00:22
911000 -- (-1345.615) [-1334.950] (-1332.648) (-1342.290) * [-1314.026] (-1339.007) (-1345.766) (-1344.015) -- 0:00:22
911500 -- (-1347.082) (-1333.941) (-1335.785) [-1331.658] * [-1332.696] (-1343.490) (-1343.885) (-1344.558) -- 0:00:22
912000 -- (-1347.232) [-1335.492] (-1344.517) (-1342.700) * (-1344.501) (-1335.926) [-1333.236] (-1347.437) -- 0:00:22
912500 -- (-1349.630) [-1334.452] (-1348.291) (-1343.501) * (-1345.508) (-1356.513) (-1337.541) [-1343.042] -- 0:00:22
913000 -- [-1337.749] (-1348.805) (-1338.608) (-1348.885) * [-1339.802] (-1340.098) (-1343.769) (-1340.303) -- 0:00:22
913500 -- (-1353.611) (-1346.989) [-1344.116] (-1351.126) * (-1347.142) (-1352.768) [-1337.106] (-1341.190) -- 0:00:22
914000 -- (-1330.053) [-1326.638] (-1347.071) (-1337.037) * (-1343.320) (-1338.715) (-1344.731) [-1332.004] -- 0:00:22
914500 -- (-1338.125) (-1337.190) [-1328.825] (-1348.621) * (-1352.129) (-1334.568) (-1348.073) [-1331.106] -- 0:00:21
915000 -- (-1338.093) (-1326.537) [-1321.643] (-1336.737) * (-1343.187) [-1322.222] (-1338.910) (-1329.205) -- 0:00:21
Average standard deviation of split frequencies: 0.006872
915500 -- (-1342.333) (-1325.670) [-1322.543] (-1352.824) * (-1348.064) (-1338.999) (-1350.848) [-1328.914] -- 0:00:21
916000 -- (-1338.346) [-1330.131] (-1346.244) (-1338.787) * (-1350.915) [-1332.764] (-1346.946) (-1342.717) -- 0:00:21
916500 -- (-1339.895) (-1335.057) [-1336.450] (-1341.587) * (-1352.701) [-1341.152] (-1345.173) (-1344.458) -- 0:00:21
917000 -- [-1326.202] (-1330.381) (-1345.071) (-1350.832) * (-1343.933) [-1332.014] (-1343.126) (-1339.983) -- 0:00:21
917500 -- [-1335.674] (-1337.846) (-1347.083) (-1340.603) * (-1346.448) (-1342.827) (-1354.543) [-1318.984] -- 0:00:21
918000 -- [-1347.574] (-1340.516) (-1336.978) (-1353.074) * [-1330.217] (-1337.689) (-1360.429) (-1336.320) -- 0:00:20
918500 -- (-1337.063) (-1337.009) [-1334.301] (-1352.185) * (-1348.102) [-1336.860] (-1347.059) (-1338.908) -- 0:00:20
919000 -- (-1336.011) (-1340.073) (-1335.395) [-1338.718] * (-1345.736) (-1345.782) [-1326.908] (-1346.412) -- 0:00:20
919500 -- (-1341.642) (-1336.551) [-1333.137] (-1353.308) * (-1343.042) (-1350.770) [-1333.517] (-1347.443) -- 0:00:20
920000 -- (-1347.555) (-1335.864) [-1341.310] (-1345.742) * (-1343.184) (-1348.847) [-1330.368] (-1346.052) -- 0:00:20
Average standard deviation of split frequencies: 0.006054
920500 -- (-1338.963) [-1342.531] (-1341.946) (-1346.742) * (-1346.738) (-1341.000) (-1328.791) [-1340.011] -- 0:00:20
921000 -- (-1339.827) (-1332.677) [-1330.901] (-1337.832) * (-1341.520) (-1354.658) [-1323.329] (-1348.881) -- 0:00:20
921500 -- [-1336.258] (-1353.172) (-1349.000) (-1342.907) * (-1346.756) [-1339.669] (-1335.839) (-1347.040) -- 0:00:20
922000 -- [-1319.434] (-1338.482) (-1345.119) (-1348.205) * [-1348.073] (-1338.969) (-1342.101) (-1340.560) -- 0:00:19
922500 -- [-1324.072] (-1333.759) (-1328.870) (-1350.155) * (-1354.545) [-1319.772] (-1341.042) (-1337.092) -- 0:00:19
923000 -- [-1344.673] (-1351.057) (-1329.824) (-1349.197) * (-1343.761) [-1317.273] (-1348.478) (-1344.588) -- 0:00:19
923500 -- (-1343.484) (-1343.500) [-1334.017] (-1341.020) * (-1345.745) [-1326.542] (-1347.760) (-1350.697) -- 0:00:19
924000 -- (-1340.992) (-1341.761) [-1317.053] (-1351.059) * (-1348.057) (-1332.795) [-1346.245] (-1351.856) -- 0:00:19
924500 -- (-1352.820) (-1344.996) [-1337.803] (-1348.424) * [-1341.619] (-1335.263) (-1342.087) (-1357.992) -- 0:00:19
925000 -- [-1337.100] (-1347.079) (-1338.832) (-1341.824) * (-1341.597) [-1333.609] (-1345.479) (-1350.761) -- 0:00:19
Average standard deviation of split frequencies: 0.006199
925500 -- (-1346.167) (-1334.270) [-1330.346] (-1344.225) * [-1343.033] (-1342.607) (-1344.270) (-1346.040) -- 0:00:19
926000 -- (-1351.248) (-1338.908) [-1325.928] (-1347.659) * (-1340.406) (-1347.218) (-1342.695) [-1334.176] -- 0:00:18
926500 -- (-1338.467) (-1342.393) [-1319.443] (-1348.028) * (-1349.724) [-1347.228] (-1353.046) (-1336.822) -- 0:00:18
927000 -- (-1348.602) (-1343.970) [-1340.263] (-1335.085) * (-1349.146) (-1349.546) (-1345.934) [-1332.660] -- 0:00:18
927500 -- [-1338.574] (-1349.881) (-1343.304) (-1345.450) * (-1346.865) (-1342.348) (-1347.910) [-1324.420] -- 0:00:18
928000 -- (-1342.037) (-1342.215) (-1310.100) [-1332.538] * (-1345.351) (-1347.551) (-1350.094) [-1330.680] -- 0:00:18
928500 -- (-1350.757) (-1349.430) (-1325.663) [-1327.754] * (-1341.992) [-1334.792] (-1349.270) (-1342.640) -- 0:00:18
929000 -- (-1351.635) [-1337.080] (-1334.901) (-1354.264) * (-1341.583) (-1350.984) (-1341.727) [-1337.087] -- 0:00:18
929500 -- (-1348.364) (-1346.886) [-1319.966] (-1351.336) * (-1340.715) (-1342.510) (-1341.768) [-1333.592] -- 0:00:18
930000 -- (-1348.952) (-1341.936) [-1340.127] (-1342.031) * (-1341.303) (-1345.324) (-1343.249) [-1326.503] -- 0:00:17
Average standard deviation of split frequencies: 0.005870
930500 -- (-1346.759) (-1348.887) [-1335.405] (-1343.393) * (-1336.719) (-1345.880) (-1346.097) [-1338.041] -- 0:00:17
931000 -- (-1350.682) (-1340.356) [-1331.049] (-1340.631) * (-1330.623) (-1347.355) (-1342.803) [-1319.912] -- 0:00:17
931500 -- [-1342.164] (-1346.052) (-1334.154) (-1346.950) * (-1338.814) [-1337.204] (-1346.459) (-1324.991) -- 0:00:17
932000 -- (-1352.855) (-1344.547) [-1322.852] (-1348.349) * [-1338.846] (-1350.227) (-1350.855) (-1317.586) -- 0:00:17
932500 -- (-1344.749) (-1338.181) [-1331.345] (-1341.329) * (-1339.970) (-1348.749) (-1352.429) [-1336.767] -- 0:00:17
933000 -- (-1342.462) (-1349.030) (-1335.714) [-1336.554] * (-1347.968) [-1335.547] (-1356.320) (-1338.912) -- 0:00:17
933500 -- (-1334.254) (-1347.934) [-1328.622] (-1334.962) * (-1348.926) (-1342.067) (-1346.493) [-1332.843] -- 0:00:17
934000 -- (-1340.269) (-1344.899) [-1335.033] (-1335.927) * (-1352.818) [-1335.526] (-1345.301) (-1331.356) -- 0:00:16
934500 -- (-1353.985) (-1336.267) (-1339.016) [-1321.129] * (-1352.430) (-1323.527) (-1347.604) [-1329.602] -- 0:00:16
935000 -- (-1343.811) (-1342.497) (-1352.329) [-1319.284] * (-1351.201) [-1344.475] (-1326.250) (-1354.076) -- 0:00:16
Average standard deviation of split frequencies: 0.005570
935500 -- (-1341.611) (-1343.951) (-1335.608) [-1322.237] * (-1354.921) (-1353.041) (-1329.659) [-1321.441] -- 0:00:16
936000 -- (-1331.363) (-1347.337) [-1320.899] (-1334.563) * (-1344.858) (-1352.711) (-1340.047) [-1329.620] -- 0:00:16
936500 -- (-1332.363) (-1340.546) [-1323.851] (-1334.407) * (-1346.948) (-1354.653) (-1356.053) [-1324.671] -- 0:00:16
937000 -- [-1329.076] (-1346.581) (-1325.119) (-1359.671) * (-1352.651) (-1365.667) (-1345.485) [-1325.437] -- 0:00:16
937500 -- (-1338.029) (-1348.002) [-1324.143] (-1341.982) * [-1327.830] (-1347.092) (-1342.063) (-1328.773) -- 0:00:16
938000 -- (-1333.514) (-1350.393) (-1336.152) [-1316.331] * [-1333.574] (-1342.949) (-1335.740) (-1344.407) -- 0:00:15
938500 -- (-1336.094) (-1347.592) (-1341.359) [-1317.041] * (-1352.987) (-1347.121) (-1335.694) [-1334.849] -- 0:00:15
939000 -- (-1348.750) (-1356.572) (-1342.441) [-1316.266] * [-1335.688] (-1342.649) (-1354.238) (-1336.304) -- 0:00:15
939500 -- (-1341.181) (-1336.464) (-1359.221) [-1309.817] * [-1316.712] (-1336.952) (-1339.395) (-1329.550) -- 0:00:15
940000 -- (-1337.638) (-1339.137) (-1355.997) [-1315.193] * (-1342.082) [-1339.824] (-1354.536) (-1338.158) -- 0:00:15
Average standard deviation of split frequencies: 0.005542
940500 -- (-1348.609) (-1337.587) (-1338.677) [-1339.297] * (-1348.562) (-1336.037) [-1334.545] (-1337.107) -- 0:00:15
941000 -- [-1341.991] (-1334.063) (-1350.170) (-1347.888) * (-1337.233) (-1349.441) (-1330.436) [-1311.873] -- 0:00:15
941500 -- (-1338.749) (-1350.271) (-1356.388) [-1332.087] * [-1335.680] (-1349.835) (-1341.737) (-1332.390) -- 0:00:14
942000 -- (-1346.373) [-1326.056] (-1353.133) (-1334.332) * (-1347.335) (-1327.975) [-1345.547] (-1331.798) -- 0:00:14
942500 -- (-1348.426) [-1314.353] (-1338.714) (-1333.612) * (-1337.575) (-1339.438) [-1336.965] (-1338.213) -- 0:00:14
943000 -- (-1344.582) [-1313.347] (-1325.217) (-1345.284) * (-1336.916) (-1350.597) [-1318.149] (-1332.673) -- 0:00:14
943500 -- (-1346.205) (-1330.021) [-1333.952] (-1344.662) * (-1351.339) (-1352.443) [-1325.588] (-1338.652) -- 0:00:14
944000 -- (-1348.778) (-1337.554) (-1339.780) [-1333.337] * (-1338.335) (-1335.262) [-1302.738] (-1341.992) -- 0:00:14
944500 -- (-1347.915) (-1340.255) (-1336.942) [-1324.123] * (-1343.007) (-1342.436) [-1322.587] (-1337.709) -- 0:00:14
945000 -- (-1335.709) (-1351.264) [-1337.593] (-1347.346) * (-1344.222) (-1348.408) [-1324.571] (-1325.608) -- 0:00:14
Average standard deviation of split frequencies: 0.005511
945500 -- (-1344.185) (-1340.036) [-1319.047] (-1358.024) * (-1342.355) (-1343.034) (-1325.694) [-1329.206] -- 0:00:13
946000 -- (-1348.195) (-1344.825) [-1323.621] (-1350.487) * (-1336.594) (-1335.299) (-1348.780) [-1329.253] -- 0:00:13
946500 -- (-1336.748) (-1354.246) [-1321.233] (-1342.236) * (-1343.416) (-1338.953) [-1337.789] (-1343.738) -- 0:00:13
947000 -- (-1340.539) (-1353.215) [-1327.929] (-1344.019) * (-1347.527) [-1331.571] (-1330.902) (-1343.468) -- 0:00:13
947500 -- (-1344.197) [-1332.399] (-1331.987) (-1343.459) * (-1349.029) (-1350.557) (-1332.422) [-1330.166] -- 0:00:13
948000 -- [-1332.450] (-1335.742) (-1349.071) (-1344.954) * (-1340.367) (-1359.528) [-1334.712] (-1323.448) -- 0:00:13
948500 -- [-1342.626] (-1343.777) (-1351.792) (-1343.510) * (-1344.319) (-1346.471) [-1338.145] (-1316.410) -- 0:00:13
949000 -- (-1339.636) [-1331.920] (-1348.701) (-1328.770) * (-1349.400) (-1363.326) (-1337.195) [-1324.821] -- 0:00:13
949500 -- (-1343.534) (-1345.583) (-1345.420) [-1323.221] * (-1349.942) (-1355.355) [-1331.328] (-1340.093) -- 0:00:12
950000 -- (-1341.469) [-1337.350] (-1345.463) (-1328.399) * [-1339.056] (-1341.597) (-1345.992) (-1344.937) -- 0:00:12
Average standard deviation of split frequencies: 0.005396
950500 -- (-1333.482) (-1337.552) (-1338.772) [-1341.224] * [-1332.357] (-1345.728) (-1354.368) (-1339.416) -- 0:00:12
951000 -- (-1346.370) (-1348.778) [-1333.045] (-1344.914) * (-1332.780) [-1337.011] (-1359.125) (-1340.615) -- 0:00:12
951500 -- (-1348.478) (-1345.185) [-1345.826] (-1341.703) * [-1331.944] (-1340.229) (-1351.373) (-1342.473) -- 0:00:12
952000 -- (-1353.038) (-1344.474) (-1350.695) [-1336.404] * (-1344.756) (-1332.487) [-1326.840] (-1345.703) -- 0:00:12
952500 -- (-1341.836) [-1334.678] (-1360.971) (-1346.063) * (-1353.883) [-1339.852] (-1330.282) (-1340.550) -- 0:00:12
953000 -- (-1340.967) [-1330.618] (-1344.051) (-1337.494) * (-1354.576) (-1357.566) [-1320.229] (-1346.380) -- 0:00:12
953500 -- [-1346.821] (-1330.978) (-1348.516) (-1341.754) * (-1355.264) (-1353.401) (-1350.465) [-1338.967] -- 0:00:11
954000 -- (-1346.537) [-1343.097] (-1326.213) (-1349.804) * (-1335.103) [-1323.393] (-1338.311) (-1325.385) -- 0:00:11
954500 -- (-1346.268) (-1343.777) [-1320.288] (-1336.092) * (-1345.701) (-1345.145) (-1345.241) [-1310.817] -- 0:00:11
955000 -- (-1336.672) (-1340.652) [-1339.274] (-1340.560) * (-1348.620) (-1345.280) [-1319.677] (-1322.477) -- 0:00:11
Average standard deviation of split frequencies: 0.005511
955500 -- (-1341.720) [-1339.609] (-1348.620) (-1339.465) * [-1337.186] (-1344.922) (-1336.927) (-1323.528) -- 0:00:11
956000 -- (-1348.977) [-1324.278] (-1341.223) (-1341.849) * (-1338.938) (-1352.073) (-1352.757) [-1323.146] -- 0:00:11
956500 -- (-1338.312) [-1322.853] (-1341.919) (-1356.190) * (-1345.997) (-1354.961) (-1344.843) [-1325.754] -- 0:00:11
957000 -- (-1356.165) (-1328.242) [-1329.520] (-1354.290) * (-1345.438) [-1337.400] (-1342.568) (-1333.449) -- 0:00:11
957500 -- (-1343.151) [-1316.311] (-1347.368) (-1349.980) * (-1350.386) (-1341.983) (-1341.885) [-1327.118] -- 0:00:10
958000 -- (-1344.084) (-1322.620) [-1323.086] (-1353.637) * (-1344.427) (-1346.708) (-1348.121) [-1320.364] -- 0:00:10
958500 -- (-1344.022) (-1314.727) [-1335.432] (-1348.416) * (-1336.184) (-1329.263) (-1353.290) [-1329.057] -- 0:00:10
959000 -- [-1335.475] (-1323.253) (-1329.125) (-1340.597) * (-1344.289) [-1334.794] (-1343.695) (-1335.380) -- 0:00:10
959500 -- (-1331.472) (-1334.107) [-1328.034] (-1339.099) * [-1343.425] (-1340.481) (-1347.268) (-1337.342) -- 0:00:10
960000 -- (-1345.809) [-1325.232] (-1335.588) (-1351.695) * (-1345.252) [-1337.705] (-1341.098) (-1337.616) -- 0:00:10
Average standard deviation of split frequencies: 0.005831
960500 -- (-1344.695) [-1319.374] (-1348.500) (-1355.514) * (-1346.788) (-1341.682) [-1339.001] (-1349.983) -- 0:00:10
961000 -- (-1347.398) [-1327.121] (-1330.692) (-1343.821) * (-1342.037) [-1342.901] (-1350.521) (-1352.449) -- 0:00:09
961500 -- (-1345.676) [-1324.224] (-1342.515) (-1353.287) * (-1339.786) [-1312.460] (-1348.047) (-1343.878) -- 0:00:09
962000 -- (-1344.593) [-1329.914] (-1338.824) (-1339.482) * (-1340.155) [-1322.907] (-1349.622) (-1339.129) -- 0:00:09
962500 -- (-1362.252) (-1329.044) (-1343.763) [-1327.098] * (-1343.356) (-1330.334) (-1347.852) [-1339.616] -- 0:00:09
963000 -- [-1351.081] (-1340.433) (-1341.519) (-1329.723) * [-1331.768] (-1346.222) (-1340.015) (-1338.790) -- 0:00:09
963500 -- (-1339.425) (-1349.141) (-1338.456) [-1322.605] * [-1337.037] (-1341.767) (-1341.926) (-1357.581) -- 0:00:09
964000 -- (-1337.427) (-1342.189) (-1346.001) [-1329.954] * [-1325.078] (-1341.454) (-1348.325) (-1336.981) -- 0:00:09
964500 -- (-1331.720) (-1348.182) (-1344.204) [-1333.487] * [-1329.239] (-1342.903) (-1338.887) (-1351.573) -- 0:00:09
965000 -- [-1345.913] (-1345.706) (-1348.478) (-1330.313) * [-1330.564] (-1347.605) (-1333.073) (-1351.591) -- 0:00:08
Average standard deviation of split frequencies: 0.005971
965500 -- (-1335.092) (-1345.140) (-1357.291) [-1332.833] * [-1319.143] (-1338.112) (-1331.436) (-1350.339) -- 0:00:08
966000 -- (-1337.986) (-1346.136) (-1348.572) [-1319.039] * (-1332.679) (-1351.720) [-1331.971] (-1352.592) -- 0:00:08
966500 -- (-1336.500) (-1350.915) (-1347.786) [-1330.190] * (-1338.302) (-1346.873) [-1324.276] (-1344.188) -- 0:00:08
967000 -- (-1342.552) (-1340.463) (-1346.247) [-1328.283] * [-1338.283] (-1338.558) (-1352.412) (-1333.593) -- 0:00:08
967500 -- [-1337.500] (-1348.639) (-1336.724) (-1342.935) * (-1344.295) [-1335.436] (-1351.256) (-1328.526) -- 0:00:08
968000 -- (-1337.252) (-1348.993) [-1329.097] (-1338.462) * (-1350.013) (-1349.133) (-1339.939) [-1329.160] -- 0:00:08
968500 -- (-1349.020) [-1334.858] (-1348.108) (-1338.608) * (-1346.132) (-1350.046) [-1335.080] (-1335.063) -- 0:00:08
969000 -- (-1339.336) (-1333.611) (-1349.546) [-1331.945] * (-1334.459) [-1340.176] (-1346.632) (-1343.270) -- 0:00:07
969500 -- (-1334.923) (-1341.663) (-1340.718) [-1341.686] * (-1343.902) [-1336.397] (-1346.112) (-1365.259) -- 0:00:07
970000 -- (-1340.847) (-1324.452) (-1340.175) [-1343.363] * [-1334.484] (-1335.870) (-1348.475) (-1343.356) -- 0:00:07
Average standard deviation of split frequencies: 0.006285
970500 -- (-1347.890) (-1324.743) (-1343.240) [-1327.663] * (-1349.218) [-1343.298] (-1344.263) (-1352.883) -- 0:00:07
971000 -- (-1351.355) (-1332.280) (-1342.289) [-1324.108] * (-1355.884) (-1330.087) (-1337.371) [-1333.763] -- 0:00:07
971500 -- (-1347.131) (-1333.904) (-1343.687) [-1323.179] * (-1346.603) (-1350.937) [-1338.127] (-1347.496) -- 0:00:07
972000 -- (-1343.664) (-1347.931) [-1338.487] (-1349.538) * (-1345.619) (-1336.592) (-1348.293) [-1313.498] -- 0:00:07
972500 -- (-1344.501) (-1351.567) (-1341.485) [-1343.185] * (-1351.941) (-1342.792) (-1362.088) [-1324.763] -- 0:00:07
973000 -- [-1342.327] (-1340.202) (-1332.705) (-1350.929) * (-1344.652) (-1345.248) (-1345.118) [-1325.984] -- 0:00:06
973500 -- (-1344.179) (-1337.205) (-1342.741) [-1327.596] * (-1348.873) (-1345.838) (-1339.917) [-1340.566] -- 0:00:06
974000 -- (-1340.060) (-1341.604) (-1345.664) [-1338.167] * (-1344.955) (-1341.693) (-1335.529) [-1338.607] -- 0:00:06
974500 -- [-1327.747] (-1355.211) (-1343.876) (-1344.475) * (-1352.894) (-1341.921) (-1347.967) [-1332.859] -- 0:00:06
975000 -- (-1345.699) (-1351.191) (-1342.247) [-1331.825] * (-1344.436) (-1341.150) [-1345.863] (-1336.545) -- 0:00:06
Average standard deviation of split frequencies: 0.006336
975500 -- (-1342.995) (-1348.785) (-1346.763) [-1337.192] * (-1344.241) (-1340.289) (-1328.808) [-1344.819] -- 0:00:06
976000 -- (-1347.600) [-1342.268] (-1346.367) (-1342.202) * (-1342.804) [-1325.284] (-1337.297) (-1342.716) -- 0:00:06
976500 -- [-1342.453] (-1342.650) (-1352.571) (-1346.381) * (-1340.710) (-1340.771) [-1336.321] (-1340.185) -- 0:00:06
977000 -- [-1328.439] (-1355.294) (-1350.774) (-1350.797) * (-1335.521) (-1331.191) [-1342.070] (-1358.167) -- 0:00:05
977500 -- [-1337.410] (-1343.522) (-1347.006) (-1345.131) * (-1339.737) [-1339.057] (-1342.467) (-1349.866) -- 0:00:05
978000 -- (-1346.633) [-1343.560] (-1340.756) (-1351.042) * (-1347.222) [-1347.407] (-1341.217) (-1338.580) -- 0:00:05
978500 -- (-1341.707) (-1343.811) [-1336.567] (-1350.562) * (-1351.488) (-1345.713) [-1328.537] (-1355.379) -- 0:00:05
979000 -- (-1345.971) (-1353.052) (-1342.228) [-1326.758] * (-1325.757) (-1353.383) [-1307.022] (-1350.636) -- 0:00:05
979500 -- (-1345.222) [-1341.897] (-1349.820) (-1346.390) * (-1329.941) (-1345.393) (-1324.006) [-1334.139] -- 0:00:05
980000 -- (-1350.720) (-1339.393) (-1343.647) [-1322.884] * [-1323.694] (-1345.478) (-1329.146) (-1341.154) -- 0:00:05
Average standard deviation of split frequencies: 0.006419
980500 -- (-1349.227) (-1346.703) (-1334.044) [-1324.569] * [-1320.539] (-1352.787) (-1346.256) (-1340.755) -- 0:00:05
981000 -- (-1340.657) (-1357.547) [-1325.730] (-1327.860) * [-1333.214] (-1354.680) (-1339.321) (-1346.714) -- 0:00:04
981500 -- (-1345.945) (-1351.358) (-1321.499) [-1322.198] * (-1345.996) (-1341.796) (-1355.382) [-1339.653] -- 0:00:04
982000 -- (-1354.534) (-1343.001) (-1327.304) [-1323.958] * (-1324.137) [-1320.800] (-1341.924) (-1346.492) -- 0:00:04
982500 -- (-1351.919) (-1341.988) (-1345.679) [-1316.527] * [-1315.694] (-1341.492) (-1341.377) (-1344.408) -- 0:00:04
983000 -- (-1349.546) (-1334.390) (-1348.023) [-1345.591] * [-1323.491] (-1346.576) (-1350.501) (-1346.770) -- 0:00:04
983500 -- [-1346.755] (-1343.145) (-1347.790) (-1344.067) * [-1324.185] (-1336.125) (-1340.229) (-1333.801) -- 0:00:04
984000 -- (-1347.312) (-1342.206) [-1340.446] (-1340.792) * [-1324.633] (-1337.015) (-1341.517) (-1342.199) -- 0:00:04
984500 -- (-1342.375) (-1347.999) [-1336.069] (-1329.225) * [-1336.781] (-1359.967) (-1350.620) (-1327.753) -- 0:00:03
985000 -- (-1351.561) [-1339.379] (-1341.315) (-1310.170) * (-1344.835) (-1357.183) (-1353.243) [-1334.536] -- 0:00:03
Average standard deviation of split frequencies: 0.005737
985500 -- (-1343.075) (-1333.890) (-1340.955) [-1315.565] * (-1331.454) (-1352.496) (-1346.329) [-1334.717] -- 0:00:03
986000 -- (-1346.178) (-1339.369) (-1343.757) [-1318.235] * (-1331.970) (-1346.798) (-1345.170) [-1326.150] -- 0:00:03
986500 -- (-1354.389) [-1340.314] (-1337.057) (-1325.126) * (-1334.718) (-1344.162) (-1350.246) [-1335.570] -- 0:00:03
987000 -- (-1344.983) [-1328.422] (-1341.614) (-1338.376) * (-1352.189) (-1336.809) (-1352.745) [-1333.236] -- 0:00:03
987500 -- (-1335.562) [-1342.474] (-1346.927) (-1349.080) * (-1351.653) (-1352.873) (-1347.338) [-1336.375] -- 0:00:03
988000 -- [-1336.324] (-1337.021) (-1347.571) (-1346.257) * (-1343.960) [-1332.419] (-1348.778) (-1342.047) -- 0:00:03
988500 -- [-1331.703] (-1340.691) (-1345.871) (-1346.216) * (-1349.143) [-1318.041] (-1349.465) (-1337.551) -- 0:00:02
989000 -- [-1337.772] (-1335.172) (-1342.502) (-1342.340) * (-1343.610) [-1315.286] (-1356.463) (-1337.205) -- 0:00:02
989500 -- (-1335.355) [-1334.945] (-1344.388) (-1341.195) * (-1339.512) (-1336.576) (-1346.475) [-1342.365] -- 0:00:02
990000 -- (-1337.630) (-1337.241) [-1335.962] (-1350.834) * [-1321.710] (-1335.296) (-1350.303) (-1352.150) -- 0:00:02
Average standard deviation of split frequencies: 0.005486
990500 -- [-1326.984] (-1342.542) (-1349.757) (-1342.193) * [-1320.129] (-1352.636) (-1339.644) (-1350.023) -- 0:00:02
991000 -- [-1317.044] (-1342.920) (-1353.472) (-1348.035) * [-1336.061] (-1355.998) (-1345.276) (-1346.716) -- 0:00:02
991500 -- (-1348.305) (-1350.523) (-1347.760) [-1322.638] * [-1327.492] (-1346.899) (-1333.995) (-1345.053) -- 0:00:02
992000 -- (-1340.434) [-1333.156] (-1354.615) (-1328.557) * [-1330.259] (-1347.529) (-1339.744) (-1344.567) -- 0:00:02
992500 -- (-1344.064) (-1345.902) (-1346.943) [-1335.859] * (-1335.960) (-1357.770) (-1347.014) [-1310.984] -- 0:00:01
993000 -- (-1352.310) (-1346.800) (-1342.682) [-1346.387] * (-1320.982) (-1355.113) (-1347.721) [-1321.907] -- 0:00:01
993500 -- (-1341.684) (-1350.509) (-1346.356) [-1336.588] * (-1333.807) (-1341.185) (-1341.691) [-1320.715] -- 0:00:01
994000 -- (-1351.117) (-1352.166) (-1346.855) [-1336.673] * (-1336.049) (-1363.092) (-1343.400) [-1329.379] -- 0:00:01
994500 -- (-1353.538) [-1344.634] (-1340.381) (-1335.351) * [-1320.604] (-1349.008) (-1345.634) (-1333.482) -- 0:00:01
995000 -- [-1336.430] (-1353.461) (-1346.886) (-1339.985) * [-1320.825] (-1354.371) (-1337.748) (-1331.967) -- 0:00:01
Average standard deviation of split frequencies: 0.005011
995500 -- [-1333.574] (-1353.059) (-1344.769) (-1350.400) * [-1327.072] (-1348.811) (-1341.851) (-1332.921) -- 0:00:01
996000 -- [-1336.150] (-1343.468) (-1337.228) (-1344.988) * [-1321.108] (-1351.577) (-1339.109) (-1341.719) -- 0:00:01
996500 -- (-1347.179) (-1350.077) [-1335.886] (-1346.969) * (-1342.745) [-1334.277] (-1339.275) (-1365.054) -- 0:00:00
997000 -- (-1338.788) (-1347.210) (-1343.849) [-1337.367] * (-1331.519) [-1333.340] (-1341.984) (-1350.267) -- 0:00:00
997500 -- (-1346.323) (-1348.602) [-1338.869] (-1340.138) * (-1345.862) [-1342.710] (-1347.330) (-1342.253) -- 0:00:00
998000 -- (-1345.314) (-1348.877) (-1341.310) [-1341.020] * (-1334.383) (-1342.218) [-1347.877] (-1347.146) -- 0:00:00
998500 -- (-1346.804) (-1342.080) [-1343.838] (-1343.759) * (-1345.442) (-1335.548) (-1349.090) [-1343.340] -- 0:00:00
999000 -- (-1343.556) (-1343.975) [-1324.796] (-1338.297) * (-1342.813) (-1332.164) (-1342.632) [-1332.824] -- 0:00:00
999500 -- (-1341.637) (-1345.957) [-1336.968] (-1338.946) * (-1339.330) [-1330.145] (-1339.735) (-1331.889) -- 0:00:00
1000000 -- (-1345.156) (-1340.680) [-1342.068] (-1341.799) * (-1344.238) [-1331.270] (-1337.425) (-1339.934) -- 0:00:00
Average standard deviation of split frequencies: 0.005182
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1345.155526 -- 10.158636
Chain 1 -- -1345.155527 -- 10.158636
Chain 2 -- -1340.680244 -- 26.880241
Chain 2 -- -1340.680243 -- 26.880241
Chain 3 -- -1342.067780 -- 24.185667
Chain 3 -- -1342.067782 -- 24.185667
Chain 4 -- -1341.799165 -- 25.245059
Chain 4 -- -1341.799168 -- 25.245059
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1344.237681 -- 7.992300
Chain 1 -- -1344.237679 -- 7.992300
Chain 2 -- -1331.270201 -- 26.772415
Chain 2 -- -1331.270195 -- 26.772415
Chain 3 -- -1337.424661 -- 24.664443
Chain 3 -- -1337.424657 -- 24.664443
Chain 4 -- -1339.934025 -- 20.164772
Chain 4 -- -1339.934026 -- 20.164772
Analysis completed in 4 mins 17 seconds
Analysis used 256.60 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1300.34
Likelihood of best state for "cold" chain of run 2 was -1303.01
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.9 % ( 61 %) Dirichlet(Revmat{all})
78.7 % ( 74 %) Slider(Revmat{all})
27.1 % ( 24 %) Dirichlet(Pi{all})
29.2 % ( 34 %) Slider(Pi{all})
35.4 % ( 20 %) Multiplier(Alpha{1,2})
47.5 % ( 29 %) Multiplier(Alpha{3})
35.1 % ( 25 %) Slider(Pinvar{all})
37.9 % ( 40 %) ExtSPR(Tau{all},V{all})
13.7 % ( 15 %) ExtTBR(Tau{all},V{all})
47.2 % ( 49 %) NNI(Tau{all},V{all})
39.5 % ( 32 %) ParsSPR(Tau{all},V{all})
27.3 % ( 28 %) Multiplier(V{all})
63.4 % ( 59 %) Nodeslider(V{all})
28.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.7 % ( 42 %) Dirichlet(Revmat{all})
78.0 % ( 67 %) Slider(Revmat{all})
27.0 % ( 31 %) Dirichlet(Pi{all})
29.5 % ( 22 %) Slider(Pi{all})
35.1 % ( 22 %) Multiplier(Alpha{1,2})
47.5 % ( 34 %) Multiplier(Alpha{3})
35.0 % ( 32 %) Slider(Pinvar{all})
37.7 % ( 36 %) ExtSPR(Tau{all},V{all})
13.4 % ( 14 %) ExtTBR(Tau{all},V{all})
47.1 % ( 54 %) NNI(Tau{all},V{all})
39.3 % ( 31 %) ParsSPR(Tau{all},V{all})
27.6 % ( 29 %) Multiplier(V{all})
63.5 % ( 61 %) Nodeslider(V{all})
28.7 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.47 0.20 0.09
2 | 166203 0.58 0.32
3 | 166879 166866 0.66
4 | 166371 167154 166527
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.47 0.21 0.09
2 | 167099 0.59 0.33
3 | 166211 166333 0.66
4 | 167060 167070 166227
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1325.28
| 2 1 1 |
| |
| 2 2 1 |
| 1 22 2 2 1 |
| 2 22 2 1 2 2|
| 1 2 1 1 1 1 11 2 1 1 1 2 |
| 2 1 1 22 122 2 2 22 2* 2 |
| 2 * 2 1 1 2 1 1 1 111 2 2 1 |
|*1 2 2 1 12 1 2 2 21 |
| 12 1 * 2 2 1 1 2 21 12 1 |
| 1 1 2 1 2 21 1 2 1 |
| 2 2 1 2 2 1 1 |
| 12 1 1 1|
| 11 1 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1337.80
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1309.54 -1349.51
2 -1309.56 -1346.69
--------------------------------------
TOTAL -1309.55 -1348.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.773171 0.183746 0.131319 1.555523 0.690411 663.42 688.18 1.000
r(A<->C){all} 0.076535 0.002012 0.001789 0.161277 0.069540 462.70 489.46 1.001
r(A<->G){all} 0.184582 0.011134 0.020620 0.390947 0.167742 212.49 231.45 1.002
r(A<->T){all} 0.057489 0.001708 0.000097 0.134465 0.048918 377.68 445.33 1.004
r(C<->G){all} 0.047575 0.001074 0.000793 0.112710 0.040204 431.71 433.92 1.001
r(C<->T){all} 0.612294 0.021431 0.353034 0.902968 0.619312 213.30 224.03 1.002
r(G<->T){all} 0.021526 0.000482 0.000014 0.064504 0.014852 601.31 750.46 1.000
pi(A){all} 0.287230 0.000269 0.256960 0.320471 0.286909 1068.07 1074.44 1.000
pi(C){all} 0.257498 0.000247 0.227803 0.288917 0.257218 1026.46 1151.09 1.000
pi(G){all} 0.257149 0.000252 0.225835 0.287693 0.257058 1164.42 1248.35 1.000
pi(T){all} 0.198123 0.000200 0.170892 0.225212 0.197553 1054.69 1148.15 1.000
alpha{1,2} 0.088992 0.000625 0.051868 0.147356 0.085145 599.85 891.91 1.000
alpha{3} 0.762185 0.259295 0.077749 1.735662 0.631283 704.62 757.91 1.000
pinvar{all} 0.853421 0.001031 0.787751 0.908532 0.857633 767.83 969.32 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- .....*******
14 -- .....***....
15 -- ...**.......
16 -- .....*.*....
17 -- ...*********
18 -- .....***.***
19 -- ..........**
20 -- .**.........
21 -- ......**....
22 -- ..**********
23 -- .*.*********
24 -- .....***.*..
25 -- .........***
26 -- .....***..**
27 -- ....********
28 -- ...*.*******
29 -- .****.......
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 2396 0.798135 0.003769 0.795470 0.800799 2
15 1936 0.644903 0.004711 0.641572 0.648235 2
16 1923 0.640573 0.011777 0.632245 0.648901 2
17 1883 0.627249 0.003298 0.624917 0.629580 2
18 1807 0.601932 0.005182 0.598268 0.605596 2
19 1510 0.502998 0.000942 0.502332 0.503664 2
20 904 0.301133 0.002827 0.299134 0.303131 2
21 863 0.287475 0.001413 0.286476 0.288474 2
22 799 0.266156 0.000471 0.265823 0.266489 2
23 759 0.252831 0.010835 0.245170 0.260493 2
24 617 0.205530 0.014604 0.195203 0.215856 2
25 606 0.201865 0.012248 0.193205 0.210526 2
26 567 0.188874 0.009893 0.181879 0.195869 2
27 505 0.168221 0.000471 0.167888 0.168554 2
28 463 0.154231 0.004240 0.151233 0.157229 2
29 301 0.100266 0.001413 0.099267 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.019842 0.000440 0.000009 0.059940 0.013273 1.000 2
length{all}[2] 0.010013 0.000173 0.000005 0.034282 0.005636 1.000 2
length{all}[3] 0.019618 0.000399 0.000006 0.056496 0.013282 1.000 2
length{all}[4] 0.011538 0.000243 0.000003 0.040313 0.006259 1.000 2
length{all}[5] 0.020287 0.000432 0.000030 0.062166 0.013798 1.000 2
length{all}[6] 0.031088 0.000993 0.000144 0.089947 0.021542 1.002 2
length{all}[7] 0.031357 0.000900 0.000064 0.094820 0.022371 1.000 2
length{all}[8] 0.025340 0.000729 0.000012 0.075549 0.017199 1.000 2
length{all}[9] 0.100096 0.005424 0.001928 0.246714 0.080981 1.001 2
length{all}[10] 0.052965 0.001899 0.002200 0.137604 0.040736 1.000 2
length{all}[11] 0.055734 0.001987 0.002572 0.147711 0.042965 1.000 2
length{all}[12] 0.055828 0.001988 0.002722 0.144408 0.042643 1.000 2
length{all}[13] 0.150544 0.010237 0.013064 0.345342 0.126889 1.000 2
length{all}[14] 0.042564 0.001700 0.000048 0.126677 0.030258 1.000 2
length{all}[15] 0.024778 0.000660 0.000046 0.076561 0.016780 0.999 2
length{all}[16] 0.028003 0.000806 0.000058 0.081638 0.019381 1.001 2
length{all}[17] 0.027145 0.000749 0.000037 0.078086 0.018904 1.000 2
length{all}[18] 0.042234 0.001854 0.000082 0.123934 0.028841 1.000 2
length{all}[19] 0.027755 0.000995 0.000064 0.083785 0.017970 1.000 2
length{all}[20] 0.011071 0.000215 0.000000 0.035771 0.006598 1.000 2
length{all}[21] 0.026934 0.000754 0.000160 0.074879 0.018687 0.999 2
length{all}[22] 0.011266 0.000234 0.000004 0.038275 0.006296 1.000 2
length{all}[23] 0.010944 0.000223 0.000030 0.034506 0.005984 0.999 2
length{all}[24] 0.015949 0.000347 0.000007 0.057891 0.009669 0.999 2
length{all}[25] 0.016755 0.000424 0.000035 0.059675 0.009212 1.002 2
length{all}[26] 0.016818 0.000464 0.000014 0.061695 0.009872 0.998 2
length{all}[27] 0.013684 0.000330 0.000006 0.047381 0.007486 1.016 2
length{all}[28] 0.013134 0.000343 0.000019 0.043222 0.007331 0.998 2
length{all}[29] 0.014948 0.000453 0.000010 0.053464 0.007087 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005182
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.016
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
| /------------ C4 (4)
+ /----------------------64---------------------+
| | \------------ C5 (5)
| |
| | /------------ C6 (6)
| | /----64----+
| | | \------------ C8 (8)
\-----63----+ /-----80----+
| | \----------------------- C7 (7)
| |
| /-----60----+----------------------------------- C10 (10)
| | |
| | | /------------ C11 (11)
\----100---+ \----------50----------+
| \------------ C12 (12)
|
\----------------------------------------------- C9 (9)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
|-- C2 (2)
|
|---- C3 (3)
|
| /-- C4 (4)
+ /---+
| | \---- C5 (5)
| |
| | /------ C6 (6)
| | /-----+
| | | \----- C8 (8)
\-----+ /--------+
| | \------- C7 (7)
| |
| /-------+------------ C10 (10)
| | |
| | | /------------- C11 (11)
\------------------------------------+ \----+
| \------------- C12 (12)
|
\----------------------- C9 (9)
|-------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1833 trees sampled):
50 % credible set contains 380 trees
90 % credible set contains 1533 trees
95 % credible set contains 1683 trees
99 % credible set contains 1803 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sequences read..
Counting site patterns.. 0:00
83 patterns at 248 / 248 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
81008 bytes for conP
11288 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9))); MP score: 37
324032 bytes for conP, adjusted
0.004202 0.000000 0.004879 0.006223 0.003050 0.000742 0.004580 0.027677 0.009289 0.009324 0.002061 0.005066 0.007700 0.006923 0.014015 0.006934 0.010881 0.014562 0.023027 0.300000 1.300000
ntime & nrate & np: 19 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 21
lnL0 = -1305.189573
Iterating by ming2
Initial: fx= 1305.189573
x= 0.00420 0.00000 0.00488 0.00622 0.00305 0.00074 0.00458 0.02768 0.00929 0.00932 0.00206 0.00507 0.00770 0.00692 0.01401 0.00693 0.01088 0.01456 0.02303 0.30000 1.30000
1 h-m-p 0.0000 0.0000 455.7460 ++ 1305.188894 m 0.0000 26 | 1/21
2 h-m-p 0.0000 0.0000 645.6971 ++ 1304.944780 m 0.0000 50 | 2/21
3 h-m-p 0.0000 0.0000 242.1478 CYCCC 1304.699064 4 0.0000 81 | 2/21
4 h-m-p 0.0000 0.0002 224.7969 +CCCCC 1303.817034 4 0.0001 114 | 2/21
5 h-m-p 0.0000 0.0004 522.0149 +YYYYCCCC 1300.885492 7 0.0002 149 | 2/21
6 h-m-p 0.0000 0.0002 1615.1048 +YYYCCC 1292.562366 5 0.0001 181 | 2/21
7 h-m-p 0.0000 0.0000 7030.5814 +YYYCCC 1289.063676 5 0.0000 213 | 2/21
8 h-m-p 0.0000 0.0000 8519.7966 +YYCCC 1286.452896 4 0.0000 244 | 2/21
9 h-m-p 0.0000 0.0001 1555.1510 +YYYYYCCCCC 1282.220052 9 0.0001 282 | 2/21
10 h-m-p 0.0000 0.0000 3462.1297 +YCYCCC 1281.043357 5 0.0000 315 | 2/21
11 h-m-p 0.0000 0.0001 563.2043 YCCCC 1280.366428 4 0.0000 346 | 2/21
12 h-m-p 0.0000 0.0001 653.5107 CCCCC 1279.654816 4 0.0000 378 | 2/21
13 h-m-p 0.0001 0.0003 74.9382 YYC 1279.577738 2 0.0000 404 | 2/21
14 h-m-p 0.0001 0.0032 42.0755 +CCC 1279.355009 2 0.0004 433 | 2/21
15 h-m-p 0.0001 0.0008 283.8948 +YYCCCCC 1278.257275 6 0.0003 468 | 2/21
16 h-m-p 0.0001 0.0007 1336.5051 ++ 1244.915164 m 0.0007 492 | 2/21
17 h-m-p 0.0000 0.0000 216075.3895 YYY 1244.844121 2 0.0000 518 | 2/21
18 h-m-p 0.0000 0.0000 13.7373 ++ 1244.841598 m 0.0000 542 | 2/21
19 h-m-p 0.0001 0.0433 1.3212 +++YCCC 1243.339823 3 0.0105 574 | 2/21
20 h-m-p 0.0001 0.0003 95.1540 YCYCCC 1241.202862 5 0.0002 606 | 2/21
21 h-m-p 0.1112 0.5562 0.0548 +YCCCC 1238.109287 4 0.3067 638 | 2/21
22 h-m-p 0.2253 1.2484 0.0746 +YYYCCC 1233.970542 5 0.8065 689 | 2/21
23 h-m-p 0.8733 4.3665 0.0477 CCCC 1232.983031 3 1.3899 738 | 2/21
24 h-m-p 0.5210 2.7184 0.1272 YCCCC 1231.920607 4 1.1456 788 | 2/21
25 h-m-p 0.3760 1.8802 0.1944 YCCCC 1230.944791 4 0.9233 838 | 2/21
26 h-m-p 0.6090 3.0450 0.2140 CCCC 1230.260478 3 0.8305 887 | 2/21
27 h-m-p 1.0428 5.2141 0.1611 CCC 1229.756032 2 1.2906 934 | 2/21
28 h-m-p 0.9937 4.9684 0.2032 CYCCC 1229.112827 4 1.5060 984 | 2/21
29 h-m-p 0.9439 4.7196 0.1847 CCCC 1228.702074 3 1.4362 1033 | 2/21
30 h-m-p 1.3957 8.0000 0.1901 CYC 1228.355379 2 1.4156 1079 | 2/21
31 h-m-p 1.6000 8.0000 0.1078 CCC 1228.186581 2 1.7716 1126 | 2/21
32 h-m-p 1.6000 8.0000 0.0611 CCCC 1228.065903 3 2.2130 1175 | 2/21
33 h-m-p 1.6000 8.0000 0.0275 CC 1228.007800 1 2.0369 1220 | 2/21
34 h-m-p 1.6000 8.0000 0.0297 YCC 1227.969608 2 2.6246 1266 | 2/21
35 h-m-p 1.6000 8.0000 0.0236 YC 1227.917936 1 3.5656 1310 | 2/21
36 h-m-p 1.6000 8.0000 0.0343 +YC 1227.797345 1 4.2711 1355 | 2/21
37 h-m-p 1.3248 8.0000 0.1107 +YC 1227.473386 1 4.1629 1400 | 2/21
38 h-m-p 1.6000 8.0000 0.1441 CCCC 1227.036866 3 2.5313 1449 | 2/21
39 h-m-p 1.6000 8.0000 0.0766 YCCC 1226.745241 3 2.7734 1497 | 2/21
40 h-m-p 1.4191 8.0000 0.1498 CC 1226.588818 1 1.6735 1542 | 2/21
41 h-m-p 1.6000 8.0000 0.1158 CCC 1226.540323 2 1.3982 1589 | 2/21
42 h-m-p 1.6000 8.0000 0.0322 CC 1226.520512 1 1.8902 1634 | 2/21
43 h-m-p 1.6000 8.0000 0.0189 C 1226.518369 0 1.5054 1677 | 2/21
44 h-m-p 1.6000 8.0000 0.0004 C 1226.517954 0 1.8490 1720 | 2/21
45 h-m-p 0.9173 8.0000 0.0008 C 1226.517894 0 1.4586 1763 | 2/21
46 h-m-p 1.6000 8.0000 0.0001 C 1226.517884 0 1.6607 1806 | 2/21
47 h-m-p 1.6000 8.0000 0.0000 C 1226.517883 0 1.8971 1849 | 2/21
48 h-m-p 0.3794 8.0000 0.0001 +Y 1226.517883 0 1.1898 1893 | 2/21
49 h-m-p 1.6000 8.0000 0.0000 C 1226.517883 0 1.6000 1936 | 2/21
50 h-m-p 1.6000 8.0000 0.0000 Y 1226.517883 0 2.6049 1979 | 2/21
51 h-m-p 1.6000 8.0000 0.0000 --Y 1226.517883 0 0.0250 2024 | 2/21
52 h-m-p 0.0160 8.0000 0.0000 ------C 1226.517883 0 0.0000 2073
Out..
lnL = -1226.517883
2074 lfun, 2074 eigenQcodon, 39406 P(t)
Time used: 0:12
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9))); MP score: 37
0.004608 0.000869 0.004645 0.006155 0.002447 0.000000 0.005164 0.027740 0.008922 0.010170 0.001602 0.005036 0.007631 0.007607 0.013922 0.006795 0.010580 0.014695 0.023269 2.353508 0.822315 0.590611
ntime & nrate & np: 19 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.453029
np = 22
lnL0 = -1255.239283
Iterating by ming2
Initial: fx= 1255.239283
x= 0.00461 0.00087 0.00465 0.00615 0.00245 0.00000 0.00516 0.02774 0.00892 0.01017 0.00160 0.00504 0.00763 0.00761 0.01392 0.00679 0.01058 0.01470 0.02327 2.35351 0.82232 0.59061
1 h-m-p 0.0000 0.0000 555.4129 ++ 1255.238263 m 0.0000 27 | 1/22
2 h-m-p 0.0000 0.0000 446.9959 ++ 1254.943963 m 0.0000 52 | 2/22
3 h-m-p 0.0000 0.0001 189.2076 CCCC 1254.773434 3 0.0000 83 | 2/22
4 h-m-p 0.0000 0.0004 63.8337 CCC 1254.679731 2 0.0001 112 | 2/22
5 h-m-p 0.0001 0.0005 69.1109 CCC 1254.573742 2 0.0001 141 | 2/22
6 h-m-p 0.0000 0.0008 158.5391 +CCCC 1254.084621 3 0.0002 173 | 2/22
7 h-m-p 0.0000 0.0004 706.9681 +CCYCCC 1250.188974 5 0.0003 209 | 2/22
8 h-m-p 0.0000 0.0000 15656.0697 +CYYCCC 1246.213455 5 0.0000 243 | 2/22
9 h-m-p 0.0000 0.0000 329945.3670 ++ 1245.619137 m 0.0000 268 | 3/22
10 h-m-p 0.0000 0.0000 1621.7545 CCCCC 1245.499340 4 0.0000 301 | 3/22
11 h-m-p 0.0000 0.0001 2064.8118 YCCC 1245.147941 3 0.0000 331 | 3/22
12 h-m-p 0.0000 0.0000 1301.2811 CCC 1245.042042 2 0.0000 360 | 3/22
13 h-m-p 0.0000 0.0001 1843.7000 CYC 1244.818817 2 0.0000 388 | 3/22
14 h-m-p 0.0001 0.0003 269.5120 YCCC 1244.665276 3 0.0001 418 | 3/22
15 h-m-p 0.0001 0.0008 187.1573 YCCC 1244.281270 3 0.0002 448 | 3/22
16 h-m-p 0.0001 0.0003 351.7492 CYCCC 1243.597558 4 0.0001 480 | 3/22
17 h-m-p 0.0000 0.0002 348.3676 CCCCC 1243.250564 4 0.0001 513 | 3/22
18 h-m-p 0.0002 0.0009 59.2675 CYCCC 1242.816695 4 0.0003 545 | 2/22
19 h-m-p 0.0001 0.0006 77.1043 +CC 1242.101842 1 0.0005 573 | 2/22
20 h-m-p 0.0033 0.0166 3.4294 YYC 1242.049387 2 0.0025 600 | 2/22
21 h-m-p 0.0003 0.0485 33.1070 +++CYYYYYCCCC 1233.406798 10 0.0332 642 | 2/22
22 h-m-p 0.0767 0.3833 0.5136 ++ 1230.109955 m 0.3833 667 | 3/22
23 h-m-p 0.1498 0.7489 0.2077 CCCC 1229.260485 3 0.2070 718 | 2/22
24 h-m-p 0.0079 0.0393 3.5785 -YC 1229.258938 1 0.0003 764 | 2/22
25 h-m-p 0.0020 0.0255 0.5593 ++ 1229.154882 m 0.0255 789 | 3/22
26 h-m-p 0.0235 1.8782 0.6060 ++CCY 1228.288829 2 0.5526 840 | 3/22
27 h-m-p 0.3427 1.7136 0.8644 CCCC 1227.726200 3 0.4749 890 | 3/22
28 h-m-p 0.4948 3.4689 0.8295 CCC 1227.238144 2 0.5512 938 | 3/22
29 h-m-p 1.4012 7.0059 0.1220 CCCCC 1226.809212 4 1.8653 990 | 3/22
30 h-m-p 0.9221 4.6106 0.0504 CCCC 1226.585571 3 1.4886 1040 | 3/22
31 h-m-p 1.6000 8.0000 0.0447 CYC 1226.321014 2 2.0868 1087 | 3/22
32 h-m-p 0.5895 2.9473 0.1215 CCCCC 1226.141640 4 0.7924 1139 | 3/22
33 h-m-p 1.6000 8.0000 0.0388 CCC 1226.022449 2 1.8246 1187 | 3/22
34 h-m-p 0.9988 8.0000 0.0709 YC 1225.950175 1 2.2541 1232 | 3/22
35 h-m-p 1.6000 8.0000 0.0036 CCC 1225.878230 2 2.1757 1280 | 3/22
36 h-m-p 0.1724 8.0000 0.0456 ++CCC 1225.792462 2 3.0583 1330 | 3/22
37 h-m-p 1.6000 8.0000 0.0585 CCC 1225.732525 2 1.7123 1378 | 3/22
38 h-m-p 1.6000 8.0000 0.0508 CC 1225.681772 1 1.9698 1424 | 3/22
39 h-m-p 1.6000 8.0000 0.0158 YC 1225.579991 1 3.8703 1469 | 3/22
40 h-m-p 1.6000 8.0000 0.0137 CCC 1225.516658 2 2.3471 1517 | 3/22
41 h-m-p 1.6000 8.0000 0.0027 CC 1225.486984 1 1.7940 1563 | 3/22
42 h-m-p 0.1765 8.0000 0.0271 +YC 1225.478116 1 1.5600 1609 | 3/22
43 h-m-p 1.6000 8.0000 0.0143 YC 1225.470261 1 2.6254 1654 | 3/22
44 h-m-p 1.6000 8.0000 0.0122 CC 1225.466864 1 2.4281 1700 | 3/22
45 h-m-p 1.6000 8.0000 0.0070 CC 1225.465257 1 1.9070 1746 | 3/22
46 h-m-p 1.6000 8.0000 0.0024 C 1225.465103 0 1.8030 1790 | 3/22
47 h-m-p 1.6000 8.0000 0.0010 C 1225.465070 0 1.7644 1834 | 3/22
48 h-m-p 1.6000 8.0000 0.0003 C 1225.465063 0 1.7795 1878 | 3/22
49 h-m-p 1.6000 8.0000 0.0000 C 1225.465063 0 1.3737 1922 | 3/22
50 h-m-p 1.6000 8.0000 0.0000 Y 1225.465062 0 1.0862 1966 | 3/22
51 h-m-p 1.6000 8.0000 0.0000 C 1225.465062 0 1.6000 2010 | 3/22
52 h-m-p 1.6000 8.0000 0.0000 Y 1225.465062 0 2.9940 2054 | 3/22
53 h-m-p 1.5814 8.0000 0.0000 -Y 1225.465062 0 0.0722 2099 | 3/22
54 h-m-p 0.0270 8.0000 0.0000 Y 1225.465062 0 0.0067 2143
Out..
lnL = -1225.465062
2144 lfun, 6432 eigenQcodon, 81472 P(t)
Time used: 0:34
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9))); MP score: 37
initial w for M2:NSpselection reset.
0.004212 0.000000 0.004552 0.006294 0.002792 0.000312 0.005103 0.027713 0.009081 0.010000 0.001818 0.005838 0.008421 0.007704 0.014835 0.006606 0.010455 0.014728 0.022483 2.384138 0.862503 0.107410 0.336572 2.818396
ntime & nrate & np: 19 3 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.886298
np = 24
lnL0 = -1264.012265
Iterating by ming2
Initial: fx= 1264.012265
x= 0.00421 0.00000 0.00455 0.00629 0.00279 0.00031 0.00510 0.02771 0.00908 0.01000 0.00182 0.00584 0.00842 0.00770 0.01484 0.00661 0.01046 0.01473 0.02248 2.38414 0.86250 0.10741 0.33657 2.81840
1 h-m-p 0.0000 0.0000 491.4095 ++ 1264.011410 m 0.0000 29 | 1/24
2 h-m-p 0.0000 0.0000 428.2494 ++ 1263.914947 m 0.0000 56 | 2/24
3 h-m-p 0.0000 0.0001 146.9791 CCCC 1263.803054 3 0.0000 89 | 2/24
4 h-m-p 0.0000 0.0004 52.4256 CCC 1263.746745 2 0.0001 120 | 2/24
5 h-m-p 0.0001 0.0008 44.8745 CYC 1263.709351 2 0.0001 150 | 2/24
6 h-m-p 0.0001 0.0005 53.6513 YCCC 1263.653193 3 0.0001 182 | 2/24
7 h-m-p 0.0000 0.0004 164.6089 +YYC 1263.496387 2 0.0001 212 | 2/24
8 h-m-p 0.0000 0.0005 397.8353 +CYCCC 1262.663706 4 0.0002 247 | 2/24
9 h-m-p 0.0000 0.0002 1506.4049 +YYCYC 1260.522114 4 0.0001 280 | 2/24
10 h-m-p 0.0000 0.0000 11235.0166 ++ 1258.758240 m 0.0000 307 | 3/24
11 h-m-p 0.0000 0.0002 1151.0436 CCC 1258.741348 2 0.0000 338 | 3/24
12 h-m-p 0.0002 0.0017 72.8650 CCC 1258.700599 2 0.0002 369 | 3/24
13 h-m-p 0.0002 0.0009 31.2781 CYCCC 1258.541816 4 0.0003 403 | 3/24
14 h-m-p 0.0001 0.0004 65.9793 CYCCC 1258.041356 4 0.0002 437 | 3/24
15 h-m-p 0.0000 0.0002 177.3960 YCCCC 1256.846940 4 0.0001 471 | 3/24
16 h-m-p 0.0000 0.0001 212.1655 CCCC 1256.607955 3 0.0000 504 | 3/24
17 h-m-p 0.0001 0.0005 78.6206 YCCC 1256.328778 3 0.0001 536 | 3/24
18 h-m-p 0.0001 0.0007 39.8808 YCCC 1256.272986 3 0.0001 568 | 3/24
19 h-m-p 0.0003 0.0474 12.3564 +++YCYCCCC 1254.989041 6 0.0240 608 | 3/24
20 h-m-p 0.0001 0.0004 5639.4182 ++ 1248.075341 m 0.0004 635 | 4/24
21 h-m-p 0.2692 1.3461 3.6893 YYYCC 1244.748785 4 0.3073 667 | 4/24
22 h-m-p 0.4027 6.0751 2.8153 YYCCC 1242.037099 4 0.6378 700 | 4/24
23 h-m-p 0.5639 2.8197 2.0837 CCC 1241.121844 2 0.6216 731 | 4/24
24 h-m-p 0.9949 4.9747 0.3651 ----------------.. | 4/24
25 h-m-p 0.0000 0.0002 163.0523 +YC 1240.716862 1 0.0000 821 | 4/24
26 h-m-p 0.0000 0.0002 93.6154 CCCC 1240.569576 3 0.0000 854 | 4/24
27 h-m-p 0.0001 0.0005 41.3711 YC 1240.542072 1 0.0000 882 | 4/24
28 h-m-p 0.0001 0.0010 20.2293 YC 1240.533020 1 0.0001 910 | 4/24
29 h-m-p 0.0000 0.0017 28.8325 +YC 1240.513729 1 0.0001 939 | 4/24
30 h-m-p 0.0001 0.0028 49.8357 YCC 1240.487927 2 0.0001 969 | 4/24
31 h-m-p 0.0000 0.0008 131.1218 +YYC 1240.396989 2 0.0001 999 | 4/24
32 h-m-p 0.0000 0.0004 385.1819 +YYYYYYC 1240.005529 6 0.0002 1033 | 4/24
33 h-m-p 0.0000 0.0007 1944.3449 +YCCCC 1236.988375 4 0.0003 1068 | 4/24
34 h-m-p 0.0000 0.0002 9771.1860 +YCCC 1232.526164 3 0.0001 1101 | 4/24
35 h-m-p 0.0000 0.0001 12716.9791 YCCC 1230.051617 3 0.0000 1133 | 4/24
36 h-m-p 0.0000 0.0001 2737.7445 CYCCC 1229.548881 4 0.0000 1167 | 4/24
37 h-m-p 0.0001 0.0005 329.1833 YYCC 1229.417209 3 0.0001 1198 | 4/24
38 h-m-p 0.0000 0.0002 231.0169 YCC 1229.389600 2 0.0000 1228 | 4/24
39 h-m-p 0.0008 0.0042 4.9407 -YC 1229.389329 1 0.0000 1257 | 4/24
40 h-m-p 0.0001 0.0122 1.6863 YC 1229.389262 1 0.0000 1285 | 4/24
41 h-m-p 0.0001 0.0271 1.6381 +Y 1229.389075 0 0.0002 1313 | 4/24
42 h-m-p 0.0003 0.1746 6.2791 +++YCCC 1229.208541 3 0.0433 1348 | 4/24
43 h-m-p 0.0000 0.0005 5544.7450 +YCCCCC 1228.310768 5 0.0002 1385 | 4/24
44 h-m-p 0.3486 1.7430 3.3595 CYCCC 1226.981073 4 0.7518 1420 | 4/24
45 h-m-p 0.1373 0.6863 4.8533 CYCCCC 1226.345723 5 0.2196 1456 | 4/24
46 h-m-p 1.2690 6.3450 0.6607 YCCCC 1225.625930 4 0.7145 1490 | 4/24
47 h-m-p 1.1081 6.4970 0.4260 YYC 1225.479036 2 0.8815 1539 | 4/24
48 h-m-p 1.6000 8.0000 0.0349 YC 1225.466994 1 0.7724 1587 | 3/24
49 h-m-p 0.2709 8.0000 0.0994 +YC 1225.462377 1 0.6850 1636 | 3/24
50 h-m-p 1.6000 8.0000 0.0330 CC 1225.459652 1 1.8445 1686 | 3/24
51 h-m-p 1.4381 8.0000 0.0423 CC 1225.457852 1 1.9650 1736 | 3/24
52 h-m-p 1.6000 8.0000 0.0170 YC 1225.457499 1 1.0146 1785 | 3/24
53 h-m-p 1.6000 8.0000 0.0027 Y 1225.457474 0 1.0337 1833 | 3/24
54 h-m-p 1.6000 8.0000 0.0008 C 1225.457473 0 1.5138 1881 | 3/24
55 h-m-p 1.0961 8.0000 0.0011 ++ 1225.457465 m 8.0000 1929 | 3/24
56 h-m-p 0.1556 8.0000 0.0577 ++C 1225.457399 0 2.5060 1979 | 3/24
57 h-m-p 1.3566 8.0000 0.1067 C 1225.457288 0 1.5751 2027 | 3/24
58 h-m-p 0.3752 8.0000 0.4478 Y 1225.457193 0 0.3752 2075 | 3/24
59 h-m-p 1.6000 8.0000 0.0792 Y 1225.457072 0 1.2791 2123 | 3/24
60 h-m-p 1.3581 8.0000 0.0746 YC 1225.456989 1 2.4693 2172 | 3/24
61 h-m-p 1.6000 8.0000 0.0652 YC 1225.456925 1 0.8602 2221 | 3/24
62 h-m-p 0.2577 8.0000 0.2177 +C 1225.456836 0 1.0306 2270 | 3/24
63 h-m-p 1.1001 8.0000 0.2039 Y 1225.456775 0 1.1001 2318 | 3/24
64 h-m-p 1.6000 8.0000 0.0320 YC 1225.456728 1 0.8418 2367 | 3/24
65 h-m-p 0.1497 8.0000 0.1800 ++Y 1225.456652 0 1.6053 2417 | 3/24
66 h-m-p 1.5017 8.0000 0.1924 C 1225.456602 0 1.5017 2465 | 3/24
67 h-m-p 1.6000 8.0000 0.0945 YC 1225.456567 1 0.8595 2514 | 3/24
68 h-m-p 0.2646 8.0000 0.3069 +C 1225.456518 0 1.0583 2563 | 3/24
69 h-m-p 1.4830 8.0000 0.2190 Y 1225.456495 0 1.4830 2611 | 3/24
70 h-m-p 1.6000 8.0000 0.0645 Y 1225.456474 0 0.9869 2659 | 3/24
71 h-m-p 0.2584 8.0000 0.2463 +C 1225.456444 0 1.5724 2708 | 3/24
72 h-m-p 1.3897 8.0000 0.2787 C 1225.456430 0 1.3897 2756 | 3/24
73 h-m-p 1.6000 8.0000 0.1851 C 1225.456415 0 1.6000 2804 | 3/24
74 h-m-p 0.5830 8.0000 0.5080 C 1225.456402 0 0.8547 2852 | 3/24
75 h-m-p 1.3345 8.0000 0.3254 C 1225.456397 0 1.3345 2900 | 3/24
76 h-m-p 1.6000 8.0000 0.1247 C 1225.456392 0 1.9322 2948 | 3/24
77 h-m-p 0.6123 8.0000 0.3935 +Y 1225.456387 0 1.6839 2997 | 3/24
78 h-m-p 1.6000 8.0000 0.2570 +Y 1225.456383 0 4.4557 3046 | 3/24
79 h-m-p 1.6000 8.0000 0.3583 C 1225.456382 0 1.3213 3094 | 3/24
80 h-m-p 1.6000 8.0000 0.1779 Y 1225.456381 0 1.2069 3142 | 3/24
81 h-m-p 0.5826 8.0000 0.3685 +Y 1225.456381 0 3.9329 3191 | 3/24
82 h-m-p 1.6000 8.0000 0.2340 C 1225.456381 0 1.6000 3239 | 3/24
83 h-m-p 1.0459 8.0000 0.3580 +Y 1225.456381 0 3.3286 3288 | 3/24
84 h-m-p 1.6000 8.0000 0.3781 C 1225.456381 0 2.3721 3336 | 3/24
85 h-m-p 1.6000 8.0000 0.1720 Y 1225.456381 0 0.6952 3384 | 3/24
86 h-m-p 0.1479 8.0000 0.8088 +Y 1225.456381 0 0.4132 3433 | 3/24
87 h-m-p 0.8477 8.0000 0.3942 C 1225.456381 0 1.0346 3481 | 3/24
88 h-m-p 0.8519 8.0000 0.4788 +C 1225.456381 0 3.1494 3530 | 3/24
89 h-m-p 1.6000 8.0000 0.1715 +C 1225.456381 0 6.1102 3579 | 3/24
90 h-m-p 1.6000 8.0000 0.5464 -----C 1225.456381 0 0.0006 3632 | 3/24
91 h-m-p 0.0160 8.0000 0.0244 ----C 1225.456381 0 0.0000 3684 | 3/24
92 h-m-p 0.0160 8.0000 0.0212 --------Y 1225.456381 0 0.0000 3740 | 3/24
93 h-m-p 0.0160 8.0000 0.6452 -------------.. | 3/24
94 h-m-p 0.0015 0.7640 0.0199 ----------- | 3/24
95 h-m-p 0.0015 0.7640 0.0199 -----------
Out..
lnL = -1225.456381
3914 lfun, 15656 eigenQcodon, 223098 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1238.764259 S = -1215.955456 -14.075063
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 1:36
did 20 / 83 patterns 1:36
did 30 / 83 patterns 1:36
did 40 / 83 patterns 1:36
did 50 / 83 patterns 1:36
did 60 / 83 patterns 1:36
did 70 / 83 patterns 1:36
did 80 / 83 patterns 1:36
did 83 / 83 patterns 1:36
Time used: 1:36
Model 3: discrete
TREE # 1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9))); MP score: 37
0.004450 0.000000 0.004208 0.006145 0.002320 0.000204 0.004535 0.027671 0.008720 0.009314 0.001734 0.004918 0.007642 0.007045 0.013897 0.006532 0.010256 0.014343 0.022677 2.392637 0.335590 0.845675 0.014885 0.038125 0.053731
ntime & nrate & np: 19 4 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.621487
np = 25
lnL0 = -1227.356217
Iterating by ming2
Initial: fx= 1227.356217
x= 0.00445 0.00000 0.00421 0.00615 0.00232 0.00020 0.00453 0.02767 0.00872 0.00931 0.00173 0.00492 0.00764 0.00704 0.01390 0.00653 0.01026 0.01434 0.02268 2.39264 0.33559 0.84567 0.01488 0.03812 0.05373
1 h-m-p 0.0000 0.0000 483.3147 ++ 1227.354738 m 0.0000 55 | 1/25
2 h-m-p 0.0000 0.0000 457.8488 ++ 1227.288911 m 0.0000 108 | 2/25
3 h-m-p 0.0000 0.0001 185.0290 CCCC 1227.152319 3 0.0000 166 | 2/25
4 h-m-p 0.0001 0.0005 45.3641 YCC 1227.117239 2 0.0000 220 | 2/25
5 h-m-p 0.0001 0.0007 27.1782 YC 1227.107435 1 0.0000 272 | 2/25
6 h-m-p 0.0001 0.0021 14.5744 CC 1227.101435 1 0.0001 325 | 2/25
7 h-m-p 0.0001 0.0012 19.6919 CC 1227.095150 1 0.0001 378 | 2/25
8 h-m-p 0.0000 0.0006 32.2082 YC 1227.084639 1 0.0001 430 | 2/25
9 h-m-p 0.0001 0.0004 41.9535 CC 1227.076503 1 0.0001 483 | 2/25
10 h-m-p 0.0001 0.0004 36.1413 YC 1227.070622 1 0.0000 535 | 2/25
11 h-m-p 0.0002 0.0014 9.0518 CC 1227.068817 1 0.0001 588 | 2/25
12 h-m-p 0.0001 0.0013 8.5481 YC 1227.067655 1 0.0001 640 | 2/25
13 h-m-p 0.0001 0.0013 7.7362 +YC 1227.064240 1 0.0002 693 | 2/25
14 h-m-p 0.0000 0.0002 39.3718 ++ 1227.049889 m 0.0002 744 | 3/25
15 h-m-p 0.0000 0.0013 98.0058 CC 1227.029226 1 0.0001 797 | 3/25
16 h-m-p 0.0001 0.0009 105.5417 CCC 1227.010013 2 0.0001 851 | 3/25
17 h-m-p 0.0001 0.0012 51.1823 CC 1227.004849 1 0.0000 903 | 3/25
18 h-m-p 0.0005 0.0241 4.0563 CC 1226.999721 1 0.0006 955 | 3/25
19 h-m-p 0.0000 0.0017 53.3480 +++ 1226.637368 m 0.0017 1006 | 4/25
20 h-m-p 0.0001 0.0026 896.4330 CC 1226.615062 1 0.0000 1058 | 4/25
21 h-m-p 0.0439 0.5181 0.4776 YCCC 1226.174695 3 0.0880 1112 | 4/25
22 h-m-p 0.1602 8.0000 0.2624 ++YYC 1226.061440 2 1.9706 1165 | 4/25
23 h-m-p 0.9828 8.0000 0.5262 CCCC 1225.886207 3 1.7834 1220 | 4/25
24 h-m-p 1.6000 8.0000 0.2635 CCC 1225.777915 2 1.6878 1273 | 4/25
25 h-m-p 1.6000 8.0000 0.1334 CYC 1225.716553 2 1.5044 1325 | 4/25
26 h-m-p 0.4136 8.0000 0.4851 YCCC 1225.653543 3 0.9681 1379 | 4/25
27 h-m-p 1.6000 8.0000 0.0961 YC 1225.596521 1 2.6254 1429 | 4/25
28 h-m-p 1.6000 8.0000 0.0847 YCCC 1225.528373 3 3.2665 1483 | 4/25
29 h-m-p 1.6000 8.0000 0.1523 CCC 1225.496472 2 2.0653 1536 | 4/25
30 h-m-p 1.6000 8.0000 0.0763 CC 1225.477319 1 1.4134 1587 | 4/25
31 h-m-p 0.5096 8.0000 0.2116 +YC 1225.459223 1 1.3225 1638 | 4/25
32 h-m-p 1.6000 8.0000 0.0359 YC 1225.456656 1 1.2453 1688 | 4/25
33 h-m-p 1.6000 8.0000 0.0196 YC 1225.456416 1 1.2204 1738 | 4/25
34 h-m-p 1.6000 8.0000 0.0044 C 1225.456384 0 1.3846 1787 | 4/25
35 h-m-p 1.6000 8.0000 0.0011 Y 1225.456381 0 1.0906 1836 | 4/25
36 h-m-p 1.6000 8.0000 0.0002 Y 1225.456381 0 1.1615 1885 | 4/25
37 h-m-p 1.6000 8.0000 0.0001 C 1225.456381 0 0.5752 1934 | 4/25
38 h-m-p 1.5918 8.0000 0.0000 -----C 1225.456381 0 0.0005 1988
Out..
lnL = -1225.456381
1989 lfun, 7956 eigenQcodon, 113373 P(t)
Time used: 2:07
Model 7: beta
TREE # 1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9))); MP score: 37
0.004258 0.000000 0.005015 0.006394 0.003010 0.000104 0.004575 0.028084 0.009000 0.009253 0.001791 0.005681 0.007635 0.007062 0.014239 0.006819 0.010438 0.014319 0.022794 2.392660 0.637551 1.244267
ntime & nrate & np: 19 1 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.022649
np = 22
lnL0 = -1241.645976
Iterating by ming2
Initial: fx= 1241.645976
x= 0.00426 0.00000 0.00502 0.00639 0.00301 0.00010 0.00457 0.02808 0.00900 0.00925 0.00179 0.00568 0.00763 0.00706 0.01424 0.00682 0.01044 0.01432 0.02279 2.39266 0.63755 1.24427
1 h-m-p 0.0000 0.0000 448.6245 ++ 1241.644650 m 0.0000 49 | 1/22
2 h-m-p 0.0000 0.0000 458.6599 ++ 1241.613612 m 0.0000 96 | 2/22
3 h-m-p 0.0000 0.0001 132.6212 CCCC 1241.528009 3 0.0000 148 | 2/22
4 h-m-p 0.0000 0.0004 47.5359 CCC 1241.487559 2 0.0000 197 | 2/22
5 h-m-p 0.0001 0.0010 41.6487 CC 1241.447544 1 0.0001 244 | 2/22
6 h-m-p 0.0001 0.0015 55.6834 +CCC 1241.273466 2 0.0003 294 | 2/22
7 h-m-p 0.0000 0.0003 457.6499 +YYC 1240.709733 2 0.0001 342 | 2/22
8 h-m-p 0.0000 0.0004 1446.9963 +CYYCCC 1237.333237 5 0.0003 397 | 2/22
9 h-m-p 0.0000 0.0000 19423.4747 YCYCCC 1235.708110 5 0.0000 450 | 2/22
10 h-m-p 0.0000 0.0000 5322.2867 CYCCC 1235.337458 4 0.0000 502 | 2/22
11 h-m-p 0.0000 0.0001 247.3462 YY 1235.303697 1 0.0000 548 | 2/22
12 h-m-p 0.0000 0.0002 104.6017 YC 1235.290316 1 0.0000 594 | 2/22
13 h-m-p 0.0001 0.0006 22.6216 YCC 1235.284212 2 0.0000 642 | 2/22
14 h-m-p 0.0000 0.0017 29.2917 +YC 1235.266997 1 0.0001 689 | 2/22
15 h-m-p 0.0001 0.0024 33.8197 CCC 1235.253636 2 0.0001 738 | 2/22
16 h-m-p 0.0000 0.0013 58.2797 YC 1235.231880 1 0.0001 784 | 2/22
17 h-m-p 0.0000 0.0020 171.0145 ++CYCCC 1234.650914 4 0.0007 838 | 2/22
18 h-m-p 0.0001 0.0006 1165.0012 +YYCYCCC 1231.453106 6 0.0005 893 | 2/22
19 h-m-p 0.0005 0.0025 19.4219 CC 1231.442079 1 0.0002 940 | 2/22
20 h-m-p 0.0010 0.2644 3.0398 +++YCYCCC 1228.494463 5 0.1603 996 | 2/22
21 h-m-p 0.1173 0.5863 0.3154 YCCCC 1227.413237 4 0.2879 1048 | 2/22
22 h-m-p 0.2268 1.5217 0.4003 CYC 1226.773403 2 0.2528 1096 | 2/22
23 h-m-p 0.3865 5.9192 0.2618 YCCC 1226.436546 3 0.6704 1146 | 2/22
24 h-m-p 1.0900 5.4501 0.1356 YYC 1226.242260 2 0.9396 1193 | 2/22
25 h-m-p 1.6000 8.0000 0.0595 CY 1226.162666 1 1.5839 1240 | 2/22
26 h-m-p 1.6000 8.0000 0.0184 CC 1226.122344 1 1.3331 1287 | 2/22
27 h-m-p 0.6161 8.0000 0.0399 CC 1226.102278 1 0.8428 1334 | 2/22
28 h-m-p 1.6000 8.0000 0.0055 CC 1226.084804 1 2.0305 1381 | 2/22
29 h-m-p 0.2324 8.0000 0.0476 +CC 1226.077789 1 1.2472 1429 | 2/22
30 h-m-p 1.6000 8.0000 0.0284 CC 1226.071801 1 2.4170 1476 | 2/22
31 h-m-p 1.6000 8.0000 0.0377 CC 1226.066228 1 2.3628 1523 | 2/22
32 h-m-p 1.6000 8.0000 0.0435 CC 1226.062671 1 1.7104 1570 | 2/22
33 h-m-p 1.2060 8.0000 0.0617 +CC 1226.052743 1 4.1932 1618 | 2/22
34 h-m-p 1.4867 8.0000 0.1740 +CYYC 1225.973099 3 6.8746 1669 | 2/22
35 h-m-p 0.0617 0.3083 3.1292 YYYYCCCCC 1225.962003 8 0.0713 1726 | 2/22
36 h-m-p 0.0898 0.4490 1.3696 CCC 1225.914949 2 0.2431 1776 | 2/22
37 h-m-p 0.9575 4.7876 0.1584 YCCCC 1225.861227 4 1.1967 1828 | 2/22
38 h-m-p 0.5247 6.8952 0.3612 CYC 1225.854022 2 0.1105 1876 | 2/22
39 h-m-p 1.6000 8.0000 0.0139 CCC 1225.830102 2 1.9479 1925 | 2/22
40 h-m-p 0.2577 2.5455 0.1052 +YYYC 1225.823838 3 0.9410 1974 | 2/22
41 h-m-p 1.6000 8.0000 0.0194 CC 1225.819439 1 0.6124 2021 | 2/22
42 h-m-p 0.7132 8.0000 0.0167 CC 1225.818609 1 1.1697 2068 | 2/22
43 h-m-p 1.6000 8.0000 0.0074 C 1225.818505 0 1.8705 2113 | 2/22
44 h-m-p 1.6000 8.0000 0.0025 C 1225.818482 0 1.5413 2158 | 2/22
45 h-m-p 1.6000 8.0000 0.0017 C 1225.818470 0 2.0822 2203 | 2/22
46 h-m-p 1.6000 8.0000 0.0010 C 1225.818470 0 0.4776 2248 | 2/22
47 h-m-p 1.6000 8.0000 0.0001 Y 1225.818469 0 1.0891 2293 | 2/22
48 h-m-p 0.7510 8.0000 0.0001 ++ 1225.818465 m 8.0000 2338 | 2/22
49 h-m-p 1.4572 8.0000 0.0008 -----------C 1225.818465 0 0.0000 2394
Out..
lnL = -1225.818465
2395 lfun, 26345 eigenQcodon, 455050 P(t)
Time used: 4:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9))); MP score: 37
initial w for M8:NSbetaw>1 reset.
0.004438 0.000000 0.004856 0.006791 0.002458 0.000662 0.004286 0.027916 0.008570 0.009279 0.001793 0.005661 0.008264 0.007126 0.014322 0.007033 0.010947 0.014564 0.022912 2.395352 0.900000 0.681712 1.353905 2.843187
ntime & nrate & np: 19 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.862038
np = 24
lnL0 = -1249.969688
Iterating by ming2
Initial: fx= 1249.969688
x= 0.00444 0.00000 0.00486 0.00679 0.00246 0.00066 0.00429 0.02792 0.00857 0.00928 0.00179 0.00566 0.00826 0.00713 0.01432 0.00703 0.01095 0.01456 0.02291 2.39535 0.90000 0.68171 1.35390 2.84319
1 h-m-p 0.0000 0.0000 479.6739 ++ 1249.968076 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 425.4109 ++ 1249.748026 m 0.0000 104 | 2/24
3 h-m-p 0.0000 0.0001 291.0466 YCCCC 1249.328658 4 0.0000 161 | 2/24
4 h-m-p 0.0000 0.0003 178.4633 +CYCCC 1247.599065 4 0.0002 218 | 2/24
5 h-m-p 0.0000 0.0001 1076.6024 +CC 1245.510542 1 0.0000 270 | 2/24
6 h-m-p 0.0000 0.0000 2551.0231 ++ 1244.620597 m 0.0000 319 | 3/24
7 h-m-p 0.0000 0.0004 131.9534 YCCC 1244.476433 3 0.0001 373 | 3/24
8 h-m-p 0.0000 0.0002 216.9844 CCCC 1244.220558 3 0.0001 427 | 3/24
9 h-m-p 0.0001 0.0003 215.1355 CCC 1243.974352 2 0.0001 479 | 3/24
10 h-m-p 0.0001 0.0005 171.5386 +YC 1243.237392 1 0.0002 529 | 3/24
11 h-m-p 0.0000 0.0001 669.1414 +YYCYCC 1242.217186 5 0.0001 585 | 3/24
12 h-m-p 0.0000 0.0000 1599.6385 +YCYCCC 1241.436266 5 0.0000 642 | 3/24
13 h-m-p 0.0000 0.0002 240.7596 CCCC 1241.283651 3 0.0000 696 | 3/24
14 h-m-p 0.0000 0.0002 63.0070 Y 1241.261668 0 0.0000 744 | 3/24
15 h-m-p 0.0000 0.0004 112.3495 YC 1241.223571 1 0.0000 793 | 3/24
16 h-m-p 0.0001 0.0009 69.0672 +YCC 1241.134081 2 0.0001 845 | 3/24
17 h-m-p 0.0001 0.0032 170.6652 ++CYCCCC 1239.130720 5 0.0014 904 | 3/24
18 h-m-p 0.0000 0.0001 6093.4688 +YYYCCCC 1235.940893 6 0.0000 962 | 3/24
19 h-m-p 0.0000 0.0002 266.2059 CCCC 1235.846718 3 0.0000 1016 | 3/24
20 h-m-p 0.0019 0.8085 5.5660 +++YCCC 1231.780217 3 0.2529 1072 | 2/24
21 h-m-p 0.0001 0.0004 8813.4819 CYCCC 1230.378791 4 0.0001 1127 | 2/24
22 h-m-p 0.0851 0.4256 3.2816 YCCCC 1228.199872 4 0.1770 1183 | 2/24
23 h-m-p 0.0208 0.1041 5.4421 +
QuantileBeta(0.15, 0.00500, 3.59844) = 6.617715e-161 2000 rounds
YCCC 1226.934459 3 0.0546 1238 | 2/24
24 h-m-p 0.4076 2.2192 0.7290 CCC 1226.146743 2 0.4845 1291 | 2/24
25 h-m-p 0.4002 2.0009 0.6671 YCCC 1225.717894 3 0.8138 1345 | 2/24
26 h-m-p 0.2140 1.0701 0.5346 YCC 1225.593869 2 0.4609 1397 | 2/24
27 h-m-p 0.5234 2.6168 0.0931 +
QuantileBeta(0.15, 0.00500, 3.80239) = 6.212430e-161 2000 rounds
YC 1225.523908 1 1.4023 1448 | 2/24
28 h-m-p 0.2237 1.1184 0.0572 +
QuantileBeta(0.15, 0.00500, 3.80966) = 6.198900e-161 2000 rounds
CC 1225.502567 1 0.7730 1500 | 2/24
29 h-m-p 0.0824 0.4122 0.0733 +
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
+ 1225.490828 m 0.4122 1549
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81088) = 6.196633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81056) = 6.197228e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161 2000 rounds
| 3/24
30 h-m-p 0.2087 2.9600 0.1440
QuantileBeta(0.15, 0.00500, 3.80878) = 6.200538e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80296) = 6.211385e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.78318) = 6.248491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80105) = 6.214945e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.79211) = 6.231673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80065) = 6.215695e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.79638) = 6.223674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
C 1225.469575 2 1.0889 1603
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.432791e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80075) = 6.215500e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80043) = 6.216098e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161 2000 rounds
| 3/24
31 h-m-p 1.6000 8.0000 0.0186
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73644) = 6.337963e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78362) = 6.247660e-161 2000 rounds
C 1225.464926 0 1.6000 1651
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.463940e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78471) = 6.245597e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78439) = 6.246199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161 2000 rounds
| 3/24
32 h-m-p 0.6832 6.2041 0.0436
QuantileBeta(0.15, 0.00500, 3.77399) = 6.265884e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74230) = 6.326615e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75962) = 6.293269e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
C 1225.461053 1 1.6154 1700
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.513062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75973) = 6.293058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75942) = 6.293667e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161 2000 rounds
| 3/24
33 h-m-p 1.6000 8.0000 0.0151
QuantileBeta(0.15, 0.00500, 3.73731) = 6.336272e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67053) = 6.468572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74224) = 6.326732e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
C 1225.459516 1 1.2564 1749
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.547881e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74225) = 6.326701e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74194) = 6.327315e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161 2000 rounds
| 3/24
34 h-m-p 0.8702 8.0000 0.0218
QuantileBeta(0.15, 0.00500, 3.72465) = 6.360953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67230) = 6.465002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71741) = 6.375130e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.69486) = 6.419753e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
C 1225.458499 1 1.2369 1799
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.597929e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71745) = 6.375056e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71714) = 6.375677e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161 2000 rounds
| 3/24
35 h-m-p 1.5263 8.0000 0.0177
QuantileBeta(0.15, 0.00500, 3.69465) = 6.420162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62672) = 6.558391e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67553) = 6.458481e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
C 1225.457416 1 2.8123 1848
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.683858e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67573) = 6.458081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67541) = 6.458714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161 2000 rounds
| 3/24
36 h-m-p 1.6000 8.0000 0.0136
QuantileBeta(0.15, 0.00500, 3.65781) = 6.494406e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60452) = 6.604871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65212) = 6.506013e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.62832) = 6.555071e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
C 1225.456791 1 2.1219 1898
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.733368e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65217) = 6.505917e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65186) = 6.506558e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161 2000 rounds
| 3/24
37 h-m-p 1.6000 8.0000 0.0110
QuantileBeta(0.15, 0.00500, 3.63866) = 6.533680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59858) = 6.617410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63525) = 6.540715e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.61692) = 6.578840e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
C 1225.456496 1 2.0118 1948
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.769118e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63538) = 6.540458e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63506) = 6.541104e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161 2000 rounds
| 3/24
38 h-m-p 1.6000 8.0000 0.0053
QuantileBeta(0.15, 0.00500, 3.62683) = 6.558163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60168) = 6.610865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62935) = 6.552932e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
C 1225.456403 1 1.1233 1997
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.781737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62949) = 6.552651e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62918) = 6.553299e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161 2000 rounds
| 3/24
39 h-m-p 1.6000 8.0000 0.0020
QuantileBeta(0.15, 0.00500, 3.62788) = 6.555993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62352) = 6.565063e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
Y 1225.456387 0 1.0899 2045
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.783864e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62850) = 6.554706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62819) = 6.555355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161 2000 rounds
| 3/24
40 h-m-p 1.6000 8.0000 0.0009
QuantileBeta(0.15, 0.00500, 3.62777) = 6.556214e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62606) = 6.559766e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
C 1225.456380 0 1.7457 2093
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.785200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62788) = 6.555997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62756) = 6.556646e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161 2000 rounds
| 3/24
41 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 3.62811) = 6.555518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62927) = 6.553108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
C 1225.456378 0 1.5859 2141
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.784376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555201e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62795) = 6.555849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161 2000 rounds
| 3/24
42 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555150e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62883) = 6.554026e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
C 1225.456377 0 1.5656 2189
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.783996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62844) = 6.554834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62812) = 6.555482e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161 2000 rounds
| 3/24
43 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 3.62823) = 6.555269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62807) = 6.555603e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
C 1225.456377 0 1.9197 2237
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.784135e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62837) = 6.554967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62806) = 6.555616e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161 2000 rounds
| 3/24
44 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62837) = 6.554963e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
Y 1225.456377 0 1.1400 2285
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.784074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62840) = 6.554909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62809) = 6.555557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161 2000 rounds
| 3/24
45 h-m-p 1.5959 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62827) = 6.555177e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
C 1225.456377 0 0.6348 2333
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.784051e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554886e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161 2000 rounds
| 3/24
46 h-m-p 1.4568 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555193e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
C 1225.456377 0 0.3642 2381
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
| 3/24
47 h-m-p 0.5217 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555196e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
C 1225.456377 0 0.5217 2429
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555528e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
| 3/24
48 h-m-p 0.8642 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
C 1225.456377 0 0.7078 2477
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554879e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555528e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
| 3/24
49 h-m-p 1.3398 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555210e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
Y 1225.456377 0 2.9657 2525
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555531e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
| 3/24
50 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
C 1225.456377 0 0.5200 2573
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555531e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
| 3/24
51 h-m-p 1.1673 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
Y 1225.456377 0 1.8721 2621
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
| 3/24
52 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
C 1225.456377 0 1.6000 2669
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161 2000 rounds
| 3/24
53 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555203e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
Y 1225.456377 0 4.3478 2718
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555528e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
| 3/24
54 h-m-p 1.2754 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
C 1225.456377 0 0.3189 2766
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
| 3/24
55 h-m-p 0.4181 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
C 1225.456377 0 0.4181 2814
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
| 3/24
56 h-m-p 0.5645 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
C 1225.456377 0 0.0088 2864
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
Out..
lnL = -1225.456377
2865 lfun, 34380 eigenQcodon, 598785 P(t)
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1239.987903 S = -1215.955465 -15.973356
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 7:24
did 20 / 83 patterns 7:24
did 30 / 83 patterns 7:24
did 40 / 83 patterns 7:24
did 50 / 83 patterns 7:25
did 60 / 83 patterns 7:25
did 70 / 83 patterns 7:25
did 80 / 83 patterns 7:25
did 83 / 83 patterns 7:25
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161 2000 rounds
Time used: 7:25
CodeML output code: -1