--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 14:09:41 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/14-3-3zeta-PF/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1309.54         -1349.51
2      -1309.56         -1346.69
--------------------------------------
TOTAL    -1309.55         -1348.87
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.773171    0.183746    0.131319    1.555523    0.690411    663.42    688.18    1.000
r(A<->C){all}   0.076535    0.002012    0.001789    0.161277    0.069540    462.70    489.46    1.001
r(A<->G){all}   0.184582    0.011134    0.020620    0.390947    0.167742    212.49    231.45    1.002
r(A<->T){all}   0.057489    0.001708    0.000097    0.134465    0.048918    377.68    445.33    1.004
r(C<->G){all}   0.047575    0.001074    0.000793    0.112710    0.040204    431.71    433.92    1.001
r(C<->T){all}   0.612294    0.021431    0.353034    0.902968    0.619312    213.30    224.03    1.002
r(G<->T){all}   0.021526    0.000482    0.000014    0.064504    0.014852    601.31    750.46    1.000
pi(A){all}      0.287230    0.000269    0.256960    0.320471    0.286909   1068.07   1074.44    1.000
pi(C){all}      0.257498    0.000247    0.227803    0.288917    0.257218   1026.46   1151.09    1.000
pi(G){all}      0.257149    0.000252    0.225835    0.287693    0.257058   1164.42   1248.35    1.000
pi(T){all}      0.198123    0.000200    0.170892    0.225212    0.197553   1054.69   1148.15    1.000
alpha{1,2}      0.088992    0.000625    0.051868    0.147356    0.085145    599.85    891.91    1.000
alpha{3}        0.762185    0.259295    0.077749    1.735662    0.631283    704.62    757.91    1.000
pinvar{all}     0.853421    0.001031    0.787751    0.908532    0.857633    767.83    969.32    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1225.465062
Model 2: PositiveSelection	-1225.456381
Model 0: one-ratio	-1226.517883
Model 3: discrete	-1225.456381
Model 7: beta	-1225.818465
Model 8: beta&w>1	-1225.456377


Model 0 vs 1	2.105641999999989

Model 2 vs 1	0.017362000000048283

Model 8 vs 7	0.7241760000001705
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=248 

C1              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C2              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C3              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C4              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C5              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C6              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C7              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C8              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C9              MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C10             MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C11             MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C12             MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
                **************************************************

C1              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C2              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C3              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C4              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C5              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C6              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C7              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C8              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C9              YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C10             YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C11             YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C12             YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
                **************************************************

C1              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C2              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C3              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C4              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C5              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C6              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C7              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C8              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C9              LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C10             LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C11             LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C12             LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
                **************************************************

C1              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C2              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C3              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C4              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C5              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C6              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C7              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C8              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C9              AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C10             AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C11             AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C12             AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
                **************************************************

C1              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C2              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C3              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C4              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C5              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C6              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C7              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C8              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C9              DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C10             DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C11             DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C12             DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
                **********************************:***  ********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 -plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  248 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  248 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32736]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [32736]--->[32736]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.676 Mb, Max= 31.578 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN

FORMAT of file /tmp/tmp6123767141380272777aln Not Supported[FATAL:T-COFFEE]
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:100 BS:248
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00  C1	  C2	 100.00
TOP	    1    0	 100.00  C2	  C1	 100.00
BOT	    0    2	 100.00  C1	  C3	 100.00
TOP	    2    0	 100.00  C3	  C1	 100.00
BOT	    0    3	 100.00  C1	  C4	 100.00
TOP	    3    0	 100.00  C4	  C1	 100.00
BOT	    0    4	 100.00  C1	  C5	 100.00
TOP	    4    0	 100.00  C5	  C1	 100.00
BOT	    0    5	 99.19  C1	  C6	 99.19
TOP	    5    0	 99.19  C6	  C1	 99.19
BOT	    0    6	 99.19  C1	  C7	 99.19
TOP	    6    0	 99.19  C7	  C1	 99.19
BOT	    0    7	 99.19  C1	  C8	 99.19
TOP	    7    0	 99.19  C8	  C1	 99.19
BOT	    0    8	 99.19  C1	  C9	 99.19
TOP	    8    0	 99.19  C9	  C1	 99.19
BOT	    0    9	 99.19  C1	 C10	 99.19
TOP	    9    0	 99.19 C10	  C1	 99.19
BOT	    0   10	 99.19  C1	 C11	 99.19
TOP	   10    0	 99.19 C11	  C1	 99.19
BOT	    0   11	 98.79  C1	 C12	 98.79
TOP	   11    0	 98.79 C12	  C1	 98.79
BOT	    1    2	 100.00  C2	  C3	 100.00
TOP	    2    1	 100.00  C3	  C2	 100.00
BOT	    1    3	 100.00  C2	  C4	 100.00
TOP	    3    1	 100.00  C4	  C2	 100.00
BOT	    1    4	 100.00  C2	  C5	 100.00
TOP	    4    1	 100.00  C5	  C2	 100.00
BOT	    1    5	 99.19  C2	  C6	 99.19
TOP	    5    1	 99.19  C6	  C2	 99.19
BOT	    1    6	 99.19  C2	  C7	 99.19
TOP	    6    1	 99.19  C7	  C2	 99.19
BOT	    1    7	 99.19  C2	  C8	 99.19
TOP	    7    1	 99.19  C8	  C2	 99.19
BOT	    1    8	 99.19  C2	  C9	 99.19
TOP	    8    1	 99.19  C9	  C2	 99.19
BOT	    1    9	 99.19  C2	 C10	 99.19
TOP	    9    1	 99.19 C10	  C2	 99.19
BOT	    1   10	 99.19  C2	 C11	 99.19
TOP	   10    1	 99.19 C11	  C2	 99.19
BOT	    1   11	 98.79  C2	 C12	 98.79
TOP	   11    1	 98.79 C12	  C2	 98.79
BOT	    2    3	 100.00  C3	  C4	 100.00
TOP	    3    2	 100.00  C4	  C3	 100.00
BOT	    2    4	 100.00  C3	  C5	 100.00
TOP	    4    2	 100.00  C5	  C3	 100.00
BOT	    2    5	 99.19  C3	  C6	 99.19
TOP	    5    2	 99.19  C6	  C3	 99.19
BOT	    2    6	 99.19  C3	  C7	 99.19
TOP	    6    2	 99.19  C7	  C3	 99.19
BOT	    2    7	 99.19  C3	  C8	 99.19
TOP	    7    2	 99.19  C8	  C3	 99.19
BOT	    2    8	 99.19  C3	  C9	 99.19
TOP	    8    2	 99.19  C9	  C3	 99.19
BOT	    2    9	 99.19  C3	 C10	 99.19
TOP	    9    2	 99.19 C10	  C3	 99.19
BOT	    2   10	 99.19  C3	 C11	 99.19
TOP	   10    2	 99.19 C11	  C3	 99.19
BOT	    2   11	 98.79  C3	 C12	 98.79
TOP	   11    2	 98.79 C12	  C3	 98.79
BOT	    3    4	 100.00  C4	  C5	 100.00
TOP	    4    3	 100.00  C5	  C4	 100.00
BOT	    3    5	 99.19  C4	  C6	 99.19
TOP	    5    3	 99.19  C6	  C4	 99.19
BOT	    3    6	 99.19  C4	  C7	 99.19
TOP	    6    3	 99.19  C7	  C4	 99.19
BOT	    3    7	 99.19  C4	  C8	 99.19
TOP	    7    3	 99.19  C8	  C4	 99.19
BOT	    3    8	 99.19  C4	  C9	 99.19
TOP	    8    3	 99.19  C9	  C4	 99.19
BOT	    3    9	 99.19  C4	 C10	 99.19
TOP	    9    3	 99.19 C10	  C4	 99.19
BOT	    3   10	 99.19  C4	 C11	 99.19
TOP	   10    3	 99.19 C11	  C4	 99.19
BOT	    3   11	 98.79  C4	 C12	 98.79
TOP	   11    3	 98.79 C12	  C4	 98.79
BOT	    4    5	 99.19  C5	  C6	 99.19
TOP	    5    4	 99.19  C6	  C5	 99.19
BOT	    4    6	 99.19  C5	  C7	 99.19
TOP	    6    4	 99.19  C7	  C5	 99.19
BOT	    4    7	 99.19  C5	  C8	 99.19
TOP	    7    4	 99.19  C8	  C5	 99.19
BOT	    4    8	 99.19  C5	  C9	 99.19
TOP	    8    4	 99.19  C9	  C5	 99.19
BOT	    4    9	 99.19  C5	 C10	 99.19
TOP	    9    4	 99.19 C10	  C5	 99.19
BOT	    4   10	 99.19  C5	 C11	 99.19
TOP	   10    4	 99.19 C11	  C5	 99.19
BOT	    4   11	 98.79  C5	 C12	 98.79
TOP	   11    4	 98.79 C12	  C5	 98.79
BOT	    5    6	 100.00  C6	  C7	 100.00
TOP	    6    5	 100.00  C7	  C6	 100.00
BOT	    5    7	 100.00  C6	  C8	 100.00
TOP	    7    5	 100.00  C8	  C6	 100.00
BOT	    5    8	 100.00  C6	  C9	 100.00
TOP	    8    5	 100.00  C9	  C6	 100.00
BOT	    5    9	 100.00  C6	 C10	 100.00
TOP	    9    5	 100.00 C10	  C6	 100.00
BOT	    5   10	 100.00  C6	 C11	 100.00
TOP	   10    5	 100.00 C11	  C6	 100.00
BOT	    5   11	 99.60  C6	 C12	 99.60
TOP	   11    5	 99.60 C12	  C6	 99.60
BOT	    6    7	 100.00  C7	  C8	 100.00
TOP	    7    6	 100.00  C8	  C7	 100.00
BOT	    6    8	 100.00  C7	  C9	 100.00
TOP	    8    6	 100.00  C9	  C7	 100.00
BOT	    6    9	 100.00  C7	 C10	 100.00
TOP	    9    6	 100.00 C10	  C7	 100.00
BOT	    6   10	 100.00  C7	 C11	 100.00
TOP	   10    6	 100.00 C11	  C7	 100.00
BOT	    6   11	 99.60  C7	 C12	 99.60
TOP	   11    6	 99.60 C12	  C7	 99.60
BOT	    7    8	 100.00  C8	  C9	 100.00
TOP	    8    7	 100.00  C9	  C8	 100.00
BOT	    7    9	 100.00  C8	 C10	 100.00
TOP	    9    7	 100.00 C10	  C8	 100.00
BOT	    7   10	 100.00  C8	 C11	 100.00
TOP	   10    7	 100.00 C11	  C8	 100.00
BOT	    7   11	 99.60  C8	 C12	 99.60
TOP	   11    7	 99.60 C12	  C8	 99.60
BOT	    8    9	 100.00  C9	 C10	 100.00
TOP	    9    8	 100.00 C10	  C9	 100.00
BOT	    8   10	 100.00  C9	 C11	 100.00
TOP	   10    8	 100.00 C11	  C9	 100.00
BOT	    8   11	 99.60  C9	 C12	 99.60
TOP	   11    8	 99.60 C12	  C9	 99.60
BOT	    9   10	 100.00 C10	 C11	 100.00
TOP	   10    9	 100.00 C11	 C10	 100.00
BOT	    9   11	 99.60 C10	 C12	 99.60
TOP	   11    9	 99.60 C12	 C10	 99.60
BOT	   10   11	 99.60 C11	 C12	 99.60
TOP	   11   10	 99.60 C12	 C11	 99.60
AVG	 0	  C1	   *	 99.45
AVG	 1	  C2	   *	 99.45
AVG	 2	  C3	   *	 99.45
AVG	 3	  C4	   *	 99.45
AVG	 4	  C5	   *	 99.45
AVG	 5	  C6	   *	 99.60
AVG	 6	  C7	   *	 99.60
AVG	 7	  C8	   *	 99.60
AVG	 8	  C9	   *	 99.60
AVG	 9	 C10	   *	 99.60
AVG	 10	 C11	   *	 99.60
AVG	 11	 C12	   *	 99.23
TOT	 TOT	   *	 99.51
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C2              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C3              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C4              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C5              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C6              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C7              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C8              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C9              ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
C10             ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C11             ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C12             ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
                ****************************************** *******

C1              GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C2              GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C3              GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C4              GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C5              GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C6              GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C7              GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C8              GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C9              GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C10             GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C11             GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C12             GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
                ***.**.***** ******** *****************.**********

C1              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C2              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C3              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C4              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C5              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C6              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C7              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C8              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C9              AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
C10             AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C11             AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C12             AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
                ********************************** **.************

C1              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C2              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C3              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C4              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C5              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C6              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C7              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C8              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C9              TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C10             TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C11             TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C12             TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
                **************************************************

C1              CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C2              CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C3              CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C4              CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C5              CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C6              CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C7              CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C8              CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C9              CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C10             CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C11             CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C12             CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
                *** **************.*******************************

C1              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C2              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C3              AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C4              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C5              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C6              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C7              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C8              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C9              AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C10             AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C11             AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C12             AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
                ************* ************************************

C1              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C2              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C3              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C4              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C5              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C6              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C7              CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C8              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C9              TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C10             TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C11             TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C12             TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
                 **********.**************************************

C1              CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C2              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C3              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C4              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C5              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C6              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C7              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C8              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C9              CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C10             CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
C11             CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C12             CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
                ****** ** *********************** ***********.****

C1              AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C2              AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C3              AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C4              AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C5              AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C6              AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C7              AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C8              AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C9              AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C10             AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C11             AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C12             AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
                **********.***** *********************************

C1              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C2              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C3              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C4              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C5              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C6              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C7              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C8              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C9              GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C10             GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C11             GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C12             GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
                **************************************************

C1              TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C2              TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C3              TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C4              TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C5              TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C6              TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C7              TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C8              TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C9              TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C10             TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C11             TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C12             TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
                *********************:****************************

C1              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C2              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C3              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C4              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C5              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C6              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C7              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C8              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C9              TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C10             TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C11             TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C12             TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
                **************************************************

C1              GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C2              GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C3              GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C4              GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C5              GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C6              GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C7              GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C8              GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C9              GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C10             GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C11             GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C12             GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
                ** ***********.*********** ***********************

C1              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C2              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C3              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C4              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C5              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C6              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
C7              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C8              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C9              GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
C10             GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C11             GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
C12             GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
                ************************************ ** ******** *

C1              ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C2              ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C3              ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C4              ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C5              ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C6              ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C7              ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C8              ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C9              ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
C10             ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C11             ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C12             ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
                **.* ******** *..*.******:******************



>C1
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C2
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C3
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C4
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C5
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C6
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C7
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C8
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C9
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C10
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C11
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C12
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 12 taxa and 744 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480082279
      Setting output file names to "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1941058404
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6225957245
      Seed = 313290748
      Swapseed = 1480082279
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 7 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 30 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2686.402976 -- -24.979900
         Chain 2 -- -2680.284916 -- -24.979900
         Chain 3 -- -2661.327749 -- -24.979900
         Chain 4 -- -2677.595942 -- -24.979900

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2654.507049 -- -24.979900
         Chain 2 -- -2720.086824 -- -24.979900
         Chain 3 -- -2666.127949 -- -24.979900
         Chain 4 -- -2664.639264 -- -24.979900


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2686.403] (-2680.285) (-2661.328) (-2677.596) * [-2654.507] (-2720.087) (-2666.128) (-2664.639) 
        500 -- (-1336.381) (-1342.735) (-1332.209) [-1335.572] * (-1349.358) (-1335.217) [-1336.498] (-1370.288) -- 0:00:00
       1000 -- (-1327.473) [-1325.586] (-1335.191) (-1337.548) * (-1320.648) (-1332.185) [-1328.513] (-1328.210) -- 0:00:00
       1500 -- (-1324.848) (-1335.562) (-1331.309) [-1324.122] * [-1311.270] (-1329.193) (-1330.506) (-1329.377) -- 0:00:00
       2000 -- [-1323.289] (-1327.299) (-1334.398) (-1324.370) * (-1317.483) (-1335.865) (-1319.051) [-1317.825] -- 0:00:00
       2500 -- (-1316.571) (-1333.300) [-1324.659] (-1320.956) * (-1322.747) (-1331.295) (-1328.199) [-1324.245] -- 0:06:39
       3000 -- (-1315.795) [-1318.807] (-1346.585) (-1328.750) * (-1312.402) [-1326.200] (-1319.965) (-1325.079) -- 0:05:32
       3500 -- [-1321.772] (-1318.742) (-1328.258) (-1329.822) * (-1332.302) [-1311.814] (-1329.976) (-1315.149) -- 0:04:44
       4000 -- (-1319.281) (-1331.570) (-1333.906) [-1319.697] * (-1326.657) (-1316.278) (-1326.268) [-1321.665] -- 0:04:09
       4500 -- (-1312.033) (-1318.870) (-1321.074) [-1326.240] * (-1311.976) [-1312.704] (-1339.654) (-1321.114) -- 0:03:41
       5000 -- (-1316.557) (-1328.542) (-1331.583) [-1326.640] * (-1319.644) [-1316.930] (-1331.743) (-1318.716) -- 0:03:19

      Average standard deviation of split frequencies: 0.117851

       5500 -- [-1317.135] (-1325.559) (-1346.090) (-1335.073) * (-1323.359) (-1309.626) (-1356.112) [-1325.915] -- 0:03:00
       6000 -- [-1312.852] (-1323.252) (-1353.111) (-1340.465) * [-1318.025] (-1312.965) (-1361.161) (-1313.824) -- 0:02:45
       6500 -- [-1304.499] (-1322.491) (-1336.926) (-1323.248) * [-1313.494] (-1320.760) (-1347.642) (-1314.311) -- 0:05:05
       7000 -- (-1314.449) [-1320.226] (-1346.185) (-1321.894) * (-1311.172) (-1313.648) (-1353.444) [-1326.449] -- 0:04:43
       7500 -- [-1312.737] (-1329.140) (-1347.419) (-1329.799) * (-1323.466) (-1318.432) (-1355.271) [-1326.799] -- 0:04:24
       8000 -- (-1340.986) (-1342.227) (-1346.106) [-1328.800] * (-1322.874) [-1313.953] (-1346.104) (-1329.866) -- 0:04:08
       8500 -- (-1348.307) (-1346.447) (-1346.086) [-1324.859] * (-1324.851) [-1315.754] (-1353.586) (-1322.676) -- 0:03:53
       9000 -- (-1346.363) (-1345.138) (-1336.893) [-1337.333] * (-1341.479) (-1321.680) (-1358.206) [-1316.368] -- 0:03:40
       9500 -- (-1339.651) (-1343.327) (-1331.236) [-1326.190] * (-1331.874) (-1309.761) (-1344.951) [-1315.190] -- 0:03:28
      10000 -- (-1349.387) [-1343.398] (-1346.328) (-1320.234) * (-1337.209) [-1326.904] (-1349.363) (-1316.825) -- 0:03:18

      Average standard deviation of split frequencies: 0.099437

      10500 -- (-1335.715) (-1349.192) [-1327.645] (-1331.979) * (-1331.611) [-1316.459] (-1347.375) (-1317.791) -- 0:03:08
      11000 -- (-1324.199) (-1348.310) (-1336.864) [-1342.505] * (-1332.972) (-1328.489) (-1352.106) [-1326.887] -- 0:04:29
      11500 -- [-1319.441] (-1343.633) (-1341.099) (-1327.683) * (-1332.341) [-1319.730] (-1351.989) (-1330.588) -- 0:04:17
      12000 -- [-1326.876] (-1336.318) (-1344.661) (-1337.189) * (-1339.146) [-1314.710] (-1346.515) (-1316.415) -- 0:04:07
      12500 -- [-1327.352] (-1331.736) (-1344.621) (-1339.451) * (-1344.858) (-1306.918) (-1342.128) [-1319.620] -- 0:03:57
      13000 -- (-1342.028) (-1348.609) (-1347.728) [-1339.737] * (-1342.396) [-1309.221] (-1345.677) (-1315.319) -- 0:03:47
      13500 -- (-1343.765) (-1336.595) (-1341.028) [-1335.915] * (-1338.858) (-1349.081) (-1354.783) [-1330.549] -- 0:03:39
      14000 -- (-1351.679) (-1337.276) (-1343.115) [-1338.730] * (-1356.975) (-1351.193) (-1358.518) [-1320.530] -- 0:03:31
      14500 -- (-1349.254) (-1340.192) (-1345.503) [-1343.358] * (-1346.984) (-1354.521) (-1348.561) [-1316.536] -- 0:03:23
      15000 -- [-1336.756] (-1345.243) (-1342.494) (-1344.593) * (-1334.097) (-1352.750) (-1339.664) [-1308.108] -- 0:04:22

      Average standard deviation of split frequencies: 0.069238

      15500 -- [-1347.898] (-1342.626) (-1329.492) (-1345.000) * (-1345.218) (-1350.929) (-1347.655) [-1329.095] -- 0:04:14
      16000 -- (-1329.092) (-1342.718) (-1338.906) [-1309.877] * (-1342.243) (-1344.372) (-1340.141) [-1313.133] -- 0:04:06
      16500 -- [-1324.504] (-1358.731) (-1342.304) (-1326.592) * (-1346.950) (-1344.426) (-1325.066) [-1311.164] -- 0:03:58
      17000 -- (-1334.564) (-1349.494) (-1340.185) [-1323.050] * (-1340.057) (-1354.933) (-1328.716) [-1325.128] -- 0:03:51
      17500 -- (-1342.620) (-1346.433) [-1334.970] (-1344.326) * (-1343.524) (-1345.641) (-1337.126) [-1314.284] -- 0:03:44
      18000 -- (-1342.399) (-1353.471) [-1337.241] (-1341.449) * (-1357.447) (-1332.940) (-1344.641) [-1316.540] -- 0:03:38
      18500 -- (-1347.321) (-1349.724) [-1317.822] (-1352.606) * (-1341.878) (-1343.622) (-1341.122) [-1320.457] -- 0:03:32
      19000 -- [-1324.096] (-1353.219) (-1337.831) (-1351.002) * (-1346.500) (-1327.878) (-1345.438) [-1322.717] -- 0:04:18
      19500 -- [-1328.159] (-1353.896) (-1336.800) (-1340.802) * [-1338.734] (-1344.666) (-1347.618) (-1345.876) -- 0:04:11
      20000 -- [-1323.884] (-1353.186) (-1344.571) (-1350.073) * (-1350.824) (-1342.703) (-1335.773) [-1321.439] -- 0:04:05

      Average standard deviation of split frequencies: 0.067344

      20500 -- [-1320.915] (-1343.668) (-1333.220) (-1336.609) * (-1342.170) (-1341.238) (-1358.861) [-1319.007] -- 0:03:58
      21000 -- (-1322.169) (-1340.246) [-1344.374] (-1341.676) * (-1341.910) (-1339.601) (-1344.898) [-1330.197] -- 0:03:53
      21500 -- [-1327.553] (-1346.139) (-1345.480) (-1339.597) * (-1355.795) (-1337.199) (-1341.643) [-1317.972] -- 0:03:47
      22000 -- [-1332.656] (-1344.048) (-1343.627) (-1347.930) * (-1341.704) (-1325.774) (-1359.551) [-1324.126] -- 0:03:42
      22500 -- [-1341.226] (-1337.859) (-1343.683) (-1348.184) * (-1337.902) [-1328.046] (-1353.464) (-1342.873) -- 0:03:37
      23000 -- [-1342.840] (-1342.303) (-1343.454) (-1346.952) * (-1340.776) (-1335.461) (-1348.578) [-1333.081] -- 0:04:14
      23500 -- [-1319.631] (-1343.941) (-1350.304) (-1337.273) * (-1343.329) (-1345.015) (-1345.004) [-1333.063] -- 0:04:09
      24000 -- (-1342.353) [-1334.770] (-1351.131) (-1343.183) * (-1346.408) (-1350.446) (-1342.140) [-1338.051] -- 0:04:04
      24500 -- [-1323.266] (-1340.904) (-1355.410) (-1337.965) * (-1340.094) [-1343.218] (-1354.033) (-1334.669) -- 0:03:58
      25000 -- [-1326.716] (-1345.243) (-1351.559) (-1338.974) * (-1340.417) (-1343.311) (-1350.334) [-1333.758] -- 0:03:54

      Average standard deviation of split frequencies: 0.069623

      25500 -- [-1328.411] (-1344.513) (-1343.718) (-1337.885) * (-1344.317) (-1341.341) (-1343.298) [-1335.994] -- 0:03:49
      26000 -- [-1336.324] (-1327.142) (-1347.101) (-1346.493) * (-1342.335) (-1342.502) (-1352.212) [-1328.383] -- 0:03:44
      26500 -- (-1331.891) [-1331.353] (-1343.415) (-1353.045) * (-1348.726) (-1343.164) (-1341.404) [-1338.848] -- 0:03:40
      27000 -- (-1343.952) [-1327.521] (-1349.546) (-1338.307) * (-1350.195) (-1351.273) (-1338.846) [-1319.949] -- 0:04:12
      27500 -- [-1329.318] (-1339.825) (-1346.602) (-1340.721) * (-1350.625) (-1344.308) (-1345.223) [-1328.217] -- 0:04:07
      28000 -- [-1331.583] (-1343.939) (-1341.271) (-1341.257) * (-1347.389) (-1362.354) (-1350.247) [-1331.938] -- 0:04:03
      28500 -- (-1333.463) (-1341.420) [-1334.781] (-1341.349) * (-1347.472) (-1355.541) (-1338.836) [-1322.893] -- 0:03:58
      29000 -- [-1329.836] (-1328.495) (-1342.823) (-1342.223) * (-1347.241) (-1341.904) (-1346.563) [-1327.965] -- 0:03:54
      29500 -- [-1322.846] (-1345.913) (-1347.542) (-1348.011) * (-1350.741) (-1338.390) (-1338.806) [-1315.960] -- 0:03:50
      30000 -- (-1319.806) (-1348.436) [-1330.220] (-1341.024) * (-1349.648) (-1359.379) (-1345.307) [-1323.436] -- 0:03:46

      Average standard deviation of split frequencies: 0.061488

      30500 -- [-1322.770] (-1338.437) (-1336.038) (-1354.241) * [-1346.184] (-1348.701) (-1346.210) (-1335.696) -- 0:03:42
      31000 -- (-1321.241) [-1332.488] (-1345.847) (-1344.291) * (-1346.672) [-1335.628] (-1338.053) (-1352.529) -- 0:04:10
      31500 -- [-1336.406] (-1342.832) (-1335.318) (-1342.412) * (-1338.670) [-1338.458] (-1351.364) (-1344.604) -- 0:04:05
      32000 -- (-1337.247) (-1336.438) [-1317.793] (-1347.408) * [-1341.652] (-1335.451) (-1342.636) (-1335.592) -- 0:04:02
      32500 -- (-1344.498) (-1336.105) [-1325.241] (-1332.836) * (-1338.442) [-1333.444] (-1347.349) (-1344.270) -- 0:03:58
      33000 -- (-1345.661) (-1335.763) [-1325.188] (-1341.749) * (-1342.327) (-1358.833) [-1342.378] (-1342.242) -- 0:03:54
      33500 -- (-1349.847) (-1343.229) [-1319.428] (-1344.295) * (-1345.943) [-1345.018] (-1347.692) (-1350.879) -- 0:03:50
      34000 -- (-1351.697) (-1337.970) [-1327.195] (-1341.657) * [-1338.474] (-1335.982) (-1340.741) (-1346.779) -- 0:03:47
      34500 -- (-1344.712) (-1352.763) [-1315.426] (-1338.310) * (-1348.763) [-1332.746] (-1333.823) (-1339.953) -- 0:03:43
      35000 -- (-1343.677) (-1350.727) (-1348.638) [-1337.799] * (-1353.346) (-1348.093) [-1318.303] (-1349.822) -- 0:04:08

      Average standard deviation of split frequencies: 0.055354

      35500 -- (-1337.244) (-1344.526) (-1341.133) [-1337.486] * [-1335.827] (-1330.725) (-1348.791) (-1347.714) -- 0:04:04
      36000 -- (-1345.084) (-1336.969) [-1345.740] (-1344.623) * (-1350.867) (-1345.167) [-1340.270] (-1345.231) -- 0:04:01
      36500 -- (-1334.701) [-1333.680] (-1346.891) (-1336.294) * (-1343.293) (-1340.745) [-1330.641] (-1343.995) -- 0:03:57
      37000 -- [-1341.392] (-1341.722) (-1345.286) (-1346.520) * (-1345.230) (-1346.317) [-1340.477] (-1340.503) -- 0:03:54
      37500 -- [-1339.922] (-1340.633) (-1344.883) (-1345.375) * (-1350.960) [-1338.525] (-1331.724) (-1344.834) -- 0:03:51
      38000 -- (-1338.640) (-1340.580) (-1334.426) [-1337.216] * (-1351.943) (-1338.173) [-1330.909] (-1345.549) -- 0:03:47
      38500 -- (-1342.295) (-1336.106) (-1339.643) [-1337.890] * (-1343.204) (-1335.282) (-1350.990) [-1342.661] -- 0:04:09
      39000 -- (-1351.745) (-1355.823) (-1335.778) [-1339.343] * (-1353.724) [-1335.251] (-1337.785) (-1349.903) -- 0:04:06
      39500 -- (-1353.940) (-1340.703) [-1338.015] (-1352.769) * (-1351.538) (-1343.350) (-1339.963) [-1333.562] -- 0:04:03
      40000 -- (-1344.337) [-1328.964] (-1331.792) (-1347.396) * (-1341.473) (-1348.518) (-1352.641) [-1331.716] -- 0:04:00

      Average standard deviation of split frequencies: 0.046368

      40500 -- (-1339.400) [-1334.558] (-1346.452) (-1343.445) * (-1346.131) (-1355.735) (-1341.106) [-1338.755] -- 0:03:56
      41000 -- (-1349.313) [-1335.073] (-1343.405) (-1350.870) * (-1348.889) [-1330.955] (-1335.560) (-1344.613) -- 0:03:53
      41500 -- [-1354.130] (-1347.433) (-1345.900) (-1345.889) * (-1354.079) (-1342.938) [-1335.644] (-1337.281) -- 0:03:50
      42000 -- (-1362.961) [-1343.950] (-1350.413) (-1358.014) * (-1345.931) [-1339.932] (-1339.576) (-1334.560) -- 0:03:48
      42500 -- (-1338.649) [-1335.645] (-1353.549) (-1354.855) * [-1345.141] (-1342.395) (-1347.450) (-1345.533) -- 0:04:07
      43000 -- (-1347.021) (-1347.878) [-1350.703] (-1354.207) * (-1330.801) (-1349.242) [-1334.291] (-1341.047) -- 0:04:04
      43500 -- [-1332.632] (-1343.620) (-1343.470) (-1349.567) * (-1343.982) (-1335.560) [-1331.212] (-1347.226) -- 0:04:01
      44000 -- [-1338.422] (-1346.212) (-1356.325) (-1344.069) * [-1327.323] (-1341.057) (-1339.329) (-1348.243) -- 0:03:59
      44500 -- [-1333.817] (-1339.237) (-1347.195) (-1342.159) * (-1339.074) (-1341.187) [-1326.096] (-1349.567) -- 0:03:56
      45000 -- [-1312.908] (-1347.070) (-1339.558) (-1353.327) * (-1339.818) [-1341.597] (-1324.413) (-1346.023) -- 0:03:53

      Average standard deviation of split frequencies: 0.040992

      45500 -- (-1333.911) (-1345.530) [-1330.411] (-1359.416) * (-1342.816) [-1329.362] (-1329.472) (-1343.779) -- 0:03:50
      46000 -- [-1327.210] (-1345.483) (-1344.121) (-1345.107) * (-1349.311) [-1328.723] (-1316.935) (-1349.096) -- 0:03:48
      46500 -- (-1333.177) (-1350.026) [-1346.381] (-1351.178) * (-1345.954) (-1336.611) [-1324.299] (-1354.568) -- 0:04:06
      47000 -- [-1331.546] (-1349.013) (-1324.980) (-1346.328) * (-1344.033) (-1337.377) [-1331.575] (-1350.370) -- 0:04:03
      47500 -- [-1320.757] (-1351.773) (-1343.097) (-1343.530) * (-1346.811) [-1329.177] (-1359.291) (-1340.450) -- 0:04:00
      48000 -- [-1320.848] (-1343.850) (-1345.690) (-1336.710) * (-1355.495) [-1333.949] (-1349.995) (-1356.616) -- 0:03:58
      48500 -- (-1342.871) (-1324.047) [-1336.022] (-1344.759) * (-1355.097) (-1338.516) [-1348.672] (-1368.501) -- 0:03:55
      49000 -- [-1338.013] (-1342.842) (-1341.947) (-1339.884) * (-1349.533) (-1339.856) [-1320.540] (-1350.014) -- 0:03:52
      49500 -- [-1334.958] (-1354.669) (-1346.399) (-1350.190) * (-1351.632) (-1339.545) [-1326.676] (-1343.091) -- 0:03:50
      50000 -- [-1332.331] (-1347.548) (-1345.172) (-1339.088) * (-1350.443) (-1346.567) [-1335.145] (-1348.328) -- 0:03:48

      Average standard deviation of split frequencies: 0.040048

      50500 -- (-1350.079) [-1338.547] (-1329.979) (-1338.364) * (-1340.066) (-1357.476) [-1338.070] (-1345.602) -- 0:04:04
      51000 -- (-1340.217) (-1350.666) [-1310.098] (-1342.182) * (-1335.430) (-1356.114) [-1319.496] (-1347.325) -- 0:04:01
      51500 -- (-1360.091) (-1351.389) [-1323.182] (-1344.865) * (-1338.792) (-1345.117) [-1332.655] (-1358.745) -- 0:03:59
      52000 -- (-1342.905) (-1347.760) [-1323.065] (-1345.642) * [-1338.779] (-1342.245) (-1328.336) (-1341.727) -- 0:03:57
      52500 -- (-1345.819) (-1340.773) [-1314.086] (-1345.375) * (-1338.334) (-1354.972) [-1340.801] (-1341.324) -- 0:03:54
      53000 -- (-1343.742) (-1358.924) (-1321.601) [-1334.880] * (-1355.811) (-1339.615) [-1341.607] (-1337.553) -- 0:03:52
      53500 -- [-1343.791] (-1344.148) (-1332.313) (-1336.083) * [-1337.294] (-1345.255) (-1339.636) (-1347.638) -- 0:03:49
      54000 -- (-1344.607) (-1348.164) [-1328.078] (-1337.432) * (-1353.801) (-1349.228) [-1340.998] (-1351.359) -- 0:03:47
      54500 -- (-1338.101) (-1347.883) [-1332.538] (-1348.634) * [-1331.083] (-1340.966) (-1331.335) (-1349.616) -- 0:04:02
      55000 -- [-1329.695] (-1347.843) (-1337.587) (-1339.308) * [-1318.095] (-1345.105) (-1345.482) (-1341.768) -- 0:04:00

      Average standard deviation of split frequencies: 0.040626

      55500 -- (-1340.581) (-1348.249) [-1327.423] (-1349.904) * [-1327.802] (-1349.331) (-1332.343) (-1349.674) -- 0:03:58
      56000 -- (-1344.998) [-1339.835] (-1340.156) (-1343.442) * [-1328.413] (-1348.614) (-1336.201) (-1340.122) -- 0:03:56
      56500 -- [-1334.764] (-1343.617) (-1344.473) (-1338.592) * (-1331.637) (-1358.376) (-1340.256) [-1345.515] -- 0:03:53
      57000 -- (-1340.019) [-1344.357] (-1339.266) (-1350.000) * [-1321.313] (-1343.025) (-1348.031) (-1349.341) -- 0:03:51
      57500 -- [-1335.395] (-1343.519) (-1339.862) (-1342.784) * (-1327.073) [-1342.228] (-1330.291) (-1355.336) -- 0:03:49
      58000 -- (-1345.171) [-1333.738] (-1327.097) (-1349.406) * [-1337.227] (-1346.230) (-1343.068) (-1346.083) -- 0:03:47
      58500 -- [-1324.238] (-1335.027) (-1340.015) (-1329.011) * (-1328.109) [-1342.595] (-1347.770) (-1349.352) -- 0:04:01
      59000 -- (-1352.394) (-1354.462) [-1336.254] (-1348.236) * [-1324.635] (-1344.990) (-1339.464) (-1348.962) -- 0:03:59
      59500 -- [-1327.885] (-1351.724) (-1337.802) (-1342.211) * (-1352.141) (-1353.806) [-1350.700] (-1346.831) -- 0:03:57
      60000 -- [-1346.949] (-1333.092) (-1329.115) (-1342.196) * [-1329.903] (-1340.096) (-1335.808) (-1354.177) -- 0:03:55

      Average standard deviation of split frequencies: 0.038514

      60500 -- (-1336.331) (-1331.224) [-1332.760] (-1351.002) * (-1345.675) (-1338.528) [-1339.257] (-1354.137) -- 0:03:52
      61000 -- (-1338.358) (-1350.042) (-1333.772) [-1339.642] * (-1352.768) [-1346.629] (-1333.891) (-1346.486) -- 0:03:50
      61500 -- (-1337.921) (-1340.697) [-1323.371] (-1342.429) * [-1345.688] (-1338.421) (-1339.915) (-1345.526) -- 0:03:48
      62000 -- (-1342.778) [-1335.373] (-1343.242) (-1347.975) * [-1336.426] (-1345.314) (-1339.638) (-1334.996) -- 0:04:02
      62500 -- (-1345.801) [-1342.780] (-1334.523) (-1348.613) * (-1335.339) (-1336.856) (-1345.677) [-1340.991] -- 0:04:00
      63000 -- (-1345.786) (-1347.098) [-1342.562] (-1346.118) * (-1353.626) (-1349.022) [-1335.728] (-1353.403) -- 0:03:57
      63500 -- (-1340.778) (-1341.668) (-1343.320) [-1348.290] * [-1336.065] (-1338.147) (-1338.142) (-1346.565) -- 0:03:55
      64000 -- (-1341.427) (-1335.417) (-1349.520) [-1330.372] * (-1338.483) (-1362.413) (-1343.678) [-1341.191] -- 0:03:54
      64500 -- (-1346.600) [-1329.093] (-1343.834) (-1341.350) * (-1355.063) (-1350.545) [-1330.863] (-1346.764) -- 0:03:52
      65000 -- (-1347.711) (-1333.648) [-1321.781] (-1353.979) * (-1341.116) (-1357.930) (-1341.478) [-1340.157] -- 0:03:50

      Average standard deviation of split frequencies: 0.036334

      65500 -- (-1362.667) (-1336.972) [-1327.493] (-1340.193) * (-1348.405) [-1330.179] (-1338.932) (-1348.384) -- 0:03:48
      66000 -- [-1335.490] (-1335.918) (-1338.238) (-1345.166) * (-1345.290) (-1342.091) (-1349.964) [-1336.680] -- 0:04:00
      66500 -- (-1341.352) (-1340.630) (-1344.318) [-1335.401] * (-1353.275) (-1347.546) (-1335.113) [-1334.638] -- 0:03:58
      67000 -- (-1338.935) [-1330.498] (-1335.714) (-1340.880) * (-1348.214) (-1353.906) (-1335.513) [-1343.719] -- 0:03:56
      67500 -- (-1350.704) (-1336.488) (-1342.014) [-1336.563] * (-1340.873) [-1346.213] (-1341.211) (-1353.413) -- 0:03:54
      68000 -- (-1352.122) (-1333.670) [-1332.724] (-1349.337) * (-1347.946) (-1345.949) (-1337.202) [-1328.779] -- 0:03:53
      68500 -- (-1343.911) [-1333.891] (-1339.020) (-1352.124) * (-1349.444) [-1336.349] (-1346.495) (-1350.592) -- 0:03:51
      69000 -- (-1340.300) (-1342.780) [-1341.580] (-1353.486) * (-1343.051) (-1343.209) [-1348.078] (-1345.114) -- 0:03:49
      69500 -- (-1339.969) (-1344.457) [-1339.566] (-1345.868) * (-1350.015) (-1352.483) [-1337.101] (-1348.763) -- 0:03:47
      70000 -- [-1336.991] (-1341.435) (-1347.844) (-1352.996) * (-1344.424) (-1337.101) [-1344.804] (-1344.636) -- 0:03:59

      Average standard deviation of split frequencies: 0.031130

      70500 -- (-1335.828) [-1332.137] (-1342.229) (-1339.229) * (-1350.074) (-1338.505) (-1348.502) [-1338.124] -- 0:03:57
      71000 -- (-1349.602) (-1338.744) (-1342.271) [-1325.197] * (-1343.190) (-1337.233) (-1346.994) [-1343.193] -- 0:03:55
      71500 -- [-1338.764] (-1345.303) (-1345.409) (-1343.098) * (-1339.874) [-1328.405] (-1346.346) (-1340.409) -- 0:03:53
      72000 -- [-1314.476] (-1353.309) (-1338.212) (-1341.121) * (-1341.428) [-1338.038] (-1336.718) (-1351.207) -- 0:03:52
      72500 -- [-1324.194] (-1340.112) (-1340.754) (-1345.689) * (-1340.141) (-1344.595) [-1343.630] (-1343.828) -- 0:03:50
      73000 -- [-1318.082] (-1342.273) (-1350.872) (-1348.266) * (-1354.113) (-1341.199) [-1331.451] (-1339.688) -- 0:03:48
      73500 -- [-1315.296] (-1344.608) (-1353.915) (-1343.494) * (-1346.355) (-1337.663) [-1341.393] (-1326.717) -- 0:03:46
      74000 -- [-1314.622] (-1356.233) (-1340.867) (-1352.507) * (-1351.188) (-1331.232) (-1345.362) [-1317.482] -- 0:03:57
      74500 -- [-1325.107] (-1340.704) (-1345.135) (-1347.237) * [-1345.515] (-1332.151) (-1347.584) (-1333.318) -- 0:03:56
      75000 -- [-1327.660] (-1347.777) (-1337.925) (-1353.459) * (-1346.141) [-1317.548] (-1349.282) (-1331.513) -- 0:03:54

      Average standard deviation of split frequencies: 0.028194

      75500 -- (-1337.978) (-1341.723) [-1342.922] (-1346.381) * (-1311.471) [-1324.813] (-1342.013) (-1344.641) -- 0:03:52
      76000 -- [-1330.053] (-1341.960) (-1345.588) (-1351.849) * [-1324.861] (-1332.528) (-1344.993) (-1349.460) -- 0:03:51
      76500 -- [-1314.986] (-1342.235) (-1339.084) (-1341.850) * [-1336.433] (-1336.708) (-1340.656) (-1346.984) -- 0:03:49
      77000 -- (-1332.007) [-1340.575] (-1344.348) (-1345.551) * (-1327.131) (-1349.202) (-1338.534) [-1343.141] -- 0:03:47
      77500 -- (-1345.493) (-1342.754) [-1341.443] (-1347.027) * [-1339.150] (-1353.555) (-1339.557) (-1352.951) -- 0:03:58
      78000 -- [-1343.606] (-1342.586) (-1338.810) (-1347.652) * (-1338.624) (-1350.739) (-1343.914) [-1333.328] -- 0:03:56
      78500 -- (-1343.978) (-1352.929) [-1341.190] (-1354.997) * (-1336.147) (-1346.681) [-1339.454] (-1347.311) -- 0:03:54
      79000 -- (-1345.810) [-1332.225] (-1333.251) (-1352.195) * (-1334.305) [-1327.014] (-1347.224) (-1344.819) -- 0:03:53
      79500 -- (-1336.961) (-1349.358) (-1346.373) [-1351.041] * (-1337.036) [-1325.063] (-1350.579) (-1340.497) -- 0:03:51
      80000 -- (-1343.766) [-1334.377] (-1341.311) (-1360.266) * (-1342.656) [-1336.106] (-1352.877) (-1348.510) -- 0:03:50

      Average standard deviation of split frequencies: 0.027094

      80500 -- (-1344.160) (-1339.033) [-1338.172] (-1345.050) * (-1339.980) (-1331.980) (-1351.202) [-1342.890] -- 0:03:48
      81000 -- (-1348.988) [-1336.114] (-1343.041) (-1339.990) * [-1336.529] (-1339.563) (-1353.386) (-1345.563) -- 0:03:46
      81500 -- (-1346.401) (-1355.128) (-1334.369) [-1336.865] * (-1332.232) [-1333.307] (-1338.436) (-1346.652) -- 0:03:56
      82000 -- (-1341.788) (-1343.537) [-1321.941] (-1344.316) * [-1331.874] (-1339.543) (-1349.342) (-1338.471) -- 0:03:55
      82500 -- (-1339.166) [-1346.566] (-1335.611) (-1347.849) * [-1332.363] (-1343.376) (-1336.211) (-1340.042) -- 0:03:53
      83000 -- (-1344.946) [-1338.366] (-1339.644) (-1350.499) * [-1324.079] (-1350.561) (-1357.428) (-1345.474) -- 0:03:52
      83500 -- [-1328.284] (-1344.395) (-1344.299) (-1344.025) * [-1320.678] (-1356.160) (-1347.956) (-1348.250) -- 0:03:50
      84000 -- (-1344.551) [-1330.184] (-1328.738) (-1348.500) * [-1321.019] (-1354.764) (-1342.042) (-1344.528) -- 0:03:49
      84500 -- (-1345.852) [-1344.210] (-1339.449) (-1344.464) * [-1322.962] (-1334.559) (-1347.514) (-1341.354) -- 0:03:47
      85000 -- (-1343.140) (-1355.594) (-1347.086) [-1344.179] * [-1317.697] (-1345.572) (-1346.970) (-1340.448) -- 0:03:46

      Average standard deviation of split frequencies: 0.029691

      85500 -- [-1328.427] (-1355.304) (-1339.197) (-1344.022) * (-1345.125) [-1337.610] (-1341.714) (-1341.222) -- 0:03:55
      86000 -- (-1338.747) [-1349.046] (-1344.089) (-1342.312) * (-1331.073) [-1334.497] (-1341.712) (-1339.230) -- 0:03:53
      86500 -- (-1332.728) [-1339.521] (-1345.457) (-1341.507) * (-1335.770) [-1334.557] (-1347.649) (-1341.185) -- 0:03:52
      87000 -- [-1314.618] (-1344.247) (-1345.523) (-1351.368) * (-1331.656) [-1321.476] (-1336.453) (-1350.784) -- 0:03:50
      87500 -- (-1340.566) [-1338.794] (-1341.304) (-1345.894) * (-1352.137) [-1330.987] (-1344.798) (-1343.553) -- 0:03:49
      88000 -- [-1323.964] (-1337.956) (-1345.721) (-1340.246) * (-1332.568) [-1332.410] (-1339.824) (-1350.408) -- 0:03:48
      88500 -- [-1336.666] (-1335.939) (-1345.058) (-1347.167) * [-1331.754] (-1342.699) (-1342.259) (-1343.708) -- 0:03:46
      89000 -- (-1343.859) [-1338.783] (-1350.710) (-1351.133) * [-1316.634] (-1351.091) (-1354.802) (-1354.748) -- 0:03:45
      89500 -- [-1329.561] (-1342.861) (-1345.627) (-1350.589) * (-1325.392) [-1345.030] (-1348.604) (-1344.442) -- 0:03:53
      90000 -- [-1323.658] (-1339.799) (-1348.223) (-1343.868) * (-1350.261) (-1351.593) (-1343.110) [-1335.933] -- 0:03:52

      Average standard deviation of split frequencies: 0.029840

      90500 -- (-1335.275) [-1319.483] (-1349.944) (-1352.626) * [-1327.549] (-1343.908) (-1336.897) (-1339.805) -- 0:03:51
      91000 -- (-1331.012) [-1324.916] (-1349.894) (-1349.799) * (-1337.280) (-1344.554) (-1337.332) [-1330.307] -- 0:03:49
      91500 -- [-1330.523] (-1339.850) (-1350.412) (-1340.738) * (-1345.678) (-1345.884) (-1345.542) [-1313.352] -- 0:03:48
      92000 -- [-1334.333] (-1338.005) (-1347.950) (-1342.815) * (-1332.766) (-1341.653) (-1344.272) [-1314.546] -- 0:03:47
      92500 -- [-1334.269] (-1333.746) (-1351.921) (-1335.873) * (-1347.700) (-1345.136) (-1335.929) [-1313.909] -- 0:03:45
      93000 -- [-1322.846] (-1345.061) (-1350.647) (-1344.349) * (-1354.523) [-1342.943] (-1345.988) (-1332.596) -- 0:03:54
      93500 -- (-1340.150) (-1347.007) (-1352.627) [-1341.609] * (-1340.289) (-1346.614) (-1346.285) [-1319.053] -- 0:03:52
      94000 -- [-1330.852] (-1344.400) (-1351.552) (-1339.051) * (-1321.200) (-1348.245) (-1345.434) [-1328.499] -- 0:03:51
      94500 -- [-1323.429] (-1341.788) (-1347.636) (-1341.665) * (-1331.159) (-1343.282) (-1336.659) [-1316.547] -- 0:03:49
      95000 -- [-1331.453] (-1344.769) (-1346.906) (-1344.183) * (-1346.089) (-1349.233) (-1344.933) [-1319.767] -- 0:03:48

      Average standard deviation of split frequencies: 0.027826

      95500 -- [-1346.152] (-1346.509) (-1343.999) (-1337.539) * (-1351.859) (-1345.357) [-1340.834] (-1327.547) -- 0:03:47
      96000 -- [-1322.235] (-1343.488) (-1347.988) (-1342.483) * (-1342.026) (-1346.109) (-1333.193) [-1329.439] -- 0:03:46
      96500 -- (-1338.331) [-1342.607] (-1356.761) (-1342.663) * (-1330.494) (-1350.460) (-1343.993) [-1320.109] -- 0:03:44
      97000 -- [-1323.883] (-1344.003) (-1342.684) (-1337.860) * [-1343.245] (-1339.019) (-1342.600) (-1343.452) -- 0:03:52
      97500 -- [-1336.193] (-1345.772) (-1341.222) (-1339.869) * (-1347.995) (-1339.382) (-1348.714) [-1336.561] -- 0:03:51
      98000 -- [-1330.488] (-1360.687) (-1344.157) (-1343.733) * (-1339.951) (-1343.772) (-1345.096) [-1328.476] -- 0:03:50
      98500 -- [-1329.258] (-1342.205) (-1341.463) (-1341.980) * [-1329.648] (-1331.070) (-1341.326) (-1351.781) -- 0:03:48
      99000 -- (-1341.021) [-1339.529] (-1339.398) (-1349.023) * [-1336.486] (-1338.645) (-1335.805) (-1363.244) -- 0:03:47
      99500 -- (-1335.753) [-1340.127] (-1343.946) (-1344.211) * (-1336.543) (-1335.036) [-1333.549] (-1346.694) -- 0:03:46
      100000 -- [-1333.107] (-1339.778) (-1342.412) (-1339.392) * [-1336.585] (-1337.759) (-1344.685) (-1338.300) -- 0:03:45

      Average standard deviation of split frequencies: 0.029658

      100500 -- [-1334.140] (-1339.539) (-1341.839) (-1346.408) * (-1340.179) [-1334.703] (-1347.318) (-1340.878) -- 0:03:43
      101000 -- (-1333.288) [-1338.534] (-1342.858) (-1353.598) * (-1333.520) (-1340.681) [-1333.128] (-1345.763) -- 0:03:51
      101500 -- (-1341.868) [-1338.570] (-1347.076) (-1356.909) * (-1334.539) [-1335.394] (-1341.341) (-1340.255) -- 0:03:50
      102000 -- (-1344.804) [-1337.173] (-1347.294) (-1341.530) * (-1336.171) (-1339.030) (-1351.780) [-1334.036] -- 0:03:48
      102500 -- (-1340.206) [-1311.716] (-1354.375) (-1346.207) * (-1348.323) [-1334.307] (-1341.617) (-1348.097) -- 0:03:47
      103000 -- (-1341.044) (-1345.993) (-1345.423) [-1338.849] * (-1334.544) [-1340.110] (-1344.546) (-1345.813) -- 0:03:46
      103500 -- [-1338.069] (-1349.282) (-1342.622) (-1346.466) * (-1342.901) (-1348.271) (-1344.239) [-1335.830] -- 0:03:45
      104000 -- (-1343.520) (-1341.626) (-1343.770) [-1340.344] * (-1350.386) (-1349.786) [-1340.804] (-1342.923) -- 0:03:44
      104500 -- (-1361.853) (-1345.026) (-1349.159) [-1332.857] * (-1340.651) (-1356.831) (-1342.824) [-1338.005] -- 0:03:51
      105000 -- [-1319.338] (-1338.705) (-1353.631) (-1345.968) * (-1344.344) (-1340.038) [-1337.087] (-1336.361) -- 0:03:50

      Average standard deviation of split frequencies: 0.029513

      105500 -- [-1337.902] (-1344.833) (-1344.111) (-1346.213) * (-1347.057) (-1344.390) (-1340.713) [-1335.806] -- 0:03:48
      106000 -- [-1324.965] (-1338.540) (-1352.638) (-1340.342) * [-1324.399] (-1349.219) (-1328.288) (-1346.539) -- 0:03:47
      106500 -- (-1343.974) (-1348.893) (-1348.243) [-1345.104] * [-1332.768] (-1333.194) (-1339.695) (-1343.753) -- 0:03:46
      107000 -- [-1327.678] (-1351.026) (-1348.151) (-1342.163) * (-1346.583) (-1318.974) [-1332.788] (-1357.119) -- 0:03:45
      107500 -- (-1325.311) (-1339.021) (-1352.916) [-1346.122] * [-1336.836] (-1340.290) (-1345.014) (-1344.568) -- 0:03:44
      108000 -- [-1322.463] (-1342.353) (-1353.732) (-1333.068) * (-1330.541) (-1332.580) [-1335.053] (-1346.365) -- 0:03:43
      108500 -- [-1314.415] (-1333.721) (-1336.163) (-1319.160) * [-1343.776] (-1338.865) (-1332.786) (-1353.102) -- 0:03:50
      109000 -- (-1338.877) [-1332.809] (-1343.938) (-1337.725) * [-1329.254] (-1347.162) (-1334.246) (-1334.563) -- 0:03:48
      109500 -- (-1347.024) (-1341.102) (-1360.352) [-1321.683] * (-1342.282) (-1347.019) (-1343.763) [-1326.880] -- 0:03:47
      110000 -- [-1341.023] (-1341.365) (-1338.847) (-1345.381) * (-1347.145) (-1348.891) (-1336.199) [-1327.265] -- 0:03:46

      Average standard deviation of split frequencies: 0.029624

      110500 -- (-1331.026) (-1340.615) (-1356.695) [-1332.184] * (-1350.729) [-1335.185] (-1340.097) (-1347.603) -- 0:03:45
      111000 -- [-1328.474] (-1331.337) (-1348.374) (-1340.527) * (-1349.329) [-1341.255] (-1340.181) (-1344.310) -- 0:03:44
      111500 -- (-1336.589) [-1337.127] (-1347.986) (-1334.523) * (-1346.060) (-1346.920) (-1348.415) [-1329.863] -- 0:03:43
      112000 -- [-1340.770] (-1339.061) (-1346.619) (-1344.767) * (-1344.524) (-1344.213) (-1349.421) [-1337.286] -- 0:03:42
      112500 -- [-1327.098] (-1341.042) (-1349.521) (-1346.489) * (-1338.015) (-1347.365) [-1335.987] (-1347.396) -- 0:03:48
      113000 -- (-1327.197) [-1337.518] (-1345.323) (-1348.634) * (-1345.953) (-1349.444) [-1343.622] (-1338.464) -- 0:03:47
      113500 -- [-1335.515] (-1351.564) (-1345.506) (-1343.851) * (-1344.066) [-1334.685] (-1348.197) (-1356.470) -- 0:03:46
      114000 -- [-1325.163] (-1349.953) (-1347.166) (-1340.602) * (-1354.266) (-1337.273) [-1339.236] (-1338.639) -- 0:03:45
      114500 -- [-1326.690] (-1338.665) (-1343.974) (-1350.970) * (-1344.357) (-1339.365) (-1340.082) [-1337.223] -- 0:03:44
      115000 -- (-1358.907) (-1323.468) (-1350.084) [-1344.168] * (-1349.548) (-1342.642) (-1341.038) [-1333.524] -- 0:03:43

      Average standard deviation of split frequencies: 0.033091

      115500 -- (-1327.771) (-1344.097) (-1342.855) [-1328.903] * (-1341.638) (-1337.546) [-1341.673] (-1356.952) -- 0:03:42
      116000 -- [-1330.263] (-1349.490) (-1340.949) (-1347.027) * (-1338.988) [-1339.599] (-1345.713) (-1343.369) -- 0:03:48
      116500 -- (-1355.294) (-1342.960) (-1344.992) [-1330.367] * [-1338.860] (-1336.285) (-1341.014) (-1346.838) -- 0:03:47
      117000 -- [-1327.657] (-1344.896) (-1345.096) (-1336.948) * (-1330.639) [-1334.565] (-1347.179) (-1347.588) -- 0:03:46
      117500 -- (-1333.323) (-1347.499) (-1342.623) [-1331.254] * (-1348.702) (-1346.060) [-1336.027] (-1354.588) -- 0:03:45
      118000 -- (-1336.851) (-1347.963) (-1353.771) [-1335.918] * [-1333.940] (-1338.743) (-1345.476) (-1352.698) -- 0:03:44
      118500 -- [-1318.770] (-1350.525) (-1351.910) (-1333.510) * (-1347.789) [-1341.984] (-1353.251) (-1338.664) -- 0:03:43
      119000 -- [-1327.133] (-1346.986) (-1338.756) (-1354.609) * [-1340.912] (-1341.627) (-1346.974) (-1332.210) -- 0:03:42
      119500 -- [-1320.748] (-1331.706) (-1340.639) (-1351.904) * (-1335.884) (-1345.292) (-1339.942) [-1331.326] -- 0:03:41
      120000 -- [-1326.626] (-1349.445) (-1327.688) (-1338.447) * (-1333.527) (-1340.613) (-1345.526) [-1344.474] -- 0:03:47

      Average standard deviation of split frequencies: 0.034602

      120500 -- [-1325.044] (-1341.519) (-1340.329) (-1346.021) * [-1328.583] (-1348.028) (-1351.492) (-1351.933) -- 0:03:46
      121000 -- [-1319.965] (-1338.427) (-1352.112) (-1339.368) * [-1334.019] (-1352.763) (-1335.917) (-1348.221) -- 0:03:45
      121500 -- [-1320.969] (-1361.199) (-1357.496) (-1345.519) * (-1352.411) (-1348.526) (-1344.123) [-1328.603] -- 0:03:44
      122000 -- [-1315.265] (-1352.763) (-1347.349) (-1333.116) * (-1340.359) (-1347.177) (-1335.348) [-1331.933] -- 0:03:43
      122500 -- [-1330.502] (-1345.723) (-1340.191) (-1345.294) * [-1344.040] (-1331.192) (-1345.705) (-1329.746) -- 0:03:42
      123000 -- [-1319.137] (-1345.083) (-1352.519) (-1339.925) * (-1347.917) (-1351.500) (-1361.383) [-1341.956] -- 0:03:41
      123500 -- (-1334.002) (-1345.946) (-1345.166) [-1334.099] * [-1328.199] (-1350.476) (-1350.965) (-1342.995) -- 0:03:40
      124000 -- (-1337.182) (-1343.420) (-1355.037) [-1334.479] * (-1330.014) [-1347.080] (-1338.280) (-1350.311) -- 0:03:46
      124500 -- (-1344.542) [-1313.220] (-1345.843) (-1344.267) * (-1337.006) [-1328.346] (-1346.782) (-1342.644) -- 0:03:45
      125000 -- (-1346.713) [-1328.148] (-1349.540) (-1349.015) * [-1337.106] (-1335.648) (-1349.119) (-1356.662) -- 0:03:44

      Average standard deviation of split frequencies: 0.033502

      125500 -- (-1335.352) [-1331.025] (-1342.783) (-1345.110) * (-1338.052) [-1315.590] (-1340.595) (-1340.082) -- 0:03:42
      126000 -- (-1337.698) [-1321.499] (-1348.761) (-1348.681) * (-1348.384) [-1328.831] (-1352.679) (-1345.498) -- 0:03:41
      126500 -- (-1342.752) [-1342.180] (-1350.536) (-1344.734) * (-1333.944) (-1335.284) [-1346.563] (-1350.243) -- 0:03:40
      127000 -- (-1344.351) [-1322.506] (-1355.468) (-1344.318) * (-1348.488) (-1339.297) [-1332.777] (-1339.069) -- 0:03:39
      127500 -- (-1334.684) [-1324.504] (-1347.903) (-1347.170) * (-1341.279) [-1327.105] (-1337.291) (-1345.443) -- 0:03:45
      128000 -- (-1337.971) [-1336.218] (-1344.092) (-1349.836) * (-1333.894) [-1336.564] (-1346.776) (-1353.823) -- 0:03:44
      128500 -- (-1340.680) (-1345.123) [-1342.667] (-1344.291) * [-1316.522] (-1346.653) (-1346.595) (-1356.225) -- 0:03:43
      129000 -- [-1339.533] (-1345.212) (-1341.426) (-1337.204) * [-1332.075] (-1347.798) (-1342.258) (-1344.034) -- 0:03:42
      129500 -- (-1347.225) [-1338.366] (-1343.988) (-1342.301) * [-1325.482] (-1348.838) (-1338.789) (-1337.497) -- 0:03:41
      130000 -- [-1328.260] (-1347.192) (-1348.325) (-1346.508) * [-1327.937] (-1339.101) (-1344.175) (-1337.131) -- 0:03:47

      Average standard deviation of split frequencies: 0.031438

      130500 -- (-1343.523) [-1331.053] (-1341.436) (-1339.095) * [-1328.148] (-1354.659) (-1340.308) (-1349.559) -- 0:03:46
      131000 -- (-1345.057) [-1317.865] (-1346.609) (-1343.539) * [-1323.897] (-1342.822) (-1346.638) (-1338.594) -- 0:03:45
      131500 -- (-1341.346) [-1322.626] (-1335.573) (-1339.965) * [-1320.463] (-1350.287) (-1344.328) (-1352.096) -- 0:03:44
      132000 -- (-1342.827) [-1305.401] (-1343.169) (-1343.353) * [-1334.395] (-1349.533) (-1345.057) (-1345.694) -- 0:03:43
      132500 -- (-1344.455) [-1324.551] (-1338.929) (-1343.540) * (-1345.071) [-1339.364] (-1347.278) (-1345.050) -- 0:03:42
      133000 -- (-1343.858) [-1335.100] (-1343.670) (-1343.104) * [-1334.008] (-1336.219) (-1358.989) (-1351.423) -- 0:03:41
      133500 -- [-1330.706] (-1339.437) (-1341.583) (-1342.265) * [-1331.130] (-1350.324) (-1349.020) (-1336.146) -- 0:03:40
      134000 -- [-1316.063] (-1343.496) (-1349.800) (-1348.709) * (-1329.878) (-1345.251) [-1340.325] (-1347.268) -- 0:03:46
      134500 -- [-1342.440] (-1338.364) (-1347.061) (-1342.075) * [-1338.167] (-1341.674) (-1346.583) (-1350.074) -- 0:03:45
      135000 -- [-1314.538] (-1349.311) (-1352.428) (-1346.229) * [-1338.270] (-1336.075) (-1343.014) (-1345.275) -- 0:03:44

      Average standard deviation of split frequencies: 0.029710

      135500 -- [-1322.957] (-1346.485) (-1342.945) (-1350.586) * (-1336.949) (-1339.169) (-1344.807) [-1333.543] -- 0:03:43
      136000 -- [-1329.769] (-1335.111) (-1353.260) (-1356.069) * [-1327.783] (-1351.468) (-1343.146) (-1337.236) -- 0:03:42
      136500 -- [-1305.733] (-1333.723) (-1340.017) (-1350.827) * (-1345.161) [-1339.603] (-1343.149) (-1353.162) -- 0:03:41
      137000 -- [-1311.813] (-1347.535) (-1340.814) (-1347.689) * (-1334.077) [-1328.657] (-1348.005) (-1358.420) -- 0:03:40
      137500 -- [-1326.849] (-1338.083) (-1344.849) (-1349.170) * (-1340.133) [-1330.042] (-1340.642) (-1343.402) -- 0:03:39
      138000 -- [-1329.198] (-1344.089) (-1350.691) (-1348.223) * (-1336.672) [-1321.442] (-1341.751) (-1354.587) -- 0:03:44
      138500 -- [-1337.259] (-1349.812) (-1345.514) (-1350.945) * (-1337.972) [-1340.689] (-1351.671) (-1351.271) -- 0:03:43
      139000 -- [-1318.040] (-1342.060) (-1343.319) (-1338.826) * [-1326.542] (-1342.443) (-1341.270) (-1334.283) -- 0:03:42
      139500 -- (-1337.202) (-1337.237) (-1344.618) [-1335.332] * [-1315.697] (-1344.955) (-1343.560) (-1355.998) -- 0:03:42
      140000 -- [-1324.918] (-1339.663) (-1343.107) (-1342.979) * [-1317.869] (-1340.489) (-1333.982) (-1345.637) -- 0:03:41

      Average standard deviation of split frequencies: 0.030001

      140500 -- (-1349.937) (-1352.426) [-1336.947] (-1344.518) * [-1336.774] (-1338.115) (-1353.395) (-1341.818) -- 0:03:40
      141000 -- (-1351.915) [-1322.440] (-1343.769) (-1343.720) * (-1344.555) (-1334.137) (-1340.847) [-1340.800] -- 0:03:39
      141500 -- (-1353.050) [-1330.150] (-1333.233) (-1348.514) * [-1346.644] (-1338.199) (-1341.709) (-1346.676) -- 0:03:38
      142000 -- (-1354.206) [-1312.982] (-1345.284) (-1348.797) * (-1335.421) (-1349.904) [-1343.695] (-1340.316) -- 0:03:43
      142500 -- (-1356.935) (-1321.912) [-1336.267] (-1347.750) * (-1347.898) (-1332.635) (-1339.066) [-1330.776] -- 0:03:42
      143000 -- [-1333.452] (-1337.225) (-1340.740) (-1360.471) * (-1338.998) (-1351.343) (-1347.702) [-1319.015] -- 0:03:41
      143500 -- [-1331.377] (-1335.903) (-1346.258) (-1347.032) * (-1352.028) (-1342.986) (-1347.873) [-1337.557] -- 0:03:40
      144000 -- (-1344.782) [-1344.598] (-1344.568) (-1345.123) * (-1355.565) [-1336.737] (-1342.011) (-1344.078) -- 0:03:39
      144500 -- (-1357.196) [-1327.580] (-1338.013) (-1357.041) * (-1356.049) [-1324.463] (-1348.404) (-1345.593) -- 0:03:39
      145000 -- (-1346.802) [-1341.368] (-1330.127) (-1353.034) * (-1342.579) (-1328.620) (-1350.719) [-1336.121] -- 0:03:38

      Average standard deviation of split frequencies: 0.032118

      145500 -- (-1348.601) (-1345.168) [-1323.477] (-1348.356) * (-1341.237) (-1341.396) (-1335.952) [-1324.211] -- 0:03:37
      146000 -- (-1368.077) (-1355.182) [-1329.035] (-1349.607) * (-1350.076) (-1344.016) (-1350.578) [-1332.415] -- 0:03:42
      146500 -- (-1357.195) [-1349.659] (-1340.834) (-1353.142) * [-1325.299] (-1339.810) (-1342.613) (-1338.665) -- 0:03:41
      147000 -- (-1354.621) (-1342.041) (-1312.101) [-1339.101] * (-1338.620) [-1335.475] (-1352.924) (-1336.934) -- 0:03:40
      147500 -- (-1343.759) (-1352.598) [-1312.028] (-1341.919) * (-1339.202) (-1327.090) (-1357.609) [-1335.424] -- 0:03:39
      148000 -- (-1344.540) (-1341.130) [-1331.770] (-1342.571) * [-1344.720] (-1334.434) (-1342.202) (-1336.203) -- 0:03:38
      148500 -- (-1350.297) [-1330.672] (-1335.166) (-1334.524) * (-1349.644) [-1330.860] (-1347.243) (-1353.032) -- 0:03:37
      149000 -- (-1349.200) [-1317.865] (-1355.429) (-1339.642) * (-1358.109) (-1339.748) (-1347.069) [-1336.400] -- 0:03:37
      149500 -- (-1342.214) [-1338.439] (-1354.263) (-1342.389) * (-1338.529) (-1337.255) [-1336.951] (-1350.916) -- 0:03:41
      150000 -- [-1346.302] (-1347.720) (-1340.089) (-1342.306) * [-1337.969] (-1336.075) (-1337.412) (-1352.314) -- 0:03:40

      Average standard deviation of split frequencies: 0.033593

      150500 -- (-1341.407) (-1350.467) [-1328.098] (-1352.400) * (-1339.524) (-1340.897) [-1339.176] (-1345.126) -- 0:03:40
      151000 -- [-1327.991] (-1357.425) (-1324.142) (-1341.767) * [-1340.058] (-1338.153) (-1346.484) (-1341.368) -- 0:03:39
      151500 -- [-1344.373] (-1340.972) (-1341.748) (-1339.365) * [-1335.783] (-1337.610) (-1351.608) (-1345.558) -- 0:03:38
      152000 -- [-1351.413] (-1337.212) (-1354.111) (-1344.862) * (-1344.093) [-1327.102] (-1350.335) (-1341.879) -- 0:03:37
      152500 -- (-1339.331) [-1349.651] (-1349.063) (-1358.197) * (-1347.132) (-1353.294) [-1335.450] (-1336.892) -- 0:03:36
      153000 -- (-1350.825) (-1345.209) [-1340.018] (-1351.716) * (-1341.135) (-1333.064) [-1339.930] (-1343.652) -- 0:03:35
      153500 -- (-1352.687) [-1328.021] (-1350.344) (-1346.491) * (-1339.074) [-1327.571] (-1344.364) (-1340.076) -- 0:03:40
      154000 -- (-1339.143) [-1332.777] (-1342.485) (-1354.713) * [-1332.793] (-1327.033) (-1343.769) (-1344.164) -- 0:03:39
      154500 -- (-1350.663) [-1335.835] (-1346.767) (-1348.587) * [-1319.694] (-1346.417) (-1345.623) (-1331.604) -- 0:03:38
      155000 -- (-1345.382) [-1340.603] (-1350.338) (-1344.304) * (-1350.452) (-1344.547) (-1346.033) [-1336.901] -- 0:03:38

      Average standard deviation of split frequencies: 0.032127

      155500 -- [-1347.188] (-1344.577) (-1345.145) (-1341.567) * (-1341.631) (-1337.730) (-1341.825) [-1336.742] -- 0:03:37
      156000 -- (-1340.388) (-1344.426) (-1353.316) [-1340.700] * (-1340.287) [-1332.371] (-1344.747) (-1339.652) -- 0:03:36
      156500 -- [-1330.774] (-1351.232) (-1331.240) (-1348.347) * (-1347.659) [-1319.894] (-1331.235) (-1342.832) -- 0:03:35
      157000 -- [-1330.562] (-1351.129) (-1337.243) (-1347.395) * (-1344.436) [-1335.855] (-1344.124) (-1328.048) -- 0:03:34
      157500 -- (-1333.080) (-1340.162) [-1322.927] (-1351.565) * [-1330.433] (-1343.131) (-1348.998) (-1328.593) -- 0:03:39
      158000 -- (-1346.319) (-1335.807) [-1336.984] (-1353.486) * (-1345.972) (-1349.710) [-1347.955] (-1346.559) -- 0:03:38
      158500 -- (-1342.331) [-1323.899] (-1348.654) (-1341.590) * [-1349.257] (-1342.778) (-1348.574) (-1348.190) -- 0:03:37
      159000 -- (-1332.033) [-1334.523] (-1349.077) (-1345.018) * (-1344.825) (-1343.529) [-1319.349] (-1355.832) -- 0:03:36
      159500 -- [-1339.639] (-1338.793) (-1347.663) (-1344.443) * (-1339.381) (-1343.062) [-1320.582] (-1338.708) -- 0:03:36
      160000 -- [-1339.865] (-1338.026) (-1338.647) (-1346.055) * (-1338.886) (-1349.306) [-1321.021] (-1353.301) -- 0:03:35

      Average standard deviation of split frequencies: 0.031502

      160500 -- (-1351.209) [-1333.977] (-1347.195) (-1340.612) * (-1353.442) (-1335.665) [-1322.854] (-1328.496) -- 0:03:34
      161000 -- [-1338.640] (-1352.422) (-1341.725) (-1355.056) * (-1355.851) (-1347.045) [-1317.072] (-1345.081) -- 0:03:33
      161500 -- [-1343.475] (-1338.107) (-1339.800) (-1345.151) * [-1337.211] (-1339.911) (-1348.924) (-1341.705) -- 0:03:38
      162000 -- (-1339.753) (-1332.405) (-1345.514) [-1347.369] * (-1347.021) (-1336.702) [-1338.216] (-1342.654) -- 0:03:37
      162500 -- (-1340.663) (-1354.622) (-1329.402) [-1338.846] * (-1348.370) [-1338.379] (-1344.605) (-1349.698) -- 0:03:36
      163000 -- (-1342.075) (-1354.883) [-1309.663] (-1345.899) * [-1332.986] (-1334.834) (-1337.816) (-1345.484) -- 0:03:35
      163500 -- (-1335.566) (-1350.880) [-1319.120] (-1356.118) * (-1353.046) (-1337.716) [-1333.037] (-1344.079) -- 0:03:34
      164000 -- (-1346.313) (-1350.325) [-1325.409] (-1348.356) * (-1352.138) [-1336.094] (-1343.940) (-1339.427) -- 0:03:34
      164500 -- [-1327.085] (-1337.998) (-1332.485) (-1352.582) * (-1341.784) (-1352.518) [-1339.287] (-1336.918) -- 0:03:33
      165000 -- [-1318.636] (-1342.518) (-1345.511) (-1353.569) * (-1345.390) (-1348.452) [-1345.398] (-1340.016) -- 0:03:32

      Average standard deviation of split frequencies: 0.028540

      165500 -- (-1342.503) [-1330.246] (-1347.689) (-1350.072) * (-1329.788) (-1342.644) [-1329.424] (-1343.489) -- 0:03:36
      166000 -- [-1329.608] (-1332.212) (-1349.670) (-1349.288) * (-1328.462) (-1347.410) [-1334.132] (-1336.510) -- 0:03:36
      166500 -- [-1315.229] (-1346.092) (-1356.134) (-1350.185) * (-1338.411) (-1347.257) [-1328.774] (-1342.064) -- 0:03:35
      167000 -- (-1335.632) (-1347.285) (-1341.873) [-1348.497] * (-1346.011) (-1351.920) (-1340.907) [-1339.823] -- 0:03:34
      167500 -- [-1329.889] (-1342.431) (-1337.851) (-1349.954) * [-1333.158] (-1353.149) (-1337.624) (-1338.768) -- 0:03:33
      168000 -- (-1336.774) (-1338.912) [-1340.972] (-1346.401) * [-1326.810] (-1354.735) (-1330.950) (-1354.826) -- 0:03:32
      168500 -- (-1339.910) [-1338.457] (-1345.861) (-1351.086) * (-1354.647) (-1350.524) (-1342.730) [-1337.610] -- 0:03:32
      169000 -- [-1330.223] (-1337.947) (-1338.613) (-1342.566) * (-1354.681) (-1343.222) (-1343.548) [-1331.662] -- 0:03:31
      169500 -- (-1337.797) [-1333.186] (-1343.358) (-1344.455) * (-1338.413) (-1349.870) (-1347.098) [-1333.498] -- 0:03:35
      170000 -- (-1336.568) (-1343.647) [-1341.775] (-1357.605) * (-1341.289) (-1350.992) (-1351.749) [-1326.693] -- 0:03:34

      Average standard deviation of split frequencies: 0.029511

      170500 -- (-1342.638) (-1339.361) (-1343.406) [-1340.593] * [-1330.504] (-1354.994) (-1338.557) (-1329.918) -- 0:03:34
      171000 -- (-1347.876) [-1323.356] (-1350.585) (-1337.709) * [-1326.211] (-1347.758) (-1356.196) (-1329.868) -- 0:03:33
      171500 -- (-1345.620) [-1334.370] (-1343.439) (-1337.966) * (-1324.714) (-1346.767) (-1345.734) [-1328.211] -- 0:03:32
      172000 -- (-1345.687) (-1343.090) (-1347.399) [-1342.535] * (-1346.023) (-1350.821) (-1341.843) [-1328.886] -- 0:03:31
      172500 -- (-1347.335) (-1345.399) (-1342.170) [-1350.261] * (-1336.616) (-1345.681) (-1343.123) [-1343.506] -- 0:03:31
      173000 -- (-1348.016) [-1322.816] (-1346.655) (-1340.298) * [-1315.115] (-1346.473) (-1331.966) (-1334.806) -- 0:03:35
      173500 -- (-1344.531) (-1337.591) [-1345.526] (-1345.173) * (-1327.837) (-1353.110) [-1325.563] (-1343.321) -- 0:03:34
      174000 -- (-1338.338) [-1327.900] (-1360.564) (-1345.858) * [-1332.294] (-1356.218) (-1329.209) (-1340.379) -- 0:03:33
      174500 -- (-1340.919) (-1348.356) (-1342.367) [-1342.989] * (-1328.485) (-1349.344) (-1341.851) [-1340.078] -- 0:03:32
      175000 -- [-1338.315] (-1338.175) (-1338.538) (-1349.498) * [-1326.126] (-1347.498) (-1343.284) (-1343.518) -- 0:03:32

      Average standard deviation of split frequencies: 0.027348

      175500 -- (-1343.745) [-1327.533] (-1358.406) (-1340.861) * [-1322.428] (-1353.899) (-1338.407) (-1345.733) -- 0:03:31
      176000 -- (-1347.287) [-1321.703] (-1345.136) (-1346.914) * [-1320.695] (-1349.323) (-1342.366) (-1339.701) -- 0:03:30
      176500 -- (-1332.937) [-1328.810] (-1340.749) (-1352.408) * [-1337.497] (-1339.483) (-1338.614) (-1351.689) -- 0:03:29
      177000 -- (-1343.484) (-1332.348) (-1350.392) [-1321.405] * (-1340.390) (-1341.373) [-1343.306] (-1352.269) -- 0:03:33
      177500 -- (-1338.075) (-1340.423) (-1343.552) [-1332.090] * (-1341.855) (-1354.610) [-1345.989] (-1353.595) -- 0:03:33
      178000 -- (-1344.689) [-1333.758] (-1341.518) (-1339.671) * [-1325.790] (-1341.387) (-1345.501) (-1346.968) -- 0:03:32
      178500 -- (-1352.578) (-1326.051) (-1341.243) [-1337.671] * [-1311.877] (-1345.139) (-1349.043) (-1344.511) -- 0:03:31
      179000 -- (-1348.314) (-1340.905) [-1338.188] (-1341.253) * [-1315.093] (-1346.433) (-1350.765) (-1341.199) -- 0:03:30
      179500 -- (-1334.552) [-1328.864] (-1345.016) (-1338.955) * [-1314.516] (-1340.377) (-1328.965) (-1342.342) -- 0:03:30
      180000 -- (-1347.982) [-1318.298] (-1348.836) (-1347.340) * (-1338.463) (-1343.859) [-1348.379] (-1345.553) -- 0:03:29

      Average standard deviation of split frequencies: 0.024582

      180500 -- (-1342.348) [-1324.863] (-1351.259) (-1347.098) * [-1314.032] (-1343.979) (-1341.974) (-1347.345) -- 0:03:28
      181000 -- (-1348.248) (-1334.088) [-1326.781] (-1346.000) * [-1331.733] (-1343.606) (-1346.870) (-1346.293) -- 0:03:32
      181500 -- (-1342.705) (-1315.708) [-1332.163] (-1340.227) * (-1334.102) (-1348.442) [-1330.708] (-1338.299) -- 0:03:31
      182000 -- (-1341.835) [-1322.922] (-1339.411) (-1345.927) * [-1302.441] (-1342.782) (-1354.766) (-1341.242) -- 0:03:31
      182500 -- (-1339.437) [-1312.402] (-1344.784) (-1335.895) * [-1316.402] (-1332.006) (-1344.077) (-1349.973) -- 0:03:30
      183000 -- (-1344.814) [-1326.633] (-1342.272) (-1339.622) * [-1314.853] (-1346.695) (-1332.083) (-1346.498) -- 0:03:29
      183500 -- [-1323.572] (-1352.370) (-1347.246) (-1337.461) * [-1316.772] (-1339.284) (-1336.278) (-1346.493) -- 0:03:29
      184000 -- [-1336.945] (-1341.190) (-1348.824) (-1350.283) * (-1317.977) [-1338.652] (-1345.338) (-1347.078) -- 0:03:28
      184500 -- (-1352.732) (-1331.155) (-1349.921) [-1333.382] * [-1331.803] (-1343.040) (-1348.509) (-1355.816) -- 0:03:27
      185000 -- (-1350.802) (-1329.350) (-1358.240) [-1338.876] * (-1341.346) [-1327.807] (-1343.798) (-1346.592) -- 0:03:31

      Average standard deviation of split frequencies: 0.023877

      185500 -- (-1337.233) [-1316.235] (-1333.782) (-1349.124) * (-1336.135) [-1330.081] (-1348.941) (-1351.532) -- 0:03:30
      186000 -- (-1339.094) [-1327.197] (-1334.712) (-1347.861) * (-1339.424) [-1324.974] (-1344.521) (-1339.448) -- 0:03:30
      186500 -- (-1336.864) [-1334.351] (-1346.957) (-1342.161) * (-1352.963) [-1328.351] (-1339.445) (-1341.487) -- 0:03:29
      187000 -- (-1322.395) [-1342.357] (-1344.843) (-1343.224) * (-1350.584) (-1337.259) [-1337.988] (-1353.919) -- 0:03:28
      187500 -- [-1325.942] (-1338.456) (-1340.874) (-1348.265) * (-1351.253) [-1348.861] (-1344.964) (-1352.198) -- 0:03:28
      188000 -- [-1333.991] (-1339.563) (-1346.216) (-1351.344) * (-1348.898) [-1332.006] (-1352.812) (-1346.852) -- 0:03:27
      188500 -- [-1327.855] (-1337.967) (-1341.801) (-1348.880) * (-1337.173) (-1348.145) (-1348.706) [-1329.783] -- 0:03:30
      189000 -- (-1323.254) (-1341.395) [-1339.381] (-1341.171) * (-1334.775) [-1344.665] (-1352.957) (-1349.336) -- 0:03:30
      189500 -- (-1335.941) [-1340.591] (-1349.099) (-1340.741) * (-1334.155) [-1336.697] (-1344.796) (-1346.520) -- 0:03:29
      190000 -- [-1340.568] (-1346.460) (-1345.228) (-1350.010) * (-1343.477) [-1335.026] (-1336.132) (-1358.527) -- 0:03:28

      Average standard deviation of split frequencies: 0.021211

      190500 -- (-1337.091) [-1337.493] (-1351.963) (-1348.998) * [-1321.085] (-1342.441) (-1340.705) (-1347.428) -- 0:03:28
      191000 -- [-1328.346] (-1344.891) (-1337.027) (-1350.332) * [-1322.595] (-1335.580) (-1338.374) (-1355.046) -- 0:03:27
      191500 -- (-1330.896) (-1345.212) [-1336.855] (-1344.624) * [-1333.386] (-1332.266) (-1341.421) (-1349.030) -- 0:03:26
      192000 -- [-1337.108] (-1358.829) (-1341.083) (-1340.060) * [-1320.254] (-1338.457) (-1345.714) (-1344.742) -- 0:03:26
      192500 -- [-1332.199] (-1345.087) (-1342.909) (-1350.578) * [-1328.646] (-1340.602) (-1344.111) (-1339.665) -- 0:03:29
      193000 -- (-1331.995) (-1332.988) [-1327.337] (-1343.428) * (-1335.815) (-1345.746) (-1347.925) [-1337.692] -- 0:03:29
      193500 -- (-1356.970) (-1352.353) [-1318.320] (-1343.249) * (-1346.241) [-1325.936] (-1341.174) (-1323.695) -- 0:03:28
      194000 -- (-1349.758) (-1341.108) [-1314.174] (-1342.225) * (-1339.453) (-1338.245) (-1342.764) [-1339.760] -- 0:03:27
      194500 -- (-1352.973) [-1340.134] (-1327.687) (-1341.939) * (-1345.830) (-1328.315) (-1346.623) [-1337.710] -- 0:03:27
      195000 -- [-1329.227] (-1337.283) (-1329.018) (-1342.340) * [-1339.002] (-1335.438) (-1344.532) (-1342.365) -- 0:03:26

      Average standard deviation of split frequencies: 0.020380

      195500 -- [-1323.077] (-1345.855) (-1332.444) (-1349.193) * (-1344.116) [-1327.665] (-1352.596) (-1340.542) -- 0:03:25
      196000 -- (-1348.298) (-1340.461) [-1326.355] (-1341.230) * (-1345.638) (-1343.142) [-1338.689] (-1320.384) -- 0:03:25
      196500 -- [-1332.608] (-1347.302) (-1328.977) (-1349.046) * (-1348.293) (-1348.196) (-1329.292) [-1330.573] -- 0:03:28
      197000 -- (-1356.382) (-1333.109) [-1331.313] (-1340.201) * (-1352.329) [-1329.361] (-1343.434) (-1339.965) -- 0:03:27
      197500 -- (-1333.044) (-1345.922) [-1342.882] (-1345.817) * (-1349.788) [-1337.394] (-1335.893) (-1334.038) -- 0:03:27
      198000 -- (-1344.164) (-1342.064) [-1327.001] (-1348.884) * (-1334.280) (-1338.680) [-1341.525] (-1334.095) -- 0:03:26
      198500 -- (-1333.489) [-1330.104] (-1309.641) (-1350.351) * (-1343.452) (-1349.197) (-1328.818) [-1315.209] -- 0:03:25
      199000 -- (-1343.736) (-1339.974) [-1306.834] (-1341.566) * (-1344.039) (-1335.052) [-1321.337] (-1339.194) -- 0:03:25
      199500 -- (-1344.203) (-1345.252) [-1337.738] (-1343.414) * (-1351.165) (-1342.629) [-1313.171] (-1347.384) -- 0:03:24
      200000 -- (-1323.090) (-1345.158) [-1335.761] (-1357.039) * (-1336.557) (-1348.198) [-1325.246] (-1343.875) -- 0:03:24

      Average standard deviation of split frequencies: 0.018299

      200500 -- (-1353.658) [-1313.437] (-1335.027) (-1343.701) * (-1349.850) (-1360.890) [-1317.564] (-1345.576) -- 0:03:27
      201000 -- (-1345.368) [-1318.117] (-1331.056) (-1344.574) * (-1338.700) [-1340.686] (-1327.896) (-1333.473) -- 0:03:26
      201500 -- (-1345.342) [-1315.905] (-1325.998) (-1337.236) * (-1336.531) (-1344.828) [-1311.181] (-1325.742) -- 0:03:26
      202000 -- (-1352.072) [-1323.411] (-1334.551) (-1350.371) * (-1339.900) (-1347.146) [-1316.725] (-1334.667) -- 0:03:25
      202500 -- [-1328.538] (-1337.452) (-1340.096) (-1365.114) * (-1346.341) (-1352.031) [-1321.427] (-1321.875) -- 0:03:24
      203000 -- [-1340.140] (-1340.841) (-1342.962) (-1347.460) * (-1356.392) (-1339.729) (-1326.473) [-1324.999] -- 0:03:24
      203500 -- [-1333.723] (-1351.037) (-1335.126) (-1341.957) * (-1335.747) (-1345.003) (-1338.113) [-1319.801] -- 0:03:23
      204000 -- (-1347.342) (-1338.269) [-1330.929] (-1341.220) * (-1344.776) (-1346.302) (-1350.798) [-1344.328] -- 0:03:22
      204500 -- (-1349.127) [-1341.759] (-1342.342) (-1351.376) * [-1327.679] (-1336.885) (-1349.942) (-1337.358) -- 0:03:26
      205000 -- (-1343.176) (-1350.041) [-1329.966] (-1332.457) * [-1326.175] (-1345.791) (-1344.833) (-1334.933) -- 0:03:25

      Average standard deviation of split frequencies: 0.016259

      205500 -- (-1349.237) (-1352.143) (-1339.666) [-1337.048] * [-1342.054] (-1345.985) (-1336.638) (-1344.951) -- 0:03:24
      206000 -- (-1342.632) (-1346.044) (-1341.470) [-1335.665] * [-1349.481] (-1348.125) (-1341.273) (-1351.146) -- 0:03:24
      206500 -- (-1337.445) (-1350.804) (-1346.051) [-1338.532] * (-1341.114) (-1346.800) [-1317.760] (-1350.822) -- 0:03:23
      207000 -- (-1337.906) (-1344.662) [-1351.163] (-1345.657) * (-1335.065) (-1340.165) [-1315.329] (-1340.102) -- 0:03:23
      207500 -- [-1311.636] (-1347.128) (-1346.712) (-1343.490) * [-1316.770] (-1341.906) (-1316.640) (-1345.339) -- 0:03:22
      208000 -- [-1307.947] (-1350.652) (-1332.782) (-1347.439) * (-1319.780) (-1353.418) (-1342.356) [-1337.958] -- 0:03:25
      208500 -- (-1337.480) (-1339.498) [-1336.212] (-1343.348) * [-1328.308] (-1351.198) (-1355.307) (-1339.955) -- 0:03:24
      209000 -- [-1331.805] (-1348.936) (-1347.325) (-1343.529) * (-1339.060) (-1349.398) (-1338.221) [-1321.554] -- 0:03:24
      209500 -- (-1358.016) (-1342.531) (-1336.142) [-1339.655] * (-1351.510) (-1346.478) [-1321.199] (-1342.228) -- 0:03:23
      210000 -- [-1339.177] (-1351.388) (-1348.242) (-1342.878) * (-1345.685) (-1350.714) [-1335.851] (-1341.427) -- 0:03:23

      Average standard deviation of split frequencies: 0.017548

      210500 -- [-1326.337] (-1343.224) (-1334.302) (-1344.766) * (-1335.749) (-1351.079) (-1339.087) [-1336.878] -- 0:03:22
      211000 -- (-1336.347) [-1334.083] (-1325.942) (-1339.919) * (-1338.122) (-1350.221) (-1343.789) [-1343.651] -- 0:03:21
      211500 -- (-1344.162) (-1343.207) [-1333.334] (-1342.644) * (-1342.337) [-1323.676] (-1331.171) (-1333.620) -- 0:03:21
      212000 -- (-1346.147) (-1343.299) [-1335.984] (-1343.169) * (-1347.694) (-1349.513) [-1324.650] (-1331.464) -- 0:03:24
      212500 -- [-1343.963] (-1340.646) (-1337.744) (-1360.486) * [-1341.754] (-1343.685) (-1332.535) (-1355.239) -- 0:03:23
      213000 -- (-1359.286) (-1344.182) [-1333.381] (-1347.589) * (-1352.104) (-1339.978) [-1321.930] (-1342.316) -- 0:03:23
      213500 -- (-1340.591) [-1330.847] (-1332.967) (-1346.876) * (-1346.536) (-1338.121) [-1319.688] (-1337.645) -- 0:03:22
      214000 -- (-1343.922) [-1330.744] (-1348.472) (-1344.180) * (-1351.808) (-1343.474) [-1337.011] (-1356.519) -- 0:03:22
      214500 -- (-1329.006) [-1331.768] (-1351.891) (-1345.025) * (-1346.367) [-1334.639] (-1332.201) (-1341.900) -- 0:03:21
      215000 -- [-1333.047] (-1338.172) (-1320.232) (-1343.836) * (-1351.243) (-1349.525) (-1342.132) [-1338.307] -- 0:03:20

      Average standard deviation of split frequencies: 0.017115

      215500 -- (-1352.557) (-1340.311) [-1321.325] (-1339.817) * (-1340.133) [-1341.676] (-1337.010) (-1352.287) -- 0:03:20
      216000 -- (-1351.358) (-1348.727) [-1322.323] (-1348.011) * (-1349.149) (-1347.430) [-1319.235] (-1344.555) -- 0:03:23
      216500 -- (-1345.832) (-1350.526) (-1338.155) [-1328.605] * [-1339.105] (-1346.254) (-1327.024) (-1351.283) -- 0:03:22
      217000 -- (-1339.834) (-1340.430) [-1333.127] (-1354.670) * (-1333.094) (-1342.673) [-1338.532] (-1336.340) -- 0:03:22
      217500 -- (-1334.501) (-1335.918) [-1327.199] (-1349.407) * (-1348.042) (-1331.976) (-1363.420) [-1325.932] -- 0:03:21
      218000 -- (-1344.019) [-1341.372] (-1348.355) (-1347.850) * (-1334.660) [-1338.341] (-1346.848) (-1337.781) -- 0:03:20
      218500 -- (-1341.292) (-1349.220) [-1338.004] (-1351.233) * (-1359.526) (-1347.683) [-1335.547] (-1344.683) -- 0:03:20
      219000 -- (-1338.470) (-1342.097) [-1335.518] (-1356.732) * (-1355.747) (-1346.115) (-1328.487) [-1336.072] -- 0:03:19
      219500 -- (-1342.711) (-1337.256) [-1336.258] (-1352.784) * (-1351.560) (-1349.656) (-1321.441) [-1316.280] -- 0:03:19
      220000 -- (-1360.705) (-1331.733) [-1333.785] (-1345.329) * (-1342.353) (-1349.108) (-1329.336) [-1328.856] -- 0:03:22

      Average standard deviation of split frequencies: 0.018633

      220500 -- (-1351.779) [-1340.209] (-1337.427) (-1350.217) * (-1353.739) (-1346.351) [-1339.236] (-1338.169) -- 0:03:21
      221000 -- (-1343.103) (-1351.849) [-1334.177] (-1347.206) * (-1342.456) (-1342.151) (-1321.330) [-1339.518] -- 0:03:20
      221500 -- (-1348.769) [-1338.110] (-1340.894) (-1340.034) * (-1351.756) (-1356.808) (-1321.186) [-1324.367] -- 0:03:20
      222000 -- (-1336.397) (-1344.077) [-1335.947] (-1341.132) * (-1356.606) (-1348.670) [-1329.102] (-1325.697) -- 0:03:19
      222500 -- (-1344.603) (-1352.167) [-1333.909] (-1342.387) * (-1348.126) (-1353.098) [-1332.940] (-1328.682) -- 0:03:19
      223000 -- (-1356.479) (-1343.797) (-1328.001) [-1345.915] * (-1350.543) (-1350.349) (-1338.101) [-1331.033] -- 0:03:18
      223500 -- (-1346.544) (-1337.026) [-1331.765] (-1344.836) * (-1351.031) (-1351.561) (-1341.918) [-1339.465] -- 0:03:18
      224000 -- (-1344.728) (-1345.585) [-1319.834] (-1345.436) * (-1357.897) (-1345.098) (-1334.127) [-1333.097] -- 0:03:20
      224500 -- (-1346.931) (-1352.444) [-1326.358] (-1348.460) * (-1354.613) (-1350.237) [-1330.547] (-1339.227) -- 0:03:20
      225000 -- (-1350.633) (-1346.678) [-1329.035] (-1345.287) * (-1344.697) (-1356.680) (-1335.901) [-1327.209] -- 0:03:19

      Average standard deviation of split frequencies: 0.018889

      225500 -- (-1341.800) (-1352.142) [-1322.259] (-1337.191) * (-1342.484) (-1344.408) (-1333.148) [-1321.371] -- 0:03:19
      226000 -- [-1340.646] (-1355.512) (-1345.454) (-1344.438) * (-1346.798) (-1336.951) (-1350.168) [-1315.543] -- 0:03:18
      226500 -- (-1345.352) (-1341.863) (-1342.057) [-1326.649] * [-1335.807] (-1345.862) (-1344.152) (-1334.685) -- 0:03:18
      227000 -- (-1349.190) [-1333.763] (-1345.680) (-1308.844) * (-1353.027) (-1344.359) [-1333.904] (-1344.721) -- 0:03:17
      227500 -- (-1344.503) (-1331.542) (-1344.754) [-1328.912] * (-1348.051) (-1348.593) (-1337.627) [-1335.349] -- 0:03:16
      228000 -- [-1333.264] (-1357.118) (-1358.038) (-1335.647) * (-1342.998) (-1340.980) (-1345.850) [-1331.563] -- 0:03:19
      228500 -- (-1339.882) (-1350.265) (-1348.109) [-1338.664] * (-1344.792) (-1349.184) (-1345.152) [-1329.477] -- 0:03:19
      229000 -- (-1345.253) [-1341.545] (-1329.618) (-1349.790) * (-1348.491) (-1354.594) (-1344.599) [-1334.369] -- 0:03:18
      229500 -- [-1347.879] (-1346.245) (-1340.788) (-1336.260) * (-1344.783) (-1350.761) [-1336.275] (-1339.119) -- 0:03:18
      230000 -- (-1349.930) (-1355.299) (-1342.477) [-1328.266] * (-1333.949) (-1349.890) (-1333.677) [-1340.388] -- 0:03:17

      Average standard deviation of split frequencies: 0.018823

      230500 -- (-1344.274) (-1341.179) (-1347.546) [-1330.209] * (-1333.392) (-1349.664) (-1344.573) [-1336.008] -- 0:03:16
      231000 -- (-1348.869) (-1349.604) [-1336.971] (-1340.520) * [-1336.973] (-1358.490) (-1343.395) (-1335.471) -- 0:03:16
      231500 -- (-1342.690) (-1354.006) [-1321.650] (-1338.000) * (-1347.050) (-1346.433) (-1352.055) [-1319.771] -- 0:03:19
      232000 -- (-1341.144) (-1353.862) [-1333.438] (-1349.902) * (-1340.255) (-1353.934) (-1333.264) [-1320.899] -- 0:03:18
      232500 -- (-1338.660) (-1353.701) [-1324.547] (-1335.607) * (-1349.273) (-1353.252) (-1343.275) [-1341.035] -- 0:03:18
      233000 -- (-1349.646) (-1341.516) [-1338.736] (-1341.489) * [-1338.765] (-1354.917) (-1337.253) (-1346.059) -- 0:03:17
      233500 -- (-1340.789) [-1338.847] (-1351.999) (-1345.752) * [-1327.796] (-1337.636) (-1325.876) (-1340.187) -- 0:03:16
      234000 -- (-1338.776) [-1337.823] (-1346.415) (-1345.394) * (-1336.609) (-1346.718) [-1337.832] (-1341.674) -- 0:03:16
      234500 -- (-1335.747) (-1344.375) [-1339.547] (-1348.393) * (-1353.910) (-1349.857) [-1335.791] (-1359.006) -- 0:03:15
      235000 -- (-1335.164) (-1339.098) [-1333.227] (-1345.030) * (-1337.859) [-1341.069] (-1344.402) (-1345.662) -- 0:03:15

      Average standard deviation of split frequencies: 0.018818

      235500 -- (-1347.484) (-1340.318) [-1322.865] (-1351.282) * [-1340.186] (-1336.408) (-1354.957) (-1340.846) -- 0:03:18
      236000 -- (-1340.425) (-1333.764) (-1342.766) [-1325.103] * (-1343.362) (-1336.088) (-1346.277) [-1334.253] -- 0:03:17
      236500 -- (-1343.484) (-1360.607) (-1344.738) [-1332.443] * (-1339.310) (-1340.956) (-1339.420) [-1325.230] -- 0:03:16
      237000 -- (-1345.006) (-1325.253) [-1326.138] (-1346.966) * (-1342.518) (-1338.525) [-1326.081] (-1329.642) -- 0:03:16
      237500 -- [-1325.837] (-1344.424) (-1340.804) (-1348.845) * (-1341.278) (-1352.757) (-1336.611) [-1334.248] -- 0:03:15
      238000 -- [-1310.447] (-1349.682) (-1332.213) (-1344.767) * (-1345.860) [-1329.405] (-1339.297) (-1352.564) -- 0:03:15
      238500 -- (-1332.087) [-1336.945] (-1341.868) (-1344.890) * (-1345.173) [-1334.948] (-1349.651) (-1345.480) -- 0:03:14
      239000 -- [-1327.612] (-1338.419) (-1333.195) (-1341.104) * (-1342.868) [-1324.684] (-1321.468) (-1346.213) -- 0:03:14
      239500 -- [-1318.829] (-1343.726) (-1327.435) (-1327.865) * [-1338.470] (-1328.519) (-1344.344) (-1339.783) -- 0:03:16
      240000 -- (-1338.387) (-1341.161) (-1339.819) [-1327.462] * (-1332.943) [-1327.734] (-1348.868) (-1356.921) -- 0:03:16

      Average standard deviation of split frequencies: 0.018144

      240500 -- (-1346.320) [-1338.330] (-1347.776) (-1346.698) * (-1344.808) (-1330.142) (-1356.413) [-1332.298] -- 0:03:15
      241000 -- (-1340.528) [-1345.582] (-1335.069) (-1346.882) * (-1334.156) [-1329.238] (-1339.098) (-1359.164) -- 0:03:15
      241500 -- (-1346.091) (-1347.904) [-1316.424] (-1350.004) * (-1345.363) (-1343.674) [-1340.766] (-1339.716) -- 0:03:14
      242000 -- (-1341.157) [-1319.338] (-1332.068) (-1343.570) * (-1351.263) (-1336.747) (-1345.173) [-1335.738] -- 0:03:14
      242500 -- (-1340.120) (-1331.160) [-1320.331] (-1356.891) * [-1319.933] (-1341.636) (-1350.652) (-1335.390) -- 0:03:13
      243000 -- (-1337.656) [-1322.885] (-1329.042) (-1357.791) * [-1336.848] (-1345.745) (-1337.824) (-1351.493) -- 0:03:13
      243500 -- (-1340.656) [-1320.490] (-1330.820) (-1339.611) * (-1336.782) (-1341.989) (-1342.751) [-1343.929] -- 0:03:15
      244000 -- (-1347.709) [-1329.953] (-1355.509) (-1344.898) * [-1332.721] (-1345.270) (-1345.068) (-1342.771) -- 0:03:15
      244500 -- [-1334.529] (-1341.858) (-1353.482) (-1336.091) * (-1336.184) [-1325.131] (-1342.027) (-1348.705) -- 0:03:14
      245000 -- (-1330.636) [-1323.983] (-1350.441) (-1362.678) * (-1330.444) [-1333.172] (-1340.000) (-1343.892) -- 0:03:14

      Average standard deviation of split frequencies: 0.017347

      245500 -- (-1337.882) [-1331.469] (-1354.750) (-1351.231) * [-1317.669] (-1347.006) (-1341.379) (-1329.609) -- 0:03:13
      246000 -- (-1331.187) (-1341.640) [-1336.151] (-1348.579) * [-1315.302] (-1343.192) (-1348.188) (-1348.378) -- 0:03:13
      246500 -- (-1341.006) [-1345.437] (-1356.396) (-1349.814) * [-1326.654] (-1345.723) (-1345.266) (-1340.319) -- 0:03:12
      247000 -- (-1349.953) (-1335.308) (-1349.187) [-1326.232] * [-1322.709] (-1347.886) (-1353.464) (-1339.332) -- 0:03:12
      247500 -- (-1343.572) (-1338.484) (-1350.444) [-1325.974] * [-1320.466] (-1344.802) (-1348.808) (-1341.027) -- 0:03:14
      248000 -- (-1345.718) (-1349.497) (-1340.754) [-1322.469] * (-1336.576) [-1324.919] (-1349.914) (-1347.288) -- 0:03:14
      248500 -- (-1344.190) (-1343.981) (-1343.407) [-1334.236] * (-1329.764) (-1342.515) [-1340.773] (-1342.844) -- 0:03:13
      249000 -- (-1334.593) (-1346.503) (-1342.521) [-1333.380] * [-1317.445] (-1327.845) (-1341.868) (-1336.765) -- 0:03:13
      249500 -- (-1333.698) (-1350.208) (-1341.504) [-1330.981] * [-1326.454] (-1333.303) (-1345.761) (-1338.538) -- 0:03:12
      250000 -- (-1340.338) (-1353.903) (-1348.644) [-1324.974] * (-1330.163) [-1321.888] (-1341.628) (-1344.785) -- 0:03:12

      Average standard deviation of split frequencies: 0.016233

      250500 -- (-1343.181) (-1344.696) (-1344.655) [-1341.178] * (-1348.132) [-1326.757] (-1344.687) (-1340.589) -- 0:03:11
      251000 -- (-1342.880) (-1338.820) (-1342.630) [-1331.969] * (-1347.006) [-1336.689] (-1342.230) (-1334.374) -- 0:03:10
      251500 -- (-1340.212) (-1344.791) (-1347.513) [-1338.847] * (-1349.909) [-1324.872] (-1347.119) (-1337.236) -- 0:03:13
      252000 -- [-1321.219] (-1347.453) (-1341.231) (-1349.976) * (-1346.985) [-1323.979] (-1346.754) (-1333.525) -- 0:03:12
      252500 -- (-1322.478) (-1340.901) (-1344.287) [-1334.384] * (-1342.770) (-1337.860) (-1346.467) [-1336.649] -- 0:03:12
      253000 -- (-1343.980) (-1347.458) [-1344.033] (-1335.417) * (-1344.039) (-1347.452) [-1326.877] (-1344.410) -- 0:03:11
      253500 -- (-1341.390) [-1331.509] (-1343.032) (-1351.059) * (-1353.243) (-1337.824) (-1340.978) [-1335.692] -- 0:03:11
      254000 -- (-1351.518) [-1346.574] (-1349.584) (-1358.288) * (-1361.645) [-1344.863] (-1341.959) (-1337.723) -- 0:03:10
      254500 -- (-1336.676) (-1345.884) (-1353.619) [-1336.890] * (-1354.698) (-1347.400) [-1339.888] (-1341.447) -- 0:03:10
      255000 -- (-1340.089) (-1345.390) (-1339.866) [-1327.468] * (-1341.617) [-1342.609] (-1344.102) (-1339.443) -- 0:03:12

      Average standard deviation of split frequencies: 0.017251

      255500 -- (-1347.915) (-1338.609) (-1350.486) [-1312.475] * (-1346.729) [-1335.192] (-1345.456) (-1349.503) -- 0:03:12
      256000 -- (-1358.058) (-1348.961) (-1345.144) [-1341.006] * (-1350.624) (-1336.183) [-1335.583] (-1358.807) -- 0:03:11
      256500 -- [-1338.438] (-1340.415) (-1342.554) (-1338.050) * (-1344.636) [-1342.882] (-1346.773) (-1339.036) -- 0:03:11
      257000 -- (-1344.417) (-1341.999) (-1337.621) [-1311.188] * (-1342.506) [-1323.088] (-1350.475) (-1352.079) -- 0:03:10
      257500 -- [-1346.220] (-1348.883) (-1341.695) (-1337.035) * (-1343.808) [-1338.048] (-1332.589) (-1351.917) -- 0:03:10
      258000 -- [-1347.106] (-1354.471) (-1348.639) (-1346.359) * (-1348.568) (-1344.362) [-1343.341] (-1357.539) -- 0:03:09
      258500 -- [-1332.115] (-1336.787) (-1347.877) (-1345.337) * (-1353.699) (-1349.652) [-1330.542] (-1339.574) -- 0:03:09
      259000 -- [-1336.555] (-1344.533) (-1344.160) (-1343.380) * (-1341.947) [-1333.995] (-1346.352) (-1340.613) -- 0:03:11
      259500 -- [-1330.104] (-1329.333) (-1360.175) (-1337.637) * (-1344.130) [-1324.394] (-1336.381) (-1340.336) -- 0:03:11
      260000 -- [-1319.041] (-1338.208) (-1346.485) (-1342.808) * (-1351.637) [-1330.503] (-1338.371) (-1348.063) -- 0:03:10

      Average standard deviation of split frequencies: 0.017133

      260500 -- [-1323.629] (-1347.657) (-1347.094) (-1346.753) * (-1339.876) (-1335.523) (-1338.350) [-1331.656] -- 0:03:10
      261000 -- [-1331.395] (-1344.519) (-1338.009) (-1339.699) * (-1342.799) [-1331.135] (-1344.132) (-1341.713) -- 0:03:09
      261500 -- [-1339.451] (-1340.978) (-1363.999) (-1345.917) * (-1356.656) (-1332.929) [-1335.253] (-1346.746) -- 0:03:09
      262000 -- [-1329.732] (-1344.831) (-1349.593) (-1340.856) * (-1342.229) [-1315.921] (-1347.186) (-1339.474) -- 0:03:08
      262500 -- (-1342.634) [-1342.329] (-1338.596) (-1334.779) * (-1342.398) [-1342.185] (-1357.092) (-1344.348) -- 0:03:08
      263000 -- [-1342.186] (-1353.757) (-1349.537) (-1335.257) * (-1342.865) (-1346.834) (-1344.466) [-1338.909] -- 0:03:10
      263500 -- (-1345.585) (-1338.636) (-1345.777) [-1335.249] * (-1346.153) (-1344.209) [-1346.090] (-1342.269) -- 0:03:10
      264000 -- [-1344.408] (-1340.296) (-1347.737) (-1344.872) * [-1345.191] (-1346.847) (-1349.409) (-1340.807) -- 0:03:09
      264500 -- (-1347.116) (-1344.685) (-1342.224) [-1332.551] * [-1329.455] (-1343.072) (-1345.894) (-1345.321) -- 0:03:09
      265000 -- (-1349.648) (-1362.871) [-1338.700] (-1335.622) * (-1348.403) (-1342.499) (-1336.827) [-1320.932] -- 0:03:08

      Average standard deviation of split frequencies: 0.016659

      265500 -- (-1346.368) (-1343.399) (-1350.968) [-1336.264] * (-1339.815) [-1332.950] (-1341.780) (-1325.866) -- 0:03:08
      266000 -- (-1349.614) (-1345.375) (-1340.221) [-1340.434] * (-1348.864) (-1348.596) (-1332.213) [-1334.168] -- 0:03:07
      266500 -- [-1333.424] (-1360.692) (-1349.366) (-1336.548) * (-1347.950) [-1330.097] (-1343.390) (-1341.546) -- 0:03:07
      267000 -- (-1341.883) (-1345.897) (-1345.251) [-1332.684] * (-1340.704) (-1341.628) [-1337.285] (-1346.029) -- 0:03:09
      267500 -- [-1343.488] (-1351.704) (-1338.909) (-1341.215) * [-1330.711] (-1339.070) (-1349.509) (-1340.549) -- 0:03:08
      268000 -- [-1324.717] (-1361.499) (-1343.028) (-1343.842) * (-1341.333) [-1326.964] (-1350.766) (-1338.776) -- 0:03:08
      268500 -- [-1327.798] (-1352.336) (-1351.683) (-1326.743) * [-1339.527] (-1340.958) (-1338.476) (-1349.305) -- 0:03:07
      269000 -- (-1338.897) (-1335.736) (-1343.634) [-1330.140] * [-1338.424] (-1346.621) (-1342.481) (-1345.921) -- 0:03:07
      269500 -- [-1334.157] (-1342.656) (-1347.025) (-1331.499) * (-1334.751) [-1342.439] (-1345.095) (-1340.778) -- 0:03:07
      270000 -- [-1317.185] (-1342.440) (-1347.782) (-1338.685) * (-1347.057) (-1344.080) (-1349.659) [-1341.281] -- 0:03:06

      Average standard deviation of split frequencies: 0.015858

      270500 -- [-1314.043] (-1339.698) (-1346.603) (-1348.429) * [-1332.093] (-1339.142) (-1349.362) (-1336.896) -- 0:03:08
      271000 -- [-1333.548] (-1353.820) (-1347.168) (-1346.425) * [-1343.510] (-1343.308) (-1358.372) (-1342.797) -- 0:03:08
      271500 -- (-1352.250) (-1344.967) [-1334.384] (-1343.268) * (-1343.180) (-1348.198) (-1347.251) [-1339.270] -- 0:03:07
      272000 -- (-1336.183) (-1335.824) [-1325.846] (-1350.755) * [-1340.135] (-1350.099) (-1351.731) (-1348.531) -- 0:03:07
      272500 -- (-1345.117) (-1333.790) [-1324.021] (-1351.483) * (-1342.147) [-1340.947] (-1347.280) (-1342.415) -- 0:03:06
      273000 -- (-1347.663) (-1338.695) (-1343.793) [-1332.235] * (-1337.367) (-1339.314) (-1341.910) [-1340.833] -- 0:03:06
      273500 -- (-1343.439) (-1348.728) [-1333.555] (-1340.082) * (-1344.789) (-1341.568) [-1344.382] (-1345.661) -- 0:03:05
      274000 -- (-1336.377) (-1344.329) (-1346.155) [-1324.764] * (-1343.300) (-1339.437) [-1342.301] (-1351.192) -- 0:03:05
      274500 -- (-1354.670) (-1345.176) (-1343.921) [-1322.912] * (-1345.283) [-1344.875] (-1349.433) (-1358.934) -- 0:03:07
      275000 -- (-1342.459) (-1339.141) [-1337.444] (-1337.787) * [-1333.530] (-1344.417) (-1336.293) (-1344.231) -- 0:03:07

      Average standard deviation of split frequencies: 0.017260

      275500 -- (-1343.745) (-1336.790) [-1328.145] (-1342.703) * (-1344.313) (-1358.294) (-1343.274) [-1339.937] -- 0:03:06
      276000 -- [-1334.875] (-1341.200) (-1344.382) (-1337.796) * (-1336.720) [-1341.092] (-1347.413) (-1342.215) -- 0:03:06
      276500 -- (-1345.625) [-1340.254] (-1349.986) (-1340.334) * [-1336.948] (-1334.031) (-1349.803) (-1352.044) -- 0:03:05
      277000 -- [-1337.593] (-1338.277) (-1345.685) (-1346.893) * (-1351.138) [-1330.852] (-1349.804) (-1344.810) -- 0:03:05
      277500 -- (-1350.367) [-1332.641] (-1340.738) (-1352.579) * (-1339.579) [-1328.079] (-1343.093) (-1346.806) -- 0:03:04
      278000 -- (-1343.194) [-1330.726] (-1337.279) (-1342.797) * (-1352.130) [-1334.642] (-1346.258) (-1353.099) -- 0:03:04
      278500 -- (-1342.917) [-1324.544] (-1336.590) (-1343.041) * (-1340.203) [-1314.160] (-1355.853) (-1348.018) -- 0:03:06
      279000 -- [-1321.525] (-1326.137) (-1342.595) (-1344.304) * (-1345.399) [-1325.221] (-1340.805) (-1344.961) -- 0:03:06
      279500 -- (-1336.754) [-1328.848] (-1340.190) (-1347.305) * (-1348.860) [-1335.265] (-1341.654) (-1351.570) -- 0:03:05
      280000 -- (-1351.803) [-1335.589] (-1340.043) (-1339.858) * (-1348.013) [-1333.552] (-1346.832) (-1348.760) -- 0:03:05

      Average standard deviation of split frequencies: 0.016796

      280500 -- (-1345.219) [-1327.016] (-1325.446) (-1353.489) * (-1347.742) [-1333.886] (-1347.361) (-1341.381) -- 0:03:04
      281000 -- [-1346.272] (-1341.132) (-1313.022) (-1345.208) * (-1344.529) [-1335.513] (-1340.768) (-1350.513) -- 0:03:04
      281500 -- (-1338.243) (-1331.732) [-1323.532] (-1342.542) * (-1351.639) (-1338.694) (-1347.329) [-1346.080] -- 0:03:03
      282000 -- [-1321.358] (-1340.342) (-1336.818) (-1347.422) * (-1339.555) [-1337.075] (-1337.938) (-1342.658) -- 0:03:03
      282500 -- [-1328.653] (-1342.754) (-1340.712) (-1343.826) * [-1332.573] (-1344.669) (-1339.662) (-1356.694) -- 0:03:05
      283000 -- (-1344.601) [-1327.409] (-1336.292) (-1346.881) * (-1345.699) [-1337.812] (-1348.745) (-1346.394) -- 0:03:04
      283500 -- (-1348.776) [-1322.210] (-1352.934) (-1347.977) * (-1350.753) (-1344.013) (-1353.040) [-1343.137] -- 0:03:04
      284000 -- (-1344.445) [-1333.018] (-1345.409) (-1349.523) * (-1348.245) [-1332.819] (-1348.085) (-1339.381) -- 0:03:04
      284500 -- (-1356.296) (-1332.739) (-1343.883) [-1343.892] * (-1344.556) [-1328.241] (-1347.845) (-1337.391) -- 0:03:03
      285000 -- (-1337.429) [-1320.766] (-1347.723) (-1348.938) * (-1330.049) [-1327.593] (-1342.933) (-1341.238) -- 0:03:03

      Average standard deviation of split frequencies: 0.015227

      285500 -- (-1337.958) [-1330.421] (-1346.273) (-1334.759) * (-1326.226) [-1345.672] (-1348.319) (-1344.876) -- 0:03:02
      286000 -- (-1356.722) (-1342.303) (-1355.561) [-1316.054] * (-1343.655) (-1341.955) (-1346.927) [-1342.548] -- 0:03:02
      286500 -- (-1356.555) (-1345.187) (-1344.621) [-1318.445] * [-1341.309] (-1344.597) (-1344.631) (-1343.312) -- 0:03:04
      287000 -- (-1347.169) (-1343.371) (-1348.791) [-1331.646] * (-1348.256) (-1345.713) (-1343.540) [-1337.437] -- 0:03:03
      287500 -- [-1338.226] (-1338.932) (-1337.532) (-1328.093) * [-1344.953] (-1342.952) (-1341.964) (-1336.518) -- 0:03:03
      288000 -- (-1341.125) (-1348.224) (-1347.613) [-1325.183] * [-1351.663] (-1342.889) (-1355.523) (-1336.976) -- 0:03:02
      288500 -- (-1344.710) (-1342.967) (-1339.926) [-1338.125] * (-1341.427) (-1357.978) (-1346.089) [-1338.093] -- 0:03:02
      289000 -- (-1352.598) (-1326.784) (-1343.058) [-1337.164] * (-1344.674) (-1358.751) (-1339.440) [-1337.097] -- 0:03:02
      289500 -- (-1339.676) (-1337.412) (-1348.084) [-1331.250] * (-1348.008) (-1343.282) (-1347.127) [-1326.320] -- 0:03:01
      290000 -- (-1355.737) (-1336.562) (-1347.771) [-1321.537] * (-1339.286) (-1350.811) (-1332.293) [-1322.399] -- 0:03:03

      Average standard deviation of split frequencies: 0.014029

      290500 -- (-1341.717) (-1332.452) (-1347.902) [-1326.986] * (-1340.901) (-1349.736) (-1352.072) [-1322.710] -- 0:03:03
      291000 -- (-1355.204) [-1334.664] (-1344.727) (-1342.216) * (-1351.856) (-1351.185) (-1345.488) [-1327.852] -- 0:03:02
      291500 -- (-1347.453) [-1322.202] (-1339.878) (-1343.328) * (-1344.322) [-1332.960] (-1335.578) (-1345.527) -- 0:03:02
      292000 -- (-1342.959) [-1335.262] (-1340.097) (-1350.310) * (-1345.500) [-1338.254] (-1347.758) (-1343.188) -- 0:03:01
      292500 -- (-1336.553) [-1337.469] (-1343.349) (-1346.476) * (-1355.917) (-1341.534) (-1343.197) [-1330.893] -- 0:03:01
      293000 -- [-1336.781] (-1346.759) (-1342.345) (-1350.576) * (-1341.147) (-1349.792) (-1345.004) [-1334.281] -- 0:03:00
      293500 -- (-1338.932) (-1346.565) (-1341.063) [-1338.449] * (-1341.161) (-1340.783) (-1349.229) [-1338.191] -- 0:03:00
      294000 -- [-1338.541] (-1344.154) (-1342.878) (-1347.830) * (-1341.714) [-1346.420] (-1345.139) (-1347.752) -- 0:03:02
      294500 -- [-1321.427] (-1336.554) (-1355.508) (-1339.756) * (-1342.664) (-1347.695) (-1349.481) [-1336.014] -- 0:03:02
      295000 -- [-1335.058] (-1352.220) (-1350.216) (-1353.873) * (-1346.438) (-1359.931) (-1348.645) [-1343.996] -- 0:03:01

      Average standard deviation of split frequencies: 0.015050

      295500 -- (-1341.746) [-1332.954] (-1343.275) (-1336.974) * (-1346.107) (-1346.087) (-1339.271) [-1332.328] -- 0:03:01
      296000 -- [-1327.832] (-1339.708) (-1342.987) (-1345.217) * [-1331.043] (-1347.290) (-1346.990) (-1343.571) -- 0:03:00
      296500 -- [-1333.005] (-1335.436) (-1347.074) (-1349.858) * [-1324.571] (-1337.677) (-1342.640) (-1350.945) -- 0:03:00
      297000 -- (-1326.894) [-1344.393] (-1343.936) (-1350.829) * [-1320.111] (-1328.305) (-1354.376) (-1345.405) -- 0:02:59
      297500 -- (-1351.912) (-1345.301) [-1351.912] (-1341.296) * (-1345.382) (-1317.332) [-1317.494] (-1349.063) -- 0:02:59
      298000 -- (-1344.462) (-1347.061) (-1354.351) [-1351.786] * (-1343.663) [-1319.148] (-1331.410) (-1346.045) -- 0:03:01
      298500 -- [-1339.916] (-1359.477) (-1337.529) (-1338.791) * (-1347.372) (-1314.950) (-1342.285) [-1332.683] -- 0:03:00
      299000 -- [-1328.253] (-1349.512) (-1338.043) (-1337.082) * (-1342.940) [-1304.686] (-1341.453) (-1348.963) -- 0:03:00
      299500 -- [-1329.245] (-1350.043) (-1339.452) (-1340.569) * (-1351.004) [-1315.380] (-1341.591) (-1341.764) -- 0:03:00
      300000 -- [-1330.573] (-1339.668) (-1338.650) (-1344.465) * (-1354.902) [-1316.935] (-1340.285) (-1358.466) -- 0:02:59

      Average standard deviation of split frequencies: 0.016071

      300500 -- [-1343.205] (-1338.385) (-1340.144) (-1349.835) * (-1349.219) [-1313.817] (-1346.380) (-1348.754) -- 0:02:59
      301000 -- (-1346.093) [-1330.367] (-1340.706) (-1346.854) * (-1358.001) [-1308.840] (-1345.821) (-1347.878) -- 0:02:58
      301500 -- (-1338.062) [-1333.818] (-1345.193) (-1342.794) * (-1355.063) [-1315.633] (-1346.349) (-1338.956) -- 0:02:58
      302000 -- (-1338.006) [-1340.654] (-1347.393) (-1346.747) * (-1343.233) [-1324.496] (-1347.386) (-1338.002) -- 0:03:00
      302500 -- (-1344.960) [-1341.876] (-1352.441) (-1341.289) * (-1340.909) [-1307.248] (-1338.526) (-1349.024) -- 0:02:59
      303000 -- (-1355.378) (-1345.252) [-1337.706] (-1343.787) * (-1355.176) [-1311.978] (-1336.819) (-1345.498) -- 0:02:59
      303500 -- [-1337.141] (-1334.123) (-1346.317) (-1343.057) * (-1336.168) [-1315.889] (-1348.640) (-1341.267) -- 0:02:59
      304000 -- (-1335.506) [-1329.115] (-1341.031) (-1343.088) * (-1343.340) [-1330.534] (-1342.493) (-1332.991) -- 0:02:58
      304500 -- [-1325.852] (-1342.686) (-1344.401) (-1343.700) * [-1338.552] (-1342.000) (-1330.981) (-1347.651) -- 0:02:58
      305000 -- [-1334.241] (-1345.819) (-1360.794) (-1344.004) * (-1340.632) [-1335.000] (-1346.195) (-1346.297) -- 0:02:57

      Average standard deviation of split frequencies: 0.015919

      305500 -- (-1352.318) [-1332.903] (-1343.803) (-1343.753) * (-1340.280) [-1338.949] (-1349.144) (-1339.419) -- 0:02:57
      306000 -- (-1337.067) [-1335.874] (-1346.088) (-1352.979) * (-1347.091) (-1342.317) (-1340.837) [-1334.149] -- 0:02:59
      306500 -- (-1344.462) [-1336.196] (-1342.693) (-1341.029) * [-1342.576] (-1336.439) (-1347.507) (-1345.040) -- 0:02:58
      307000 -- [-1334.288] (-1337.219) (-1347.847) (-1341.293) * [-1336.920] (-1341.811) (-1341.140) (-1352.735) -- 0:02:58
      307500 -- (-1344.576) (-1335.885) (-1350.044) [-1343.868] * [-1322.118] (-1339.929) (-1345.997) (-1342.767) -- 0:02:57
      308000 -- [-1320.702] (-1341.596) (-1343.633) (-1349.868) * (-1343.275) (-1355.236) [-1330.779] (-1338.983) -- 0:02:57
      308500 -- [-1321.045] (-1344.383) (-1354.950) (-1344.151) * [-1326.839] (-1349.145) (-1336.592) (-1337.888) -- 0:02:57
      309000 -- [-1317.815] (-1340.102) (-1346.483) (-1347.667) * [-1330.410] (-1355.660) (-1343.650) (-1338.821) -- 0:02:56
      309500 -- [-1323.919] (-1349.256) (-1359.837) (-1344.770) * (-1332.393) (-1352.641) (-1348.638) [-1333.342] -- 0:02:56
      310000 -- (-1338.102) (-1349.219) (-1364.796) [-1335.525] * [-1311.194] (-1341.801) (-1362.053) (-1339.677) -- 0:02:58

      Average standard deviation of split frequencies: 0.016052

      310500 -- (-1337.947) (-1327.452) (-1361.329) [-1338.703] * [-1313.170] (-1349.193) (-1347.575) (-1335.603) -- 0:02:57
      311000 -- (-1342.598) (-1342.119) (-1347.070) [-1337.602] * [-1331.867] (-1337.094) (-1353.852) (-1338.146) -- 0:02:57
      311500 -- (-1341.244) (-1355.118) (-1346.052) [-1334.051] * (-1336.050) (-1337.488) (-1344.978) [-1339.884] -- 0:02:56
      312000 -- (-1338.751) (-1347.301) (-1351.055) [-1327.614] * (-1345.072) [-1320.765] (-1341.121) (-1336.291) -- 0:02:56
      312500 -- [-1325.274] (-1337.637) (-1344.800) (-1339.131) * (-1340.065) [-1332.319] (-1352.180) (-1344.724) -- 0:02:56
      313000 -- (-1350.216) [-1333.758] (-1345.691) (-1331.408) * (-1348.699) [-1330.149] (-1335.648) (-1339.325) -- 0:02:55
      313500 -- (-1341.402) (-1339.926) (-1339.206) [-1333.592] * (-1357.448) (-1336.544) [-1318.203] (-1338.123) -- 0:02:55
      314000 -- [-1338.536] (-1329.299) (-1341.038) (-1343.620) * (-1350.486) (-1339.722) [-1340.226] (-1347.617) -- 0:02:56
      314500 -- [-1329.897] (-1344.663) (-1339.999) (-1347.744) * (-1346.122) (-1349.364) [-1336.246] (-1346.847) -- 0:02:56
      315000 -- (-1332.273) (-1343.455) [-1338.153] (-1348.315) * (-1360.400) (-1340.066) [-1337.011] (-1344.752) -- 0:02:56

      Average standard deviation of split frequencies: 0.015703

      315500 -- (-1346.476) (-1344.727) (-1337.239) [-1324.834] * (-1341.132) (-1344.832) [-1334.284] (-1353.571) -- 0:02:55
      316000 -- (-1347.095) (-1335.694) [-1336.343] (-1331.442) * (-1349.911) (-1344.056) [-1332.397] (-1343.875) -- 0:02:55
      316500 -- (-1335.529) [-1321.860] (-1347.141) (-1340.709) * [-1347.391] (-1342.474) (-1338.953) (-1325.704) -- 0:02:54
      317000 -- (-1343.201) (-1337.023) (-1355.191) [-1345.216] * (-1351.653) (-1334.453) [-1326.720] (-1324.282) -- 0:02:54
      317500 -- (-1341.575) [-1318.597] (-1341.773) (-1346.417) * (-1346.989) (-1346.300) [-1318.785] (-1343.783) -- 0:02:56
      318000 -- (-1346.935) [-1337.841] (-1333.848) (-1357.084) * (-1353.821) (-1356.886) [-1334.001] (-1339.624) -- 0:02:55
      318500 -- (-1351.585) [-1310.895] (-1339.750) (-1350.241) * [-1336.556] (-1335.647) (-1337.569) (-1346.353) -- 0:02:55
      319000 -- (-1347.947) [-1325.931] (-1346.325) (-1345.437) * [-1342.037] (-1334.566) (-1331.754) (-1346.884) -- 0:02:55
      319500 -- (-1350.021) [-1336.802] (-1346.457) (-1338.304) * (-1349.017) [-1318.906] (-1346.173) (-1338.971) -- 0:02:54
      320000 -- (-1336.811) (-1359.789) [-1332.608] (-1353.754) * (-1344.913) [-1331.657] (-1337.308) (-1335.527) -- 0:02:54

      Average standard deviation of split frequencies: 0.015629

      320500 -- [-1332.372] (-1345.195) (-1339.237) (-1335.549) * (-1347.411) (-1337.023) [-1336.560] (-1335.521) -- 0:02:53
      321000 -- [-1321.497] (-1343.359) (-1347.060) (-1337.265) * (-1345.825) (-1344.603) (-1340.844) [-1331.500] -- 0:02:53
      321500 -- [-1326.435] (-1350.844) (-1345.596) (-1332.833) * (-1342.604) [-1345.809] (-1345.497) (-1334.571) -- 0:02:55
      322000 -- (-1340.556) (-1339.794) [-1329.961] (-1339.634) * (-1347.686) (-1340.873) (-1342.061) [-1314.375] -- 0:02:54
      322500 -- [-1335.301] (-1350.729) (-1332.363) (-1352.143) * [-1337.594] (-1343.215) (-1343.946) (-1337.509) -- 0:02:54
      323000 -- (-1348.412) [-1326.814] (-1343.621) (-1342.330) * (-1342.715) [-1334.614] (-1347.116) (-1327.098) -- 0:02:53
      323500 -- (-1343.233) (-1338.510) (-1351.781) [-1344.081] * (-1353.245) [-1332.860] (-1327.291) (-1336.745) -- 0:02:53
      324000 -- (-1357.681) [-1336.833] (-1339.277) (-1357.983) * (-1354.341) [-1337.269] (-1329.041) (-1341.957) -- 0:02:53
      324500 -- [-1333.416] (-1346.508) (-1338.757) (-1345.185) * [-1334.454] (-1350.235) (-1344.449) (-1357.196) -- 0:02:52
      325000 -- [-1324.652] (-1352.358) (-1335.931) (-1342.380) * (-1340.455) (-1340.477) (-1337.233) [-1340.467] -- 0:02:52

      Average standard deviation of split frequencies: 0.014232

      325500 -- (-1343.476) (-1343.247) [-1334.804] (-1334.836) * (-1341.644) (-1343.803) (-1336.735) [-1337.003] -- 0:02:54
      326000 -- (-1335.989) [-1329.386] (-1349.094) (-1354.168) * (-1336.034) (-1330.831) (-1346.112) [-1336.693] -- 0:02:53
      326500 -- (-1338.726) [-1318.644] (-1342.375) (-1339.284) * (-1342.969) (-1351.647) [-1336.337] (-1343.530) -- 0:02:53
      327000 -- (-1343.741) [-1331.203] (-1344.899) (-1353.124) * (-1351.706) (-1342.778) (-1333.402) [-1328.592] -- 0:02:52
      327500 -- (-1346.363) [-1330.256] (-1329.932) (-1350.260) * (-1345.401) [-1347.436] (-1347.087) (-1335.736) -- 0:02:52
      328000 -- (-1347.791) (-1349.262) [-1333.769] (-1348.198) * (-1344.629) (-1346.973) [-1320.010] (-1321.803) -- 0:02:52
      328500 -- (-1348.813) [-1342.968] (-1343.276) (-1345.763) * (-1345.852) (-1342.899) [-1331.570] (-1340.292) -- 0:02:51
      329000 -- (-1347.472) (-1352.038) (-1337.042) [-1339.549] * (-1348.666) (-1340.092) [-1322.130] (-1348.775) -- 0:02:51
      329500 -- (-1341.769) (-1332.779) (-1345.161) [-1320.598] * (-1346.882) (-1339.789) [-1330.791] (-1342.240) -- 0:02:52
      330000 -- (-1347.426) [-1351.243] (-1342.146) (-1343.186) * (-1342.765) (-1335.150) [-1337.271] (-1340.211) -- 0:02:52

      Average standard deviation of split frequencies: 0.014631

      330500 -- (-1339.593) [-1338.425] (-1357.742) (-1351.059) * (-1349.122) [-1326.797] (-1339.952) (-1341.116) -- 0:02:52
      331000 -- [-1328.079] (-1336.387) (-1337.291) (-1349.879) * (-1348.810) [-1334.027] (-1326.409) (-1345.151) -- 0:02:51
      331500 -- (-1346.871) (-1340.771) [-1337.073] (-1345.593) * (-1336.125) (-1352.868) [-1329.330] (-1351.575) -- 0:02:51
      332000 -- (-1340.649) (-1349.436) (-1346.512) [-1337.241] * (-1334.471) (-1349.074) [-1327.253] (-1337.865) -- 0:02:51
      332500 -- (-1349.028) (-1348.723) [-1343.594] (-1345.093) * (-1345.239) (-1338.753) [-1333.012] (-1345.655) -- 0:02:50
      333000 -- (-1346.905) (-1343.946) (-1338.198) [-1342.992] * (-1341.325) (-1364.008) [-1331.281] (-1347.432) -- 0:02:50
      333500 -- (-1345.693) (-1347.678) (-1346.759) [-1337.684] * (-1346.345) [-1333.075] (-1337.654) (-1341.822) -- 0:02:51
      334000 -- (-1348.199) [-1340.943] (-1347.154) (-1336.807) * [-1340.542] (-1351.652) (-1339.368) (-1340.059) -- 0:02:51
      334500 -- (-1340.996) [-1336.420] (-1331.979) (-1342.883) * (-1347.214) (-1349.133) (-1339.071) [-1352.741] -- 0:02:51
      335000 -- (-1339.373) (-1348.628) [-1314.820] (-1341.253) * (-1343.739) [-1331.019] (-1324.613) (-1350.503) -- 0:02:50

      Average standard deviation of split frequencies: 0.014178

      335500 -- (-1342.438) (-1341.783) (-1331.053) [-1323.182] * (-1353.845) (-1337.714) [-1325.088] (-1333.083) -- 0:02:50
      336000 -- (-1343.533) (-1330.821) [-1331.786] (-1357.055) * (-1353.137) (-1344.197) [-1311.872] (-1349.806) -- 0:02:49
      336500 -- [-1336.323] (-1327.814) (-1348.793) (-1356.529) * (-1356.761) (-1352.750) [-1328.334] (-1353.802) -- 0:02:49
      337000 -- (-1346.918) [-1340.052] (-1342.528) (-1358.774) * (-1352.938) (-1342.206) [-1324.326] (-1347.555) -- 0:02:49
      337500 -- (-1349.844) (-1344.626) (-1334.110) [-1328.359] * (-1346.562) (-1353.077) [-1333.414] (-1350.114) -- 0:02:50
      338000 -- (-1342.327) (-1339.978) (-1343.788) [-1321.635] * (-1341.875) (-1351.988) [-1325.018] (-1349.847) -- 0:02:50
      338500 -- [-1335.559] (-1352.307) (-1337.111) (-1332.834) * [-1345.968] (-1347.038) (-1337.032) (-1353.158) -- 0:02:50
      339000 -- (-1342.382) (-1349.400) [-1314.380] (-1338.436) * (-1354.537) (-1336.297) [-1331.949] (-1351.224) -- 0:02:49
      339500 -- (-1344.813) (-1348.604) [-1321.822] (-1349.794) * (-1333.285) (-1335.091) [-1329.406] (-1348.100) -- 0:02:49
      340000 -- (-1337.290) (-1348.707) [-1337.440] (-1344.847) * (-1330.382) (-1343.603) [-1327.978] (-1343.503) -- 0:02:48

      Average standard deviation of split frequencies: 0.013692

      340500 -- [-1336.556] (-1343.414) (-1340.636) (-1335.282) * (-1342.833) (-1348.920) [-1326.497] (-1351.096) -- 0:02:48
      341000 -- [-1325.541] (-1340.540) (-1345.107) (-1346.868) * [-1338.485] (-1345.395) (-1342.437) (-1341.234) -- 0:02:48
      341500 -- [-1332.349] (-1342.279) (-1336.353) (-1338.547) * (-1342.295) (-1340.502) [-1343.897] (-1339.884) -- 0:02:49
      342000 -- [-1320.944] (-1348.637) (-1339.784) (-1339.531) * (-1339.300) [-1333.983] (-1350.370) (-1351.695) -- 0:02:49
      342500 -- [-1315.103] (-1357.817) (-1345.718) (-1354.529) * [-1334.460] (-1343.841) (-1338.075) (-1328.082) -- 0:02:48
      343000 -- [-1327.345] (-1349.279) (-1334.033) (-1342.826) * (-1334.817) (-1350.112) [-1335.846] (-1339.782) -- 0:02:48
      343500 -- [-1319.556] (-1346.005) (-1350.800) (-1342.863) * (-1335.409) (-1342.591) (-1337.822) [-1313.907] -- 0:02:48
      344000 -- (-1320.055) (-1340.699) (-1345.449) [-1326.704] * (-1351.669) (-1341.264) (-1350.643) [-1322.579] -- 0:02:47
      344500 -- [-1320.729] (-1338.516) (-1344.744) (-1347.621) * (-1346.170) (-1332.509) (-1343.403) [-1329.576] -- 0:02:47
      345000 -- [-1318.561] (-1331.850) (-1336.228) (-1340.623) * (-1349.359) (-1340.286) [-1319.184] (-1335.825) -- 0:02:47

      Average standard deviation of split frequencies: 0.014578

      345500 -- [-1316.550] (-1340.926) (-1344.325) (-1349.592) * (-1356.938) (-1340.642) (-1343.303) [-1333.249] -- 0:02:48
      346000 -- (-1333.741) (-1346.755) [-1347.494] (-1342.407) * (-1351.876) (-1344.739) (-1335.997) [-1326.479] -- 0:02:48
      346500 -- (-1336.564) (-1349.743) [-1346.750] (-1342.435) * (-1346.431) (-1336.442) (-1336.942) [-1323.331] -- 0:02:47
      347000 -- (-1339.286) (-1349.607) [-1335.615] (-1348.579) * (-1342.485) (-1337.194) (-1351.803) [-1315.696] -- 0:02:47
      347500 -- (-1332.751) (-1344.978) [-1326.721] (-1344.674) * (-1343.895) (-1342.719) (-1339.583) [-1326.876] -- 0:02:47
      348000 -- [-1329.703] (-1341.317) (-1334.054) (-1340.619) * (-1350.958) (-1342.190) (-1345.836) [-1323.575] -- 0:02:46
      348500 -- (-1348.944) (-1351.338) [-1328.347] (-1340.706) * (-1351.831) (-1346.256) (-1341.774) [-1328.668] -- 0:02:46
      349000 -- (-1338.282) (-1338.360) [-1327.745] (-1343.722) * (-1344.212) (-1338.969) (-1361.360) [-1338.224] -- 0:02:47
      349500 -- [-1338.373] (-1340.217) (-1338.159) (-1348.792) * (-1350.587) [-1337.159] (-1340.793) (-1335.286) -- 0:02:47
      350000 -- (-1340.209) [-1345.087] (-1355.436) (-1341.386) * (-1341.335) [-1341.122] (-1346.157) (-1332.369) -- 0:02:47

      Average standard deviation of split frequencies: 0.014317

      350500 -- (-1344.250) [-1339.475] (-1347.382) (-1343.515) * (-1342.659) (-1351.048) (-1341.880) [-1343.197] -- 0:02:46
      351000 -- (-1354.017) (-1346.314) [-1335.221] (-1347.199) * (-1345.939) (-1357.506) (-1331.088) [-1323.145] -- 0:02:46
      351500 -- (-1353.503) (-1349.621) [-1330.368] (-1342.817) * (-1343.329) (-1341.612) (-1347.393) [-1333.637] -- 0:02:46
      352000 -- (-1353.480) (-1339.353) [-1324.829] (-1346.262) * (-1342.445) (-1354.765) (-1346.022) [-1335.090] -- 0:02:45
      352500 -- [-1345.806] (-1351.611) (-1330.460) (-1339.196) * (-1344.622) (-1339.034) (-1347.624) [-1334.802] -- 0:02:45
      353000 -- [-1337.724] (-1352.042) (-1341.264) (-1348.324) * (-1344.635) (-1342.019) (-1343.126) [-1346.035] -- 0:02:46
      353500 -- (-1349.807) [-1335.417] (-1342.833) (-1349.505) * (-1356.541) [-1343.602] (-1346.825) (-1338.689) -- 0:02:46
      354000 -- [-1338.272] (-1346.291) (-1341.211) (-1363.977) * [-1336.700] (-1343.564) (-1361.924) (-1335.986) -- 0:02:46
      354500 -- [-1340.377] (-1329.324) (-1347.904) (-1352.147) * (-1347.094) (-1346.965) (-1346.459) [-1321.645] -- 0:02:45
      355000 -- [-1341.792] (-1332.939) (-1347.070) (-1336.630) * (-1348.923) (-1339.773) (-1345.183) [-1329.048] -- 0:02:45

      Average standard deviation of split frequencies: 0.013838

      355500 -- (-1346.737) [-1323.036] (-1348.783) (-1355.666) * (-1333.923) (-1343.763) (-1350.096) [-1327.806] -- 0:02:44
      356000 -- (-1337.735) (-1333.729) (-1343.871) [-1334.826] * (-1349.218) (-1355.804) [-1332.143] (-1355.968) -- 0:02:44
      356500 -- (-1343.986) (-1331.560) (-1346.861) [-1336.454] * (-1346.852) (-1354.645) (-1329.976) [-1339.495] -- 0:02:44
      357000 -- (-1340.973) [-1331.376] (-1341.325) (-1347.059) * (-1343.657) (-1341.081) [-1321.818] (-1353.677) -- 0:02:45
      357500 -- (-1349.260) [-1330.268] (-1344.147) (-1341.230) * (-1341.728) [-1330.586] (-1342.833) (-1346.335) -- 0:02:45
      358000 -- (-1349.587) [-1317.852] (-1334.823) (-1348.568) * (-1353.811) (-1333.673) (-1349.167) [-1326.141] -- 0:02:44
      358500 -- (-1345.777) (-1330.599) [-1333.834] (-1344.434) * (-1337.710) (-1342.160) [-1343.340] (-1334.011) -- 0:02:44
      359000 -- (-1354.299) (-1342.942) (-1339.995) [-1337.955] * (-1331.209) (-1350.142) (-1346.901) [-1320.536] -- 0:02:44
      359500 -- (-1340.726) (-1342.982) [-1335.116] (-1346.469) * [-1317.956] (-1345.042) (-1341.313) (-1340.511) -- 0:02:43
      360000 -- (-1350.631) (-1344.080) [-1328.010] (-1349.713) * [-1332.176] (-1341.043) (-1331.437) (-1345.436) -- 0:02:43

      Average standard deviation of split frequencies: 0.012417

      360500 -- (-1346.625) [-1328.869] (-1345.594) (-1341.932) * (-1349.616) (-1344.547) (-1338.846) [-1330.099] -- 0:02:43
      361000 -- (-1348.014) (-1351.232) [-1331.363] (-1334.264) * (-1341.458) [-1333.220] (-1342.387) (-1334.475) -- 0:02:44
      361500 -- (-1341.265) (-1356.336) [-1323.027] (-1345.298) * [-1340.755] (-1332.297) (-1347.401) (-1333.159) -- 0:02:44
      362000 -- [-1329.819] (-1343.693) (-1350.838) (-1340.607) * (-1342.381) (-1341.378) (-1341.487) [-1333.134] -- 0:02:43
      362500 -- (-1344.706) (-1342.868) (-1346.751) [-1338.259] * (-1343.372) (-1339.007) (-1362.508) [-1330.316] -- 0:02:43
      363000 -- (-1332.084) [-1340.535] (-1340.858) (-1340.335) * [-1334.880] (-1342.234) (-1344.119) (-1324.711) -- 0:02:43
      363500 -- (-1334.247) (-1343.033) [-1336.983] (-1340.624) * (-1334.798) (-1337.408) (-1350.293) [-1341.718] -- 0:02:42
      364000 -- [-1333.724] (-1346.919) (-1349.711) (-1354.458) * (-1338.021) [-1328.109] (-1341.933) (-1342.219) -- 0:02:42
      364500 -- [-1313.108] (-1338.532) (-1344.438) (-1344.675) * (-1340.397) [-1332.444] (-1348.694) (-1331.374) -- 0:02:42
      365000 -- (-1313.301) (-1349.073) [-1329.420] (-1353.997) * [-1320.585] (-1340.802) (-1353.909) (-1344.590) -- 0:02:43

      Average standard deviation of split frequencies: 0.012270

      365500 -- [-1317.441] (-1343.394) (-1335.587) (-1345.942) * [-1310.322] (-1343.262) (-1350.969) (-1324.548) -- 0:02:43
      366000 -- (-1336.439) [-1323.156] (-1328.734) (-1346.000) * [-1330.176] (-1337.097) (-1347.790) (-1346.606) -- 0:02:42
      366500 -- (-1343.271) (-1357.976) [-1323.803] (-1357.257) * [-1322.734] (-1340.143) (-1337.640) (-1334.336) -- 0:02:42
      367000 -- (-1344.433) (-1344.416) [-1332.777] (-1353.899) * [-1324.387] (-1350.331) (-1347.496) (-1341.824) -- 0:02:42
      367500 -- [-1338.917] (-1350.511) (-1337.642) (-1344.573) * (-1319.944) (-1347.042) (-1345.546) [-1332.525] -- 0:02:41
      368000 -- [-1332.425] (-1345.975) (-1319.810) (-1346.718) * [-1348.597] (-1343.129) (-1346.103) (-1343.230) -- 0:02:41
      368500 -- (-1346.373) (-1363.030) (-1331.075) [-1320.242] * (-1337.726) (-1337.729) (-1341.369) [-1323.816] -- 0:02:42
      369000 -- [-1328.689] (-1352.138) (-1338.747) (-1348.884) * (-1360.642) (-1334.001) (-1355.889) [-1318.562] -- 0:02:42
      369500 -- [-1333.046] (-1339.320) (-1352.901) (-1342.051) * (-1348.764) (-1338.707) (-1351.621) [-1317.476] -- 0:02:42
      370000 -- (-1344.797) [-1334.161] (-1342.298) (-1350.739) * (-1340.201) (-1343.991) (-1336.630) [-1317.933] -- 0:02:41

      Average standard deviation of split frequencies: 0.012919

      370500 -- (-1353.158) (-1344.168) [-1338.116] (-1347.348) * (-1347.315) (-1336.104) (-1335.245) [-1325.992] -- 0:02:41
      371000 -- (-1344.022) [-1333.270] (-1334.367) (-1346.869) * (-1352.270) (-1331.551) (-1356.189) [-1329.126] -- 0:02:41
      371500 -- (-1343.403) (-1335.621) [-1318.949] (-1339.399) * (-1346.897) (-1342.843) [-1326.824] (-1336.004) -- 0:02:40
      372000 -- (-1342.623) [-1340.941] (-1337.350) (-1350.888) * (-1344.603) (-1340.294) [-1329.048] (-1341.882) -- 0:02:40
      372500 -- [-1334.516] (-1341.772) (-1344.725) (-1337.884) * (-1332.174) (-1344.187) [-1330.673] (-1347.608) -- 0:02:41
      373000 -- [-1336.420] (-1342.901) (-1339.526) (-1342.884) * [-1319.071] (-1336.035) (-1354.775) (-1352.390) -- 0:02:41
      373500 -- (-1347.390) [-1333.813] (-1338.973) (-1346.065) * [-1327.895] (-1347.883) (-1358.185) (-1341.216) -- 0:02:41
      374000 -- (-1345.603) (-1325.469) [-1312.498] (-1351.298) * (-1340.314) (-1357.393) (-1356.166) [-1332.907] -- 0:02:40
      374500 -- (-1343.589) [-1325.375] (-1333.080) (-1349.463) * [-1332.918] (-1346.646) (-1337.966) (-1335.620) -- 0:02:40
      375000 -- (-1349.485) (-1344.178) [-1323.278] (-1347.842) * (-1335.866) (-1343.577) (-1346.386) [-1341.058] -- 0:02:40

      Average standard deviation of split frequencies: 0.013461

      375500 -- (-1341.074) (-1346.597) [-1332.685] (-1344.528) * [-1324.362] (-1346.947) (-1346.522) (-1339.749) -- 0:02:39
      376000 -- [-1333.136] (-1338.727) (-1342.702) (-1357.097) * [-1328.620] (-1353.669) (-1336.231) (-1342.574) -- 0:02:39
      376500 -- [-1335.373] (-1340.867) (-1352.974) (-1352.395) * [-1324.181] (-1353.981) (-1345.719) (-1340.311) -- 0:02:40
      377000 -- (-1340.195) (-1344.509) [-1328.110] (-1331.280) * [-1324.639] (-1349.816) (-1340.767) (-1348.057) -- 0:02:40
      377500 -- (-1337.730) (-1346.451) (-1339.597) [-1327.060] * (-1338.882) (-1347.147) [-1338.588] (-1347.959) -- 0:02:39
      378000 -- [-1330.391] (-1334.589) (-1341.328) (-1328.565) * [-1325.048] (-1357.475) (-1341.099) (-1341.963) -- 0:02:39
      378500 -- (-1345.241) (-1343.631) [-1334.086] (-1332.989) * [-1328.808] (-1361.719) (-1346.456) (-1340.638) -- 0:02:39
      379000 -- (-1340.891) (-1348.769) (-1344.301) [-1310.740] * (-1330.616) (-1346.490) (-1342.032) [-1330.379] -- 0:02:38
      379500 -- (-1336.937) (-1348.312) (-1341.437) [-1326.198] * [-1343.911] (-1342.895) (-1348.023) (-1345.840) -- 0:02:38
      380000 -- (-1343.891) (-1348.675) (-1340.615) [-1339.421] * (-1358.093) (-1344.536) [-1341.588] (-1342.672) -- 0:02:38

      Average standard deviation of split frequencies: 0.013752

      380500 -- [-1336.766] (-1347.729) (-1341.400) (-1343.043) * (-1344.406) (-1341.375) (-1353.725) [-1339.415] -- 0:02:39
      381000 -- (-1349.541) (-1356.362) (-1330.880) [-1331.043] * (-1336.387) (-1331.887) (-1337.909) [-1313.917] -- 0:02:39
      381500 -- (-1333.584) (-1346.081) [-1334.680] (-1338.791) * (-1336.500) (-1344.684) (-1340.273) [-1319.023] -- 0:02:38
      382000 -- [-1335.519] (-1350.752) (-1345.205) (-1354.618) * [-1330.704] (-1343.751) (-1348.394) (-1321.010) -- 0:02:38
      382500 -- [-1341.576] (-1340.444) (-1339.174) (-1350.699) * (-1338.635) (-1346.127) (-1336.427) [-1322.519] -- 0:02:38
      383000 -- (-1341.823) (-1344.896) [-1334.699] (-1339.705) * (-1341.356) (-1341.145) (-1349.853) [-1337.462] -- 0:02:37
      383500 -- (-1346.240) (-1345.030) (-1346.118) [-1334.459] * (-1341.411) (-1340.255) (-1338.615) [-1330.441] -- 0:02:37
      384000 -- (-1354.511) (-1347.531) (-1347.414) [-1344.886] * (-1336.100) (-1337.411) (-1353.774) [-1328.951] -- 0:02:37
      384500 -- (-1362.829) (-1327.541) [-1327.905] (-1334.663) * (-1344.673) [-1328.072] (-1341.425) (-1338.669) -- 0:02:38
      385000 -- (-1340.056) (-1330.166) [-1333.653] (-1347.653) * (-1306.152) (-1350.349) (-1346.550) [-1335.661] -- 0:02:38

      Average standard deviation of split frequencies: 0.013434

      385500 -- (-1339.240) (-1330.453) [-1327.627] (-1342.038) * [-1322.606] (-1330.528) (-1340.809) (-1352.828) -- 0:02:37
      386000 -- (-1345.446) (-1329.470) [-1320.485] (-1337.566) * (-1333.941) (-1339.426) [-1339.731] (-1345.985) -- 0:02:37
      386500 -- (-1346.445) [-1328.231] (-1335.504) (-1350.052) * (-1349.786) [-1337.523] (-1328.036) (-1344.787) -- 0:02:37
      387000 -- (-1345.857) [-1329.842] (-1340.777) (-1353.230) * (-1345.934) (-1337.738) (-1350.605) [-1344.256] -- 0:02:36
      387500 -- [-1330.715] (-1344.548) (-1334.198) (-1349.934) * (-1344.181) (-1344.311) [-1331.949] (-1349.529) -- 0:02:36
      388000 -- [-1332.038] (-1349.219) (-1351.724) (-1345.480) * (-1352.444) [-1338.975] (-1334.656) (-1343.925) -- 0:02:36
      388500 -- [-1342.555] (-1339.220) (-1348.080) (-1343.650) * (-1345.406) (-1340.889) [-1325.838] (-1341.730) -- 0:02:37
      389000 -- (-1332.390) (-1354.780) [-1338.073] (-1346.160) * (-1350.796) (-1337.576) [-1330.909] (-1343.766) -- 0:02:37
      389500 -- [-1328.396] (-1346.154) (-1333.497) (-1350.264) * (-1338.387) [-1323.450] (-1342.223) (-1339.940) -- 0:02:36
      390000 -- [-1326.342] (-1351.836) (-1345.429) (-1352.462) * (-1344.646) (-1331.906) (-1340.968) [-1332.396] -- 0:02:36

      Average standard deviation of split frequencies: 0.013810

      390500 -- (-1335.725) [-1343.440] (-1345.824) (-1346.667) * (-1345.342) [-1330.742] (-1352.715) (-1349.735) -- 0:02:36
      391000 -- [-1334.716] (-1341.123) (-1343.472) (-1344.972) * (-1352.075) (-1340.907) (-1344.933) [-1344.280] -- 0:02:35
      391500 -- (-1326.158) [-1331.934] (-1348.669) (-1344.300) * (-1346.974) (-1342.268) [-1342.976] (-1344.413) -- 0:02:35
      392000 -- [-1324.140] (-1323.282) (-1348.357) (-1352.574) * (-1341.074) (-1331.596) [-1339.813] (-1338.449) -- 0:02:35
      392500 -- (-1328.828) (-1340.237) [-1332.662] (-1362.707) * (-1343.701) [-1326.669] (-1349.403) (-1345.660) -- 0:02:36
      393000 -- (-1342.064) [-1337.935] (-1340.647) (-1352.228) * [-1326.381] (-1339.500) (-1343.615) (-1347.056) -- 0:02:35
      393500 -- (-1341.980) (-1338.705) [-1323.544] (-1352.318) * [-1331.885] (-1348.515) (-1346.504) (-1342.098) -- 0:02:35
      394000 -- (-1345.820) (-1331.134) [-1334.532] (-1339.415) * (-1334.611) [-1319.237] (-1349.683) (-1356.087) -- 0:02:35
      394500 -- (-1344.373) (-1345.120) [-1337.441] (-1344.650) * (-1342.375) [-1341.516] (-1342.932) (-1347.048) -- 0:02:35
      395000 -- (-1343.347) (-1356.341) (-1333.071) [-1340.875] * (-1339.462) [-1331.800] (-1341.298) (-1359.259) -- 0:02:34

      Average standard deviation of split frequencies: 0.012896

      395500 -- (-1349.029) [-1334.990] (-1337.392) (-1343.643) * (-1343.033) [-1329.434] (-1343.606) (-1344.407) -- 0:02:34
      396000 -- (-1345.473) (-1337.851) [-1340.468] (-1345.378) * (-1336.805) [-1333.940] (-1341.645) (-1337.427) -- 0:02:34
      396500 -- (-1351.884) [-1331.239] (-1335.987) (-1350.577) * (-1342.413) [-1334.224] (-1337.417) (-1336.098) -- 0:02:35
      397000 -- (-1342.412) (-1345.742) (-1340.083) [-1336.143] * (-1351.817) (-1319.468) [-1342.192] (-1353.369) -- 0:02:34
      397500 -- (-1356.538) [-1331.411] (-1338.903) (-1340.560) * (-1348.235) [-1321.344] (-1342.879) (-1348.050) -- 0:02:34
      398000 -- (-1342.240) [-1322.663] (-1347.919) (-1347.584) * (-1341.680) (-1340.794) [-1338.050] (-1352.982) -- 0:02:34
      398500 -- [-1336.739] (-1313.318) (-1338.073) (-1360.194) * (-1357.791) (-1341.885) [-1335.060] (-1339.192) -- 0:02:33
      399000 -- (-1348.200) (-1316.777) (-1339.239) [-1335.331] * (-1344.900) (-1352.908) (-1338.003) [-1346.434] -- 0:02:33
      399500 -- (-1337.559) [-1324.257] (-1340.807) (-1359.963) * (-1350.433) (-1354.947) [-1331.096] (-1339.196) -- 0:02:33
      400000 -- [-1319.945] (-1341.116) (-1335.409) (-1351.713) * (-1346.862) [-1346.598] (-1338.435) (-1344.064) -- 0:02:34

      Average standard deviation of split frequencies: 0.014119

      400500 -- [-1316.797] (-1349.613) (-1340.374) (-1347.802) * (-1337.368) (-1334.450) [-1341.530] (-1344.931) -- 0:02:34
      401000 -- [-1317.940] (-1343.554) (-1339.893) (-1340.316) * (-1344.950) (-1351.042) [-1338.101] (-1339.561) -- 0:02:33
      401500 -- [-1322.700] (-1341.786) (-1341.765) (-1339.684) * (-1345.908) [-1329.393] (-1330.778) (-1338.238) -- 0:02:33
      402000 -- [-1322.294] (-1356.870) (-1340.560) (-1341.676) * (-1347.946) (-1337.181) [-1340.788] (-1336.638) -- 0:02:33
      402500 -- (-1347.051) (-1347.709) [-1333.170] (-1356.027) * (-1348.962) (-1335.096) (-1343.526) [-1328.292] -- 0:02:32
      403000 -- (-1336.342) (-1335.681) [-1332.891] (-1351.287) * (-1336.932) (-1345.025) (-1351.114) [-1343.390] -- 0:02:32
      403500 -- [-1325.358] (-1337.321) (-1349.666) (-1351.514) * [-1337.100] (-1331.728) (-1350.984) (-1341.779) -- 0:02:32
      404000 -- (-1340.684) [-1343.978] (-1332.466) (-1340.556) * (-1339.901) (-1340.748) [-1330.496] (-1349.131) -- 0:02:33
      404500 -- [-1343.688] (-1335.572) (-1347.675) (-1345.808) * (-1349.389) (-1339.274) [-1324.400] (-1352.931) -- 0:02:33
      405000 -- (-1347.355) [-1325.322] (-1342.672) (-1345.090) * (-1341.772) (-1337.311) [-1319.687] (-1344.155) -- 0:02:32

      Average standard deviation of split frequencies: 0.014127

      405500 -- (-1339.260) [-1329.960] (-1343.421) (-1342.429) * (-1344.078) (-1342.070) [-1338.129] (-1338.884) -- 0:02:32
      406000 -- [-1342.409] (-1345.140) (-1322.916) (-1363.853) * (-1338.041) (-1351.361) [-1321.699] (-1341.419) -- 0:02:32
      406500 -- (-1350.181) (-1335.542) [-1324.331] (-1346.956) * (-1340.567) (-1353.650) [-1320.487] (-1346.003) -- 0:02:31
      407000 -- (-1345.612) (-1340.842) [-1337.991] (-1346.281) * (-1344.178) (-1343.383) [-1317.480] (-1345.936) -- 0:02:31
      407500 -- (-1339.746) (-1344.224) [-1331.575] (-1348.201) * (-1345.645) (-1341.006) [-1337.181] (-1346.559) -- 0:02:31
      408000 -- (-1335.588) (-1345.359) (-1336.130) [-1330.171] * (-1344.590) [-1325.414] (-1342.655) (-1335.600) -- 0:02:32
      408500 -- (-1349.426) (-1347.064) [-1333.526] (-1322.509) * (-1350.376) [-1332.566] (-1348.470) (-1352.104) -- 0:02:32
      409000 -- (-1344.852) (-1343.345) [-1329.261] (-1334.222) * (-1348.001) [-1329.624] (-1339.456) (-1344.922) -- 0:02:31
      409500 -- (-1336.948) (-1349.183) [-1328.258] (-1354.594) * (-1355.986) (-1353.572) [-1328.842] (-1342.806) -- 0:02:31
      410000 -- [-1336.590] (-1330.464) (-1339.123) (-1341.104) * (-1344.416) (-1344.935) [-1330.833] (-1337.954) -- 0:02:31

      Average standard deviation of split frequencies: 0.013520

      410500 -- [-1336.869] (-1343.743) (-1348.352) (-1342.079) * (-1349.176) (-1344.066) [-1338.005] (-1346.261) -- 0:02:30
      411000 -- (-1341.317) (-1350.847) (-1348.880) [-1325.328] * (-1350.133) (-1342.447) (-1328.858) [-1338.991] -- 0:02:30
      411500 -- (-1347.670) (-1343.013) (-1342.294) [-1337.733] * (-1341.519) (-1342.058) [-1324.666] (-1337.817) -- 0:02:30
      412000 -- (-1349.161) (-1356.008) (-1345.164) [-1326.705] * (-1341.606) (-1340.107) [-1323.835] (-1339.144) -- 0:02:31
      412500 -- (-1347.120) (-1341.264) (-1341.954) [-1329.684] * (-1348.887) (-1343.733) [-1322.675] (-1348.965) -- 0:02:30
      413000 -- [-1339.343] (-1344.862) (-1345.637) (-1343.377) * (-1355.414) (-1338.637) [-1313.927] (-1339.299) -- 0:02:30
      413500 -- [-1328.234] (-1353.464) (-1338.293) (-1339.501) * (-1339.875) (-1345.907) [-1313.192] (-1337.507) -- 0:02:30
      414000 -- [-1325.538] (-1345.625) (-1350.926) (-1346.124) * (-1339.210) [-1342.664] (-1332.511) (-1336.751) -- 0:02:30
      414500 -- (-1332.303) (-1340.854) [-1342.716] (-1346.358) * (-1356.778) (-1338.358) [-1339.186] (-1344.781) -- 0:02:29
      415000 -- [-1322.022] (-1340.182) (-1332.665) (-1342.238) * (-1356.628) (-1324.350) [-1333.648] (-1350.975) -- 0:02:29

      Average standard deviation of split frequencies: 0.012048

      415500 -- (-1345.893) (-1332.588) [-1337.378] (-1340.426) * [-1342.342] (-1334.139) (-1335.401) (-1347.806) -- 0:02:29
      416000 -- (-1340.702) (-1345.920) (-1347.804) [-1342.756] * (-1343.153) [-1342.878] (-1344.194) (-1354.160) -- 0:02:30
      416500 -- (-1348.080) (-1338.489) (-1348.715) [-1340.349] * (-1360.448) (-1337.617) [-1343.078] (-1348.013) -- 0:02:29
      417000 -- (-1354.812) (-1349.716) [-1349.058] (-1346.416) * (-1340.474) [-1330.762] (-1348.310) (-1342.035) -- 0:02:29
      417500 -- (-1352.602) (-1342.255) [-1339.173] (-1337.164) * (-1342.926) [-1338.019] (-1354.693) (-1336.550) -- 0:02:29
      418000 -- (-1349.481) [-1342.213] (-1347.527) (-1346.438) * (-1339.521) [-1324.662] (-1360.966) (-1336.986) -- 0:02:28
      418500 -- (-1344.818) (-1356.410) [-1335.856] (-1338.778) * (-1344.056) (-1333.068) (-1343.699) [-1320.360] -- 0:02:28
      419000 -- (-1342.684) (-1343.264) (-1346.428) [-1345.576] * (-1340.393) (-1333.311) (-1347.746) [-1330.955] -- 0:02:28
      419500 -- [-1338.706] (-1348.516) (-1338.298) (-1350.215) * (-1335.047) [-1336.749] (-1350.331) (-1338.503) -- 0:02:28
      420000 -- (-1348.424) (-1344.725) [-1325.148] (-1342.323) * (-1334.586) [-1334.070] (-1354.831) (-1345.213) -- 0:02:29

      Average standard deviation of split frequencies: 0.012150

      420500 -- (-1342.827) (-1350.764) (-1341.472) [-1328.991] * [-1316.301] (-1338.976) (-1360.843) (-1351.187) -- 0:02:28
      421000 -- (-1344.047) (-1340.224) (-1340.959) [-1335.678] * [-1324.870] (-1346.597) (-1343.191) (-1347.255) -- 0:02:28
      421500 -- [-1345.773] (-1342.018) (-1338.790) (-1342.605) * [-1316.925] (-1344.932) (-1342.552) (-1338.316) -- 0:02:28
      422000 -- (-1341.067) (-1343.026) [-1337.541] (-1352.394) * [-1308.757] (-1341.724) (-1343.778) (-1354.888) -- 0:02:27
      422500 -- (-1346.461) (-1345.729) (-1350.831) [-1347.236] * [-1322.464] (-1345.765) (-1349.567) (-1344.507) -- 0:02:27
      423000 -- (-1346.416) (-1337.938) (-1346.434) [-1335.595] * [-1334.478] (-1350.214) (-1348.288) (-1336.032) -- 0:02:27
      423500 -- (-1352.498) (-1343.558) (-1355.736) [-1336.580] * [-1317.986] (-1349.852) (-1350.294) (-1354.423) -- 0:02:28
      424000 -- (-1346.434) (-1344.554) (-1348.543) [-1332.599] * [-1343.988] (-1336.044) (-1347.965) (-1345.380) -- 0:02:28
      424500 -- (-1350.119) (-1343.333) [-1333.767] (-1341.223) * (-1342.352) [-1314.173] (-1341.088) (-1347.699) -- 0:02:27
      425000 -- (-1347.572) (-1340.447) [-1345.713] (-1341.000) * (-1349.303) [-1331.835] (-1345.217) (-1337.369) -- 0:02:27

      Average standard deviation of split frequencies: 0.013163

      425500 -- (-1352.766) [-1338.429] (-1352.166) (-1341.772) * (-1346.053) (-1335.166) (-1345.215) [-1309.731] -- 0:02:27
      426000 -- (-1338.084) [-1335.165] (-1337.678) (-1339.037) * [-1324.448] (-1334.906) (-1345.700) (-1341.088) -- 0:02:26
      426500 -- (-1343.293) (-1344.423) [-1343.769] (-1355.490) * (-1338.784) (-1341.962) (-1354.265) [-1323.414] -- 0:02:26
      427000 -- (-1335.397) (-1349.404) [-1342.362] (-1361.408) * (-1344.350) (-1340.587) (-1344.935) [-1326.739] -- 0:02:26
      427500 -- [-1331.582] (-1347.126) (-1350.496) (-1345.860) * (-1345.914) (-1333.572) (-1347.024) [-1321.996] -- 0:02:27
      428000 -- [-1341.071] (-1347.393) (-1341.235) (-1349.445) * (-1343.916) (-1351.154) (-1352.406) [-1320.180] -- 0:02:27
      428500 -- (-1344.024) [-1333.704] (-1345.559) (-1353.996) * (-1329.952) (-1333.002) (-1347.233) [-1317.779] -- 0:02:26
      429000 -- (-1348.684) (-1342.433) [-1344.936] (-1348.308) * (-1339.770) (-1341.313) (-1349.347) [-1330.986] -- 0:02:26
      429500 -- [-1340.874] (-1339.682) (-1341.651) (-1349.718) * (-1339.254) (-1343.510) (-1358.474) [-1337.467] -- 0:02:26
      430000 -- [-1322.670] (-1348.933) (-1346.831) (-1350.868) * (-1331.818) [-1338.361] (-1358.505) (-1355.223) -- 0:02:25

      Average standard deviation of split frequencies: 0.013596

      430500 -- [-1326.000] (-1332.365) (-1346.047) (-1349.177) * (-1341.985) [-1343.290] (-1352.291) (-1341.288) -- 0:02:25
      431000 -- [-1338.450] (-1340.159) (-1350.855) (-1338.992) * (-1346.912) [-1325.083] (-1346.604) (-1347.251) -- 0:02:25
      431500 -- (-1340.807) [-1348.678] (-1342.832) (-1343.059) * (-1340.880) [-1331.602] (-1339.421) (-1347.465) -- 0:02:26
      432000 -- (-1339.786) (-1336.463) (-1337.379) [-1340.001] * (-1344.442) [-1337.667] (-1332.867) (-1352.107) -- 0:02:25
      432500 -- (-1352.279) (-1335.895) (-1344.372) [-1337.818] * [-1335.489] (-1328.190) (-1330.024) (-1346.734) -- 0:02:25
      433000 -- (-1345.695) [-1314.760] (-1336.455) (-1345.206) * (-1343.562) (-1334.662) [-1326.706] (-1345.852) -- 0:02:25
      433500 -- (-1352.862) [-1318.356] (-1351.085) (-1352.770) * (-1354.737) [-1332.798] (-1326.540) (-1348.674) -- 0:02:25
      434000 -- [-1344.018] (-1344.630) (-1341.528) (-1333.840) * (-1352.262) [-1345.497] (-1337.149) (-1357.744) -- 0:02:24
      434500 -- [-1322.167] (-1335.088) (-1349.903) (-1341.131) * [-1329.708] (-1347.211) (-1342.959) (-1341.383) -- 0:02:24
      435000 -- (-1352.079) (-1346.489) (-1353.532) [-1342.240] * [-1311.219] (-1345.911) (-1348.930) (-1348.527) -- 0:02:24

      Average standard deviation of split frequencies: 0.014454

      435500 -- (-1345.043) (-1347.304) [-1346.073] (-1352.674) * [-1313.212] (-1341.465) (-1355.937) (-1349.086) -- 0:02:25
      436000 -- (-1337.273) (-1355.546) (-1349.088) [-1334.199] * (-1335.110) (-1339.582) (-1351.308) [-1340.251] -- 0:02:24
      436500 -- (-1336.011) [-1333.037] (-1352.871) (-1348.506) * (-1343.383) (-1347.155) (-1342.919) [-1321.743] -- 0:02:24
      437000 -- [-1338.458] (-1339.225) (-1348.639) (-1338.818) * [-1331.770] (-1344.621) (-1343.950) (-1342.783) -- 0:02:24
      437500 -- (-1346.705) (-1345.542) (-1334.380) [-1340.956] * (-1324.205) (-1339.736) [-1334.191] (-1349.090) -- 0:02:24
      438000 -- (-1341.144) (-1343.148) [-1328.353] (-1349.589) * (-1345.102) (-1331.858) (-1344.991) [-1339.186] -- 0:02:23
      438500 -- (-1345.699) (-1340.310) [-1328.475] (-1349.797) * (-1350.796) (-1341.415) [-1317.653] (-1340.897) -- 0:02:23
      439000 -- (-1344.201) (-1340.582) [-1318.718] (-1336.238) * (-1345.910) (-1335.834) [-1318.012] (-1338.078) -- 0:02:24
      439500 -- (-1341.312) (-1338.881) [-1319.552] (-1343.618) * (-1363.289) (-1338.354) (-1346.039) [-1338.846] -- 0:02:24
      440000 -- (-1336.834) (-1344.542) (-1342.070) [-1323.817] * (-1339.569) (-1345.700) (-1342.501) [-1335.142] -- 0:02:23

      Average standard deviation of split frequencies: 0.013400

      440500 -- (-1337.960) (-1343.665) (-1339.182) [-1320.055] * (-1342.792) (-1341.469) (-1344.764) [-1331.888] -- 0:02:23
      441000 -- (-1339.345) (-1341.844) (-1347.091) [-1324.064] * [-1341.552] (-1327.184) (-1355.823) (-1340.397) -- 0:02:23
      441500 -- (-1340.205) (-1344.087) [-1324.337] (-1352.964) * (-1339.671) (-1339.812) (-1342.517) [-1345.018] -- 0:02:22
      442000 -- (-1348.416) (-1345.639) [-1335.855] (-1347.441) * [-1336.739] (-1340.147) (-1342.526) (-1345.040) -- 0:02:22
      442500 -- [-1340.217] (-1349.050) (-1337.562) (-1343.885) * (-1333.294) [-1351.788] (-1342.846) (-1350.584) -- 0:02:22
      443000 -- (-1343.892) (-1354.544) [-1319.666] (-1349.457) * [-1332.677] (-1341.570) (-1341.237) (-1349.426) -- 0:02:23
      443500 -- (-1350.123) (-1343.584) [-1328.205] (-1333.027) * [-1332.376] (-1348.939) (-1348.472) (-1348.622) -- 0:02:23
      444000 -- (-1341.387) (-1346.199) (-1341.024) [-1336.726] * [-1336.944] (-1355.629) (-1344.459) (-1344.806) -- 0:02:22
      444500 -- [-1339.806] (-1340.061) (-1340.386) (-1335.209) * [-1322.223] (-1345.477) (-1348.455) (-1351.834) -- 0:02:22
      445000 -- (-1347.602) [-1343.095] (-1350.182) (-1338.782) * (-1328.514) (-1355.159) (-1346.531) [-1343.464] -- 0:02:22

      Average standard deviation of split frequencies: 0.013240

      445500 -- [-1337.625] (-1346.317) (-1350.954) (-1338.158) * (-1331.807) [-1339.476] (-1359.427) (-1352.155) -- 0:02:21
      446000 -- (-1338.581) (-1363.382) (-1351.464) [-1333.332] * [-1330.364] (-1338.748) (-1349.732) (-1339.954) -- 0:02:21
      446500 -- [-1345.729] (-1343.489) (-1347.395) (-1345.242) * [-1331.263] (-1352.962) (-1344.150) (-1344.768) -- 0:02:21
      447000 -- (-1347.041) (-1339.816) [-1334.476] (-1340.246) * (-1346.164) (-1348.696) (-1342.429) [-1329.414] -- 0:02:22
      447500 -- (-1340.563) (-1342.996) (-1345.378) [-1347.528] * (-1349.477) (-1351.487) (-1345.909) [-1333.125] -- 0:02:21
      448000 -- (-1338.590) (-1352.312) [-1346.246] (-1345.615) * (-1355.167) (-1345.206) (-1334.508) [-1345.210] -- 0:02:21
      448500 -- [-1341.684] (-1342.053) (-1347.634) (-1346.890) * [-1337.562] (-1360.711) (-1333.937) (-1342.809) -- 0:02:21
      449000 -- [-1329.969] (-1347.972) (-1331.478) (-1336.398) * (-1346.066) (-1342.121) [-1337.144] (-1329.871) -- 0:02:21
      449500 -- [-1305.246] (-1337.674) (-1341.844) (-1338.308) * (-1337.211) (-1355.735) [-1336.299] (-1338.903) -- 0:02:20
      450000 -- [-1323.985] (-1338.067) (-1345.672) (-1348.150) * (-1341.738) [-1341.956] (-1344.027) (-1342.476) -- 0:02:20

      Average standard deviation of split frequencies: 0.013598

      450500 -- [-1324.545] (-1342.126) (-1334.757) (-1346.527) * (-1340.456) (-1343.524) [-1340.671] (-1336.945) -- 0:02:20
      451000 -- (-1347.202) [-1330.688] (-1345.193) (-1339.536) * [-1336.258] (-1350.222) (-1323.618) (-1344.062) -- 0:02:21
      451500 -- (-1341.023) (-1339.953) (-1348.846) [-1342.866] * (-1346.884) (-1347.504) [-1334.921] (-1336.184) -- 0:02:20
      452000 -- (-1348.987) [-1307.966] (-1337.738) (-1335.945) * (-1342.552) (-1343.571) [-1322.516] (-1349.762) -- 0:02:20
      452500 -- (-1345.532) [-1313.595] (-1343.107) (-1337.570) * (-1332.445) (-1345.226) [-1321.519] (-1335.899) -- 0:02:20
      453000 -- (-1344.148) [-1314.560] (-1351.896) (-1339.697) * (-1326.238) (-1340.789) [-1342.489] (-1356.661) -- 0:02:20
      453500 -- (-1363.149) [-1335.524] (-1341.070) (-1344.657) * (-1345.758) (-1349.523) [-1338.516] (-1336.741) -- 0:02:19
      454000 -- (-1354.380) [-1327.763] (-1337.933) (-1340.515) * (-1354.007) (-1344.536) [-1337.285] (-1348.632) -- 0:02:19
      454500 -- (-1346.513) [-1321.687] (-1350.934) (-1333.398) * (-1348.722) [-1325.903] (-1352.865) (-1350.432) -- 0:02:19
      455000 -- [-1328.026] (-1336.399) (-1349.137) (-1344.156) * (-1331.146) [-1325.266] (-1344.049) (-1344.623) -- 0:02:20

      Average standard deviation of split frequencies: 0.013841

      455500 -- [-1325.595] (-1326.598) (-1349.854) (-1341.557) * [-1342.329] (-1323.640) (-1346.797) (-1350.759) -- 0:02:19
      456000 -- (-1332.643) (-1331.198) (-1344.677) [-1328.878] * (-1352.066) [-1322.412] (-1340.363) (-1354.708) -- 0:02:19
      456500 -- (-1347.286) (-1336.741) [-1338.706] (-1340.318) * (-1341.628) [-1326.535] (-1344.750) (-1349.539) -- 0:02:19
      457000 -- [-1339.408] (-1343.501) (-1341.330) (-1351.425) * (-1341.551) [-1344.044] (-1342.672) (-1343.822) -- 0:02:19
      457500 -- (-1337.731) [-1329.524] (-1340.149) (-1347.110) * (-1349.597) [-1340.993] (-1345.761) (-1344.446) -- 0:02:18
      458000 -- [-1324.550] (-1340.045) (-1344.280) (-1347.600) * (-1339.880) [-1333.353] (-1343.093) (-1352.054) -- 0:02:18
      458500 -- [-1323.732] (-1340.703) (-1347.010) (-1350.875) * (-1337.969) [-1338.162] (-1344.836) (-1353.694) -- 0:02:18
      459000 -- (-1348.885) (-1333.448) [-1317.609] (-1327.075) * (-1347.472) (-1332.321) [-1338.911] (-1355.198) -- 0:02:19
      459500 -- (-1340.642) (-1339.107) [-1326.303] (-1340.004) * (-1340.498) [-1338.232] (-1336.057) (-1352.181) -- 0:02:18
      460000 -- (-1359.319) [-1329.066] (-1337.488) (-1330.252) * (-1337.225) (-1339.489) [-1334.396] (-1343.443) -- 0:02:18

      Average standard deviation of split frequencies: 0.012740

      460500 -- (-1349.662) [-1324.216] (-1343.375) (-1343.714) * (-1339.714) [-1332.191] (-1335.617) (-1349.304) -- 0:02:18
      461000 -- (-1343.332) [-1324.889] (-1346.087) (-1341.316) * (-1336.007) [-1330.345] (-1349.067) (-1350.363) -- 0:02:17
      461500 -- [-1320.346] (-1353.220) (-1342.865) (-1330.519) * (-1333.862) [-1322.316] (-1349.698) (-1360.450) -- 0:02:17
      462000 -- (-1351.978) (-1331.785) (-1334.608) [-1325.455] * (-1342.081) [-1323.868] (-1346.650) (-1345.543) -- 0:02:17
      462500 -- (-1338.581) (-1349.551) (-1346.402) [-1331.663] * (-1350.651) (-1340.194) (-1344.718) [-1341.672] -- 0:02:17
      463000 -- (-1341.350) [-1337.100] (-1358.167) (-1336.257) * (-1351.411) [-1326.262] (-1343.099) (-1347.840) -- 0:02:18
      463500 -- (-1343.500) (-1351.023) [-1322.476] (-1344.973) * (-1345.512) [-1341.227] (-1356.018) (-1347.183) -- 0:02:17
      464000 -- (-1336.379) (-1350.638) (-1327.381) [-1327.918] * (-1355.103) (-1341.410) [-1341.307] (-1340.717) -- 0:02:17
      464500 -- (-1341.462) [-1344.602] (-1342.836) (-1350.620) * (-1343.591) (-1351.414) [-1337.427] (-1343.186) -- 0:02:17
      465000 -- (-1325.142) (-1361.352) [-1328.378] (-1350.115) * [-1320.590] (-1346.633) (-1335.356) (-1349.849) -- 0:02:16

      Average standard deviation of split frequencies: 0.011886

      465500 -- (-1341.011) [-1340.317] (-1331.731) (-1344.030) * (-1326.091) (-1342.284) [-1338.601] (-1348.939) -- 0:02:16
      466000 -- (-1324.854) [-1313.500] (-1348.334) (-1339.556) * [-1333.844] (-1341.483) (-1330.931) (-1345.503) -- 0:02:16
      466500 -- (-1357.254) [-1306.326] (-1339.926) (-1340.408) * (-1335.717) (-1346.836) (-1334.946) [-1339.139] -- 0:02:16
      467000 -- (-1337.398) (-1335.098) [-1334.998] (-1344.174) * (-1345.346) (-1347.816) (-1349.263) [-1330.964] -- 0:02:16
      467500 -- (-1347.090) (-1339.099) (-1337.256) [-1339.804] * (-1338.857) (-1353.134) (-1348.168) [-1341.963] -- 0:02:16
      468000 -- (-1336.579) (-1340.189) [-1339.014] (-1343.419) * (-1352.779) (-1342.177) [-1333.028] (-1350.195) -- 0:02:16
      468500 -- (-1340.311) (-1341.626) [-1326.978] (-1346.393) * (-1351.059) (-1354.718) (-1337.220) [-1334.700] -- 0:02:16
      469000 -- (-1362.388) (-1328.262) [-1323.749] (-1338.110) * (-1341.830) (-1342.272) (-1336.526) [-1334.502] -- 0:02:15
      469500 -- (-1348.707) (-1343.303) (-1340.458) [-1335.864] * (-1345.744) (-1343.870) (-1346.003) [-1332.633] -- 0:02:15
      470000 -- [-1344.482] (-1345.996) (-1344.385) (-1345.528) * (-1355.414) (-1344.765) (-1343.317) [-1336.492] -- 0:02:15

      Average standard deviation of split frequencies: 0.012388

      470500 -- (-1347.887) [-1337.958] (-1345.722) (-1338.710) * (-1349.417) (-1350.826) [-1340.244] (-1342.191) -- 0:02:16
      471000 -- (-1348.750) [-1332.493] (-1348.571) (-1346.011) * (-1340.393) (-1342.083) [-1335.176] (-1345.057) -- 0:02:15
      471500 -- (-1345.492) [-1332.184] (-1341.123) (-1345.669) * (-1345.942) [-1338.908] (-1352.876) (-1345.105) -- 0:02:15
      472000 -- (-1341.349) [-1328.706] (-1355.663) (-1337.682) * (-1346.915) [-1329.429] (-1349.062) (-1336.434) -- 0:02:15
      472500 -- (-1348.959) (-1330.271) [-1325.472] (-1351.170) * (-1344.560) (-1342.692) (-1346.633) [-1321.904] -- 0:02:15
      473000 -- (-1337.895) [-1335.258] (-1337.980) (-1349.085) * (-1339.706) [-1330.781] (-1354.783) (-1336.812) -- 0:02:14
      473500 -- [-1326.801] (-1349.471) (-1343.549) (-1341.281) * (-1341.501) (-1347.014) [-1335.839] (-1339.202) -- 0:02:14
      474000 -- [-1338.179] (-1341.214) (-1356.159) (-1340.966) * (-1346.089) (-1341.480) (-1345.342) [-1328.258] -- 0:02:14
      474500 -- [-1344.242] (-1344.286) (-1347.567) (-1343.989) * (-1350.031) (-1337.254) (-1347.797) [-1318.932] -- 0:02:15
      475000 -- (-1340.719) (-1350.715) (-1347.696) [-1344.609] * (-1341.620) (-1347.083) (-1338.043) [-1321.267] -- 0:02:14

      Average standard deviation of split frequencies: 0.011994

      475500 -- (-1351.772) (-1349.444) (-1348.423) [-1312.651] * (-1339.629) (-1344.003) (-1355.181) [-1319.954] -- 0:02:14
      476000 -- (-1343.037) (-1356.413) (-1334.636) [-1323.544] * (-1345.718) [-1335.891] (-1344.030) (-1339.904) -- 0:02:14
      476500 -- [-1330.177] (-1354.464) (-1333.421) (-1340.423) * (-1350.399) (-1348.947) [-1342.533] (-1351.175) -- 0:02:14
      477000 -- [-1334.253] (-1339.936) (-1351.368) (-1326.745) * (-1344.369) (-1332.434) (-1343.763) [-1323.783] -- 0:02:13
      477500 -- (-1314.601) (-1340.560) (-1351.167) [-1323.273] * (-1338.755) (-1345.053) (-1343.579) [-1323.020] -- 0:02:13
      478000 -- [-1311.617] (-1327.623) (-1345.751) (-1332.612) * (-1338.239) (-1345.585) (-1344.537) [-1338.432] -- 0:02:13
      478500 -- (-1329.502) (-1334.951) [-1326.959] (-1344.019) * [-1324.530] (-1345.111) (-1343.221) (-1350.429) -- 0:02:14
      479000 -- [-1309.142] (-1339.337) (-1338.265) (-1343.412) * [-1323.689] (-1349.962) (-1346.460) (-1339.216) -- 0:02:13
      479500 -- (-1333.503) (-1343.074) (-1339.130) [-1335.876] * (-1329.014) [-1339.434] (-1341.579) (-1332.527) -- 0:02:13
      480000 -- [-1340.808] (-1347.275) (-1345.418) (-1334.117) * [-1329.464] (-1330.166) (-1344.071) (-1349.356) -- 0:02:13

      Average standard deviation of split frequencies: 0.011562

      480500 -- (-1351.024) (-1340.404) (-1356.353) [-1323.529] * [-1350.491] (-1341.751) (-1343.696) (-1334.825) -- 0:02:12
      481000 -- [-1342.287] (-1349.182) (-1342.657) (-1344.709) * [-1334.384] (-1347.426) (-1344.966) (-1323.066) -- 0:02:12
      481500 -- (-1345.787) [-1337.999] (-1326.325) (-1345.679) * (-1332.462) (-1348.260) (-1345.778) [-1320.268] -- 0:02:12
      482000 -- (-1362.478) (-1351.267) (-1343.798) [-1340.853] * [-1334.508] (-1348.624) (-1353.302) (-1345.407) -- 0:02:12
      482500 -- (-1347.606) (-1355.025) [-1335.504] (-1344.759) * (-1327.042) (-1347.343) (-1340.647) [-1330.690] -- 0:02:12
      483000 -- (-1345.726) (-1336.498) (-1351.999) [-1327.642] * [-1327.238] (-1346.677) (-1349.856) (-1339.021) -- 0:02:12
      483500 -- (-1337.981) [-1325.284] (-1357.587) (-1337.286) * (-1346.339) (-1343.600) (-1346.221) [-1345.668] -- 0:02:12
      484000 -- (-1340.242) (-1335.725) (-1345.759) [-1334.220] * (-1344.842) (-1343.310) [-1338.300] (-1337.053) -- 0:02:12
      484500 -- (-1337.843) [-1325.057] (-1341.122) (-1349.715) * (-1341.114) (-1344.468) [-1336.090] (-1340.526) -- 0:02:11
      485000 -- (-1329.034) [-1328.968] (-1352.116) (-1342.210) * [-1334.327] (-1350.809) (-1346.017) (-1341.234) -- 0:02:11

      Average standard deviation of split frequencies: 0.011180

      485500 -- [-1336.176] (-1340.496) (-1338.652) (-1343.564) * (-1339.697) (-1342.393) [-1336.418] (-1342.898) -- 0:02:11
      486000 -- (-1343.661) (-1346.490) [-1342.810] (-1344.331) * (-1343.800) (-1346.564) [-1329.753] (-1351.524) -- 0:02:11
      486500 -- [-1334.700] (-1343.663) (-1338.397) (-1350.625) * (-1340.505) (-1348.449) [-1332.553] (-1352.796) -- 0:02:11
      487000 -- (-1341.224) [-1345.196] (-1347.282) (-1335.763) * (-1347.901) (-1347.111) [-1329.652] (-1338.390) -- 0:02:11
      487500 -- [-1321.259] (-1344.383) (-1354.240) (-1353.248) * (-1347.642) (-1345.383) [-1323.315] (-1332.044) -- 0:02:11
      488000 -- [-1320.858] (-1343.484) (-1358.176) (-1341.329) * (-1351.187) (-1343.097) [-1333.865] (-1328.817) -- 0:02:11
      488500 -- [-1318.586] (-1344.584) (-1341.713) (-1335.395) * (-1352.903) (-1340.507) [-1316.485] (-1336.899) -- 0:02:10
      489000 -- [-1339.263] (-1345.402) (-1346.782) (-1353.283) * (-1337.060) (-1340.137) (-1332.623) [-1339.627] -- 0:02:10
      489500 -- (-1333.910) (-1342.989) [-1335.884] (-1356.667) * (-1346.061) (-1344.160) (-1323.698) [-1338.565] -- 0:02:10
      490000 -- [-1337.319] (-1341.969) (-1339.740) (-1353.787) * (-1329.954) (-1343.509) [-1329.916] (-1333.661) -- 0:02:10

      Average standard deviation of split frequencies: 0.010973

      490500 -- [-1336.398] (-1348.625) (-1351.745) (-1333.003) * (-1340.903) (-1334.645) (-1336.136) [-1325.635] -- 0:02:10
      491000 -- (-1348.638) (-1337.308) (-1355.627) [-1340.749] * (-1337.953) (-1343.823) [-1333.132] (-1340.996) -- 0:02:10
      491500 -- (-1342.164) (-1339.690) (-1348.034) [-1333.941] * (-1352.891) (-1336.293) [-1320.718] (-1337.056) -- 0:02:10
      492000 -- (-1333.586) (-1346.597) (-1347.258) [-1327.790] * (-1345.912) (-1340.682) [-1316.435] (-1349.431) -- 0:02:10
      492500 -- (-1338.373) (-1345.551) (-1344.920) [-1333.525] * (-1333.794) (-1343.574) (-1350.548) [-1342.917] -- 0:02:09
      493000 -- (-1343.169) [-1334.494] (-1354.708) (-1333.308) * [-1313.679] (-1346.067) (-1351.529) (-1327.724) -- 0:02:09
      493500 -- (-1349.630) (-1338.720) [-1346.994] (-1344.326) * [-1323.129] (-1341.206) (-1346.520) (-1343.234) -- 0:02:09
      494000 -- (-1353.119) (-1343.956) (-1344.886) [-1339.931] * (-1344.593) (-1346.359) (-1335.378) [-1318.635] -- 0:02:10
      494500 -- [-1342.890] (-1351.511) (-1347.027) (-1350.663) * [-1349.372] (-1354.441) (-1343.188) (-1350.377) -- 0:02:09
      495000 -- (-1342.382) [-1330.223] (-1344.544) (-1354.472) * (-1353.609) [-1335.910] (-1347.214) (-1336.002) -- 0:02:09

      Average standard deviation of split frequencies: 0.011405

      495500 -- (-1349.019) (-1350.465) (-1352.868) [-1326.709] * (-1345.199) [-1337.813] (-1347.014) (-1334.489) -- 0:02:09
      496000 -- (-1338.060) (-1343.750) (-1349.635) [-1328.804] * (-1355.107) (-1334.788) (-1351.102) [-1336.749] -- 0:02:09
      496500 -- (-1344.900) [-1348.178] (-1336.300) (-1345.201) * (-1338.943) [-1339.364] (-1349.084) (-1344.448) -- 0:02:08
      497000 -- (-1340.405) [-1336.512] (-1350.621) (-1316.140) * (-1342.108) (-1345.506) (-1334.395) [-1329.486] -- 0:02:08
      497500 -- (-1350.551) (-1341.233) (-1348.547) [-1335.942] * [-1335.924] (-1341.922) (-1335.875) (-1345.832) -- 0:02:08
      498000 -- (-1345.386) [-1337.115] (-1346.418) (-1337.819) * [-1334.425] (-1343.679) (-1335.516) (-1341.396) -- 0:02:09
      498500 -- (-1337.008) [-1336.396] (-1343.673) (-1332.755) * (-1327.396) (-1335.651) [-1329.675] (-1340.072) -- 0:02:08
      499000 -- (-1338.038) (-1346.269) (-1343.807) [-1339.971] * (-1346.974) [-1348.465] (-1331.423) (-1355.147) -- 0:02:08
      499500 -- (-1350.058) (-1356.285) (-1349.280) [-1336.853] * [-1341.403] (-1345.411) (-1340.026) (-1341.781) -- 0:02:08
      500000 -- (-1345.713) (-1347.118) (-1344.399) [-1333.828] * (-1348.459) [-1333.176] (-1339.805) (-1341.699) -- 0:02:08

      Average standard deviation of split frequencies: 0.010828

      500500 -- (-1344.146) (-1350.506) [-1344.462] (-1325.997) * (-1345.432) (-1349.105) [-1337.549] (-1338.921) -- 0:02:07
      501000 -- (-1343.716) (-1345.944) (-1336.106) [-1326.314] * (-1351.113) [-1345.182] (-1333.476) (-1344.601) -- 0:02:07
      501500 -- (-1350.866) (-1338.424) (-1332.792) [-1319.027] * [-1343.819] (-1338.537) (-1344.624) (-1355.015) -- 0:02:07
      502000 -- (-1340.414) (-1344.292) [-1334.024] (-1328.361) * (-1356.564) (-1337.500) [-1338.595] (-1349.715) -- 0:02:07
      502500 -- (-1342.591) (-1341.357) [-1332.505] (-1340.750) * (-1349.538) (-1345.328) [-1333.852] (-1341.116) -- 0:02:07
      503000 -- (-1344.438) (-1335.583) [-1333.711] (-1341.094) * [-1323.372] (-1342.513) (-1338.117) (-1345.901) -- 0:02:07
      503500 -- (-1339.897) (-1347.678) [-1341.658] (-1332.573) * [-1329.668] (-1340.934) (-1340.587) (-1343.446) -- 0:02:07
      504000 -- [-1338.849] (-1347.614) (-1344.936) (-1337.684) * (-1335.995) (-1333.733) [-1333.712] (-1337.699) -- 0:02:06
      504500 -- (-1343.867) [-1338.070] (-1355.177) (-1345.237) * (-1335.794) (-1344.708) (-1334.549) [-1319.441] -- 0:02:06
      505000 -- (-1347.900) [-1338.201] (-1331.034) (-1340.069) * (-1335.475) (-1352.903) (-1338.705) [-1326.677] -- 0:02:06

      Average standard deviation of split frequencies: 0.010765

      505500 -- (-1355.526) (-1343.432) [-1345.009] (-1342.721) * (-1343.505) (-1341.876) (-1349.561) [-1316.530] -- 0:02:06
      506000 -- (-1344.466) [-1342.185] (-1352.396) (-1351.551) * (-1346.769) (-1336.397) [-1338.841] (-1331.685) -- 0:02:06
      506500 -- (-1336.615) (-1345.157) (-1344.866) [-1330.927] * (-1346.834) (-1346.952) (-1342.821) [-1323.178] -- 0:02:06
      507000 -- [-1337.820] (-1343.695) (-1345.646) (-1354.179) * (-1366.919) (-1339.579) (-1349.211) [-1320.133] -- 0:02:06
      507500 -- (-1333.526) (-1343.071) [-1334.941] (-1341.864) * (-1341.632) (-1337.606) (-1346.897) [-1317.434] -- 0:02:06
      508000 -- [-1330.396] (-1350.475) (-1339.477) (-1345.002) * (-1339.779) (-1332.035) (-1344.672) [-1321.616] -- 0:02:05
      508500 -- (-1340.613) [-1340.990] (-1347.942) (-1337.573) * (-1331.010) (-1341.877) (-1349.906) [-1322.414] -- 0:02:05
      509000 -- (-1345.079) (-1338.401) (-1349.882) [-1332.384] * (-1346.272) (-1354.812) [-1327.382] (-1338.034) -- 0:02:05
      509500 -- (-1331.154) (-1343.640) (-1348.358) [-1333.205] * (-1352.120) (-1330.685) [-1314.346] (-1341.813) -- 0:02:05
      510000 -- [-1336.284] (-1344.809) (-1338.120) (-1323.951) * (-1343.671) (-1332.271) [-1325.843] (-1343.217) -- 0:02:05

      Average standard deviation of split frequencies: 0.010462

      510500 -- [-1343.831] (-1342.511) (-1347.019) (-1343.448) * (-1345.946) [-1326.184] (-1337.311) (-1351.049) -- 0:02:05
      511000 -- (-1348.465) (-1348.362) (-1337.805) [-1333.807] * (-1348.843) [-1334.540] (-1344.288) (-1333.782) -- 0:02:05
      511500 -- (-1353.967) (-1337.404) [-1340.388] (-1346.496) * (-1343.119) (-1342.882) (-1342.641) [-1323.518] -- 0:02:05
      512000 -- [-1332.858] (-1329.904) (-1341.896) (-1351.500) * (-1367.122) (-1341.561) [-1331.043] (-1350.400) -- 0:02:04
      512500 -- (-1348.748) [-1321.641] (-1344.535) (-1346.788) * (-1351.505) [-1331.499] (-1353.393) (-1338.912) -- 0:02:04
      513000 -- (-1334.888) [-1327.137] (-1327.656) (-1357.148) * [-1352.751] (-1335.902) (-1344.819) (-1341.972) -- 0:02:04
      513500 -- [-1336.888] (-1341.513) (-1343.808) (-1350.787) * (-1354.497) (-1335.915) (-1343.671) [-1330.479] -- 0:02:04
      514000 -- [-1342.556] (-1343.830) (-1339.993) (-1355.979) * (-1350.160) (-1327.307) (-1351.013) [-1331.233] -- 0:02:04
      514500 -- [-1318.172] (-1345.631) (-1353.905) (-1347.361) * (-1333.928) [-1318.937] (-1346.681) (-1341.576) -- 0:02:04
      515000 -- [-1324.348] (-1332.779) (-1346.829) (-1348.685) * (-1343.407) [-1333.178] (-1342.469) (-1344.654) -- 0:02:04

      Average standard deviation of split frequencies: 0.010405

      515500 -- [-1325.631] (-1343.898) (-1337.982) (-1358.512) * (-1353.385) [-1326.692] (-1338.543) (-1353.253) -- 0:02:04
      516000 -- [-1334.442] (-1345.392) (-1342.369) (-1341.437) * (-1343.953) (-1336.325) (-1332.122) [-1327.995] -- 0:02:03
      516500 -- [-1330.763] (-1348.674) (-1347.947) (-1338.829) * (-1345.717) (-1339.106) (-1350.817) [-1336.148] -- 0:02:03
      517000 -- (-1335.440) (-1340.620) (-1348.343) [-1319.544] * (-1350.079) [-1346.405] (-1351.040) (-1341.942) -- 0:02:03
      517500 -- (-1337.569) (-1342.957) (-1346.354) [-1329.966] * (-1343.122) [-1346.331] (-1341.973) (-1347.606) -- 0:02:04
      518000 -- (-1347.644) [-1330.994] (-1352.916) (-1345.189) * (-1359.149) (-1340.320) (-1353.055) [-1321.993] -- 0:02:03
      518500 -- (-1354.224) [-1338.529] (-1345.067) (-1336.210) * (-1345.469) [-1340.538] (-1347.569) (-1346.548) -- 0:02:03
      519000 -- (-1351.886) (-1339.553) (-1347.599) [-1314.330] * (-1343.163) [-1338.686] (-1343.172) (-1341.878) -- 0:02:03
      519500 -- (-1346.928) [-1342.239] (-1351.198) (-1337.034) * (-1342.215) [-1334.838] (-1342.129) (-1339.525) -- 0:02:03
      520000 -- (-1332.964) [-1322.435] (-1350.091) (-1341.033) * (-1356.557) [-1335.401] (-1346.928) (-1353.136) -- 0:02:02

      Average standard deviation of split frequencies: 0.010764

      520500 -- (-1350.184) (-1333.554) [-1337.360] (-1342.805) * (-1341.181) [-1343.839] (-1345.950) (-1347.040) -- 0:02:02
      521000 -- [-1336.947] (-1343.927) (-1347.454) (-1339.191) * (-1349.444) (-1343.793) [-1335.110] (-1349.152) -- 0:02:02
      521500 -- (-1351.220) [-1313.949] (-1351.348) (-1346.072) * (-1348.082) [-1343.312] (-1342.789) (-1343.071) -- 0:02:02
      522000 -- (-1351.167) [-1327.853] (-1345.190) (-1352.571) * [-1339.633] (-1346.266) (-1343.479) (-1343.000) -- 0:02:02
      522500 -- (-1348.350) [-1337.149] (-1356.145) (-1343.163) * (-1343.526) (-1345.513) [-1338.715] (-1343.521) -- 0:02:02
      523000 -- (-1349.792) [-1337.583] (-1343.533) (-1345.185) * (-1356.634) (-1342.565) (-1334.927) [-1328.134] -- 0:02:02
      523500 -- (-1349.546) (-1336.977) [-1344.177] (-1341.298) * (-1347.610) (-1347.190) [-1336.645] (-1331.351) -- 0:02:01
      524000 -- (-1334.279) (-1348.132) [-1314.929] (-1340.805) * (-1344.550) (-1343.241) (-1344.850) [-1349.250] -- 0:02:01
      524500 -- (-1340.785) (-1331.700) [-1330.767] (-1352.274) * (-1337.175) (-1348.733) (-1352.590) [-1333.725] -- 0:02:01
      525000 -- (-1327.545) [-1330.470] (-1367.142) (-1343.178) * (-1345.927) (-1354.558) [-1327.016] (-1339.127) -- 0:02:01

      Average standard deviation of split frequencies: 0.011103

      525500 -- (-1351.917) (-1342.490) (-1351.416) [-1336.977] * [-1337.083] (-1350.624) (-1345.586) (-1330.600) -- 0:02:01
      526000 -- (-1350.076) [-1342.496] (-1342.627) (-1345.973) * (-1342.510) (-1345.040) [-1327.355] (-1336.878) -- 0:02:01
      526500 -- (-1338.370) [-1338.694] (-1352.975) (-1340.334) * (-1345.504) (-1350.061) [-1327.530] (-1348.297) -- 0:02:01
      527000 -- (-1343.214) [-1333.045] (-1334.248) (-1337.470) * (-1350.455) (-1343.625) [-1323.182] (-1352.100) -- 0:02:01
      527500 -- (-1335.250) (-1348.969) [-1328.968] (-1346.257) * (-1349.047) (-1343.681) [-1321.025] (-1347.891) -- 0:02:00
      528000 -- (-1342.070) [-1339.660] (-1336.851) (-1344.356) * (-1355.382) [-1322.426] (-1341.836) (-1342.812) -- 0:02:00
      528500 -- [-1331.437] (-1337.904) (-1351.321) (-1351.093) * [-1331.305] (-1343.054) (-1339.271) (-1336.250) -- 0:02:00
      529000 -- (-1341.452) [-1322.240] (-1344.446) (-1350.009) * [-1329.318] (-1343.511) (-1344.545) (-1330.695) -- 0:02:00
      529500 -- [-1336.819] (-1323.263) (-1349.790) (-1344.340) * (-1333.273) (-1349.815) (-1339.703) [-1326.949] -- 0:02:00
      530000 -- [-1327.514] (-1345.044) (-1341.241) (-1334.399) * (-1337.370) (-1347.887) [-1329.712] (-1356.067) -- 0:02:00

      Average standard deviation of split frequencies: 0.011252

      530500 -- (-1340.956) (-1326.931) [-1340.834] (-1351.839) * (-1333.179) (-1337.796) [-1327.292] (-1344.919) -- 0:02:00
      531000 -- (-1342.168) [-1334.921] (-1342.201) (-1351.555) * (-1348.313) (-1343.600) [-1337.516] (-1350.258) -- 0:02:00
      531500 -- (-1342.654) [-1336.271] (-1347.738) (-1350.688) * (-1350.418) (-1338.811) [-1329.510] (-1338.472) -- 0:01:59
      532000 -- [-1324.788] (-1332.538) (-1333.470) (-1348.697) * (-1344.147) (-1345.338) [-1323.672] (-1340.977) -- 0:01:59
      532500 -- (-1331.497) [-1328.942] (-1339.916) (-1347.044) * (-1332.883) (-1350.934) [-1321.341] (-1345.254) -- 0:01:59
      533000 -- (-1344.785) [-1333.270] (-1343.038) (-1353.349) * (-1336.605) (-1348.348) [-1332.045] (-1333.324) -- 0:01:59
      533500 -- (-1350.962) [-1328.225] (-1331.898) (-1343.891) * (-1324.007) [-1335.956] (-1355.593) (-1353.648) -- 0:01:59
      534000 -- [-1339.264] (-1340.067) (-1336.276) (-1348.225) * [-1312.140] (-1348.106) (-1347.561) (-1343.354) -- 0:01:59
      534500 -- (-1337.825) (-1334.180) [-1338.516] (-1357.947) * [-1326.145] (-1355.421) (-1339.764) (-1359.896) -- 0:01:59
      535000 -- (-1328.359) [-1332.284] (-1345.423) (-1343.442) * [-1332.882] (-1344.350) (-1342.445) (-1339.079) -- 0:01:59

      Average standard deviation of split frequencies: 0.011336

      535500 -- (-1341.587) [-1326.170] (-1349.275) (-1340.459) * [-1334.524] (-1353.757) (-1336.575) (-1341.990) -- 0:01:58
      536000 -- [-1337.650] (-1339.162) (-1341.373) (-1335.778) * (-1345.728) (-1352.415) (-1342.841) [-1342.139] -- 0:01:58
      536500 -- (-1333.339) (-1343.586) (-1347.333) [-1338.586] * (-1336.222) (-1348.400) [-1325.430] (-1341.082) -- 0:01:58
      537000 -- (-1343.980) [-1337.303] (-1342.595) (-1346.925) * (-1343.724) (-1343.289) [-1335.578] (-1337.926) -- 0:01:58
      537500 -- (-1342.211) [-1331.004] (-1352.706) (-1336.989) * [-1334.499] (-1339.289) (-1346.383) (-1341.976) -- 0:01:58
      538000 -- (-1348.082) [-1336.584] (-1348.764) (-1322.219) * (-1338.042) [-1345.989] (-1346.052) (-1341.002) -- 0:01:58
      538500 -- [-1319.249] (-1331.983) (-1342.297) (-1345.818) * (-1337.733) (-1342.782) [-1330.298] (-1351.203) -- 0:01:58
      539000 -- [-1326.975] (-1344.207) (-1343.367) (-1325.815) * (-1333.934) (-1360.872) [-1318.007] (-1345.563) -- 0:01:58
      539500 -- (-1349.853) (-1334.778) (-1339.481) [-1324.537] * (-1348.233) (-1342.808) [-1338.966] (-1344.559) -- 0:01:57
      540000 -- (-1341.739) [-1321.052] (-1341.185) (-1344.047) * (-1349.688) (-1351.252) [-1317.839] (-1342.312) -- 0:01:57

      Average standard deviation of split frequencies: 0.010608

      540500 -- (-1346.167) [-1322.322] (-1340.492) (-1337.450) * (-1348.855) [-1348.919] (-1326.778) (-1336.756) -- 0:01:57
      541000 -- (-1333.062) [-1333.542] (-1336.419) (-1339.388) * (-1345.952) (-1343.406) [-1326.555] (-1350.769) -- 0:01:57
      541500 -- (-1341.157) [-1332.599] (-1348.681) (-1333.764) * (-1346.811) (-1345.420) [-1322.391] (-1346.616) -- 0:01:57
      542000 -- (-1342.140) (-1339.295) [-1341.404] (-1342.909) * (-1336.851) (-1358.775) [-1337.211] (-1340.787) -- 0:01:57
      542500 -- [-1348.445] (-1333.319) (-1343.343) (-1346.918) * (-1343.140) (-1346.716) (-1341.045) [-1329.939] -- 0:01:57
      543000 -- (-1351.249) [-1336.629] (-1345.101) (-1343.887) * (-1331.676) (-1351.904) (-1347.191) [-1321.723] -- 0:01:56
      543500 -- (-1342.531) (-1330.788) (-1338.356) [-1341.560] * (-1352.073) (-1343.596) (-1344.133) [-1331.475] -- 0:01:56
      544000 -- (-1343.812) [-1323.609] (-1349.705) (-1329.196) * (-1346.292) (-1351.542) [-1321.103] (-1325.265) -- 0:01:56
      544500 -- [-1336.966] (-1354.506) (-1341.500) (-1340.182) * [-1342.802] (-1354.024) (-1347.137) (-1319.264) -- 0:01:56
      545000 -- (-1332.151) (-1349.517) [-1328.268] (-1345.315) * (-1338.658) (-1352.754) (-1345.443) [-1314.831] -- 0:01:56

      Average standard deviation of split frequencies: 0.010552

      545500 -- (-1343.625) (-1347.470) [-1326.009] (-1346.704) * (-1350.692) (-1355.188) (-1337.496) [-1310.295] -- 0:01:56
      546000 -- (-1356.261) [-1337.418] (-1347.293) (-1349.726) * (-1337.564) (-1348.629) (-1352.587) [-1317.213] -- 0:01:56
      546500 -- (-1343.579) (-1351.405) [-1344.213] (-1351.115) * (-1336.098) (-1355.399) [-1341.857] (-1323.017) -- 0:01:56
      547000 -- (-1336.730) (-1348.762) (-1341.117) [-1315.432] * (-1328.806) (-1346.886) (-1342.393) [-1317.751] -- 0:01:55
      547500 -- (-1340.150) [-1332.815] (-1339.782) (-1341.766) * (-1343.119) (-1353.187) (-1353.528) [-1322.242] -- 0:01:55
      548000 -- [-1335.450] (-1339.892) (-1345.083) (-1342.791) * (-1338.367) [-1347.674] (-1344.525) (-1344.108) -- 0:01:55
      548500 -- (-1337.787) (-1351.816) [-1339.218] (-1346.893) * [-1334.897] (-1342.315) (-1339.341) (-1347.335) -- 0:01:55
      549000 -- [-1329.403] (-1344.868) (-1340.037) (-1334.852) * [-1345.421] (-1352.062) (-1336.528) (-1348.375) -- 0:01:55
      549500 -- [-1333.499] (-1339.173) (-1341.388) (-1345.153) * (-1343.532) [-1338.505] (-1340.293) (-1350.017) -- 0:01:55
      550000 -- [-1325.938] (-1344.427) (-1345.242) (-1348.702) * (-1354.993) [-1336.341] (-1346.617) (-1345.928) -- 0:01:55

      Average standard deviation of split frequencies: 0.010368

      550500 -- [-1324.367] (-1345.110) (-1356.531) (-1338.313) * [-1330.772] (-1344.237) (-1350.054) (-1340.449) -- 0:01:55
      551000 -- [-1311.099] (-1346.053) (-1345.992) (-1341.441) * [-1331.054] (-1345.036) (-1346.357) (-1328.253) -- 0:01:54
      551500 -- [-1318.390] (-1345.701) (-1345.633) (-1328.436) * (-1332.580) (-1345.085) (-1354.066) [-1330.624] -- 0:01:54
      552000 -- (-1353.548) [-1335.226] (-1344.582) (-1349.688) * (-1343.746) (-1339.845) [-1330.444] (-1334.527) -- 0:01:54
      552500 -- [-1327.223] (-1334.719) (-1338.068) (-1351.635) * (-1336.722) (-1349.292) [-1321.378] (-1345.836) -- 0:01:54
      553000 -- (-1336.989) [-1334.448] (-1346.957) (-1345.347) * (-1345.694) (-1340.097) [-1319.932] (-1344.440) -- 0:01:54
      553500 -- (-1343.030) [-1332.520] (-1348.526) (-1355.113) * (-1328.478) (-1342.312) [-1316.813] (-1342.109) -- 0:01:54
      554000 -- (-1344.729) [-1329.927] (-1341.920) (-1354.097) * [-1343.117] (-1345.133) (-1338.938) (-1347.954) -- 0:01:54
      554500 -- (-1346.273) (-1332.098) [-1332.492] (-1353.658) * [-1345.822] (-1344.127) (-1346.962) (-1345.726) -- 0:01:54
      555000 -- (-1351.965) (-1340.749) [-1336.440] (-1346.367) * [-1337.346] (-1339.061) (-1345.873) (-1353.923) -- 0:01:53

      Average standard deviation of split frequencies: 0.010692

      555500 -- [-1332.365] (-1340.355) (-1345.582) (-1346.668) * [-1338.501] (-1342.579) (-1347.382) (-1335.008) -- 0:01:53
      556000 -- [-1339.119] (-1340.168) (-1354.598) (-1340.839) * (-1346.686) (-1357.839) (-1337.952) [-1327.517] -- 0:01:53
      556500 -- [-1320.549] (-1348.773) (-1356.391) (-1327.739) * (-1331.129) (-1344.732) (-1339.814) [-1337.223] -- 0:01:53
      557000 -- [-1327.419] (-1350.856) (-1341.730) (-1333.363) * (-1350.687) (-1336.366) (-1342.188) [-1336.957] -- 0:01:53
      557500 -- (-1338.293) (-1347.906) (-1339.450) [-1333.858] * [-1335.692] (-1339.824) (-1335.827) (-1350.752) -- 0:01:53
      558000 -- [-1319.384] (-1350.467) (-1336.665) (-1335.188) * [-1320.157] (-1337.199) (-1349.121) (-1341.364) -- 0:01:53
      558500 -- [-1334.662] (-1349.331) (-1354.283) (-1339.368) * [-1328.853] (-1344.785) (-1338.756) (-1353.224) -- 0:01:53
      559000 -- (-1344.514) (-1346.928) (-1346.121) [-1327.382] * [-1312.807] (-1345.882) (-1347.216) (-1356.738) -- 0:01:52
      559500 -- (-1338.386) (-1339.526) [-1333.796] (-1342.624) * [-1328.882] (-1344.270) (-1341.648) (-1344.448) -- 0:01:52
      560000 -- [-1337.452] (-1345.572) (-1339.886) (-1353.465) * [-1324.445] (-1343.789) (-1344.092) (-1340.725) -- 0:01:52

      Average standard deviation of split frequencies: 0.010930

      560500 -- (-1348.836) (-1354.221) [-1329.499] (-1347.892) * [-1322.296] (-1341.937) (-1355.537) (-1348.239) -- 0:01:52
      561000 -- (-1344.806) [-1333.438] (-1355.991) (-1345.411) * [-1335.980] (-1326.718) (-1349.680) (-1333.419) -- 0:01:52
      561500 -- (-1362.254) (-1339.756) (-1353.557) [-1333.066] * (-1349.722) [-1329.737] (-1344.195) (-1347.127) -- 0:01:52
      562000 -- (-1349.423) (-1350.619) [-1327.812] (-1338.010) * (-1343.804) [-1334.446] (-1351.503) (-1349.685) -- 0:01:52
      562500 -- (-1350.825) (-1346.830) [-1341.593] (-1346.026) * (-1341.889) [-1325.286] (-1348.046) (-1343.128) -- 0:01:52
      563000 -- (-1344.170) (-1340.112) [-1325.148] (-1344.652) * (-1350.878) (-1328.726) (-1344.265) [-1341.998] -- 0:01:51
      563500 -- (-1352.464) (-1319.817) (-1348.732) [-1325.850] * (-1348.106) (-1339.361) [-1332.902] (-1338.724) -- 0:01:51
      564000 -- (-1346.880) [-1342.136] (-1337.740) (-1322.961) * (-1343.864) (-1343.647) [-1336.236] (-1351.311) -- 0:01:51
      564500 -- (-1344.870) (-1353.560) (-1343.911) [-1333.427] * (-1340.322) (-1347.127) [-1330.017] (-1347.206) -- 0:01:51
      565000 -- [-1341.176] (-1357.138) (-1339.963) (-1340.962) * (-1349.110) [-1328.033] (-1346.422) (-1347.119) -- 0:01:51

      Average standard deviation of split frequencies: 0.010966

      565500 -- [-1332.282] (-1351.783) (-1342.297) (-1335.635) * (-1340.551) (-1346.860) [-1336.364] (-1336.959) -- 0:01:51
      566000 -- [-1322.830] (-1341.233) (-1344.946) (-1344.797) * (-1339.923) (-1342.692) (-1350.026) [-1333.947] -- 0:01:51
      566500 -- (-1340.815) [-1342.858] (-1339.261) (-1337.975) * [-1335.209] (-1347.843) (-1341.513) (-1339.573) -- 0:01:50
      567000 -- (-1346.116) (-1346.233) (-1332.554) [-1335.314] * [-1336.707] (-1343.563) (-1349.495) (-1334.622) -- 0:01:50
      567500 -- (-1339.159) (-1350.297) [-1335.044] (-1339.861) * (-1335.249) (-1346.617) [-1329.836] (-1342.523) -- 0:01:50
      568000 -- (-1341.200) [-1337.755] (-1344.237) (-1343.491) * [-1326.077] (-1342.441) (-1352.193) (-1342.646) -- 0:01:50
      568500 -- (-1349.035) (-1353.236) (-1334.009) [-1341.854] * (-1335.943) (-1338.437) (-1343.345) [-1338.839] -- 0:01:50
      569000 -- (-1341.949) (-1344.488) [-1317.576] (-1337.549) * (-1335.209) [-1332.389] (-1343.381) (-1328.975) -- 0:01:50
      569500 -- (-1345.005) (-1349.826) [-1337.592] (-1342.997) * (-1340.900) (-1343.365) (-1343.304) [-1325.907] -- 0:01:50
      570000 -- (-1335.168) (-1340.902) [-1330.844] (-1346.087) * (-1338.058) [-1340.826] (-1339.112) (-1331.014) -- 0:01:50

      Average standard deviation of split frequencies: 0.010593

      570500 -- (-1350.548) (-1349.981) [-1314.616] (-1338.989) * (-1346.305) (-1336.383) (-1340.209) [-1332.916] -- 0:01:49
      571000 -- [-1332.755] (-1350.470) (-1338.046) (-1350.298) * (-1351.014) [-1339.764] (-1340.305) (-1313.087) -- 0:01:49
      571500 -- (-1335.265) (-1342.412) [-1338.773] (-1350.621) * (-1342.389) (-1347.293) [-1336.224] (-1348.031) -- 0:01:49
      572000 -- [-1332.014] (-1344.447) (-1348.876) (-1336.738) * (-1338.301) (-1349.551) [-1340.486] (-1342.418) -- 0:01:49
      572500 -- (-1340.030) (-1335.833) (-1329.253) [-1335.952] * [-1342.934] (-1348.796) (-1323.544) (-1337.559) -- 0:01:49
      573000 -- (-1324.300) (-1344.663) [-1314.772] (-1342.892) * [-1330.702] (-1347.641) (-1348.671) (-1345.570) -- 0:01:49
      573500 -- [-1330.467] (-1347.509) (-1341.870) (-1344.084) * [-1336.554] (-1344.089) (-1347.104) (-1339.161) -- 0:01:49
      574000 -- (-1333.408) [-1337.637] (-1350.332) (-1340.299) * (-1337.045) (-1345.546) (-1352.448) [-1327.199] -- 0:01:49
      574500 -- [-1333.278] (-1348.842) (-1340.898) (-1344.723) * (-1337.099) (-1341.390) (-1344.056) [-1329.965] -- 0:01:48
      575000 -- [-1321.904] (-1348.567) (-1329.674) (-1338.764) * (-1340.410) (-1335.923) (-1344.902) [-1330.240] -- 0:01:48

      Average standard deviation of split frequencies: 0.010495

      575500 -- [-1330.224] (-1339.315) (-1346.832) (-1346.704) * [-1344.114] (-1341.751) (-1338.693) (-1333.494) -- 0:01:48
      576000 -- (-1338.989) [-1348.462] (-1348.358) (-1344.398) * (-1345.750) (-1346.803) [-1331.551] (-1344.525) -- 0:01:48
      576500 -- (-1343.240) (-1349.081) (-1346.837) [-1332.561] * (-1348.491) [-1327.284] (-1347.579) (-1340.206) -- 0:01:48
      577000 -- (-1346.895) (-1343.638) [-1335.021] (-1350.116) * (-1347.724) [-1318.775] (-1343.515) (-1345.424) -- 0:01:48
      577500 -- (-1344.755) (-1343.030) [-1333.056] (-1349.694) * (-1336.120) [-1324.954] (-1357.251) (-1335.218) -- 0:01:48
      578000 -- (-1335.545) (-1347.018) (-1337.902) [-1335.847] * (-1352.791) (-1327.752) (-1344.925) [-1325.333] -- 0:01:48
      578500 -- (-1334.316) (-1349.677) (-1341.504) [-1331.124] * (-1346.313) (-1342.074) (-1344.161) [-1323.018] -- 0:01:47
      579000 -- (-1339.992) (-1346.549) (-1333.765) [-1344.979] * (-1348.314) [-1336.041] (-1340.618) (-1350.102) -- 0:01:47
      579500 -- [-1329.489] (-1354.143) (-1336.157) (-1357.277) * (-1344.535) [-1340.529] (-1338.627) (-1336.875) -- 0:01:47
      580000 -- (-1311.903) (-1349.880) [-1316.794] (-1350.938) * (-1358.042) (-1341.168) [-1345.601] (-1344.319) -- 0:01:47

      Average standard deviation of split frequencies: 0.010029

      580500 -- [-1311.597] (-1347.834) (-1333.434) (-1347.888) * (-1351.211) [-1335.638] (-1330.316) (-1342.146) -- 0:01:47
      581000 -- (-1337.150) (-1358.523) (-1347.925) [-1333.819] * (-1350.131) [-1333.579] (-1346.497) (-1348.449) -- 0:01:47
      581500 -- (-1343.513) (-1344.597) (-1350.831) [-1330.795] * (-1340.129) (-1343.549) [-1333.469] (-1349.975) -- 0:01:47
      582000 -- (-1345.818) (-1347.705) (-1347.949) [-1323.572] * (-1338.148) (-1340.323) [-1342.255] (-1345.830) -- 0:01:47
      582500 -- (-1343.198) (-1340.072) [-1318.094] (-1329.962) * (-1341.071) (-1341.833) [-1343.090] (-1354.223) -- 0:01:46
      583000 -- (-1346.175) (-1342.695) [-1314.244] (-1332.646) * (-1345.715) (-1340.656) (-1337.953) [-1343.887] -- 0:01:46
      583500 -- (-1350.461) [-1340.104] (-1334.659) (-1347.312) * (-1349.079) (-1346.704) [-1336.039] (-1354.499) -- 0:01:46
      584000 -- (-1342.500) (-1347.490) [-1337.063] (-1349.450) * (-1343.027) (-1342.343) (-1336.699) [-1330.016] -- 0:01:46
      584500 -- (-1329.805) (-1345.528) (-1345.614) [-1332.464] * (-1346.675) (-1342.170) (-1355.622) [-1339.366] -- 0:01:46
      585000 -- (-1342.664) (-1339.672) (-1342.671) [-1348.956] * (-1355.694) (-1348.585) (-1349.398) [-1333.365] -- 0:01:46

      Average standard deviation of split frequencies: 0.010127

      585500 -- [-1331.491] (-1352.771) (-1328.116) (-1343.039) * (-1349.927) [-1344.046] (-1339.352) (-1348.688) -- 0:01:46
      586000 -- [-1337.308] (-1342.295) (-1341.922) (-1340.353) * (-1336.955) [-1341.745] (-1342.401) (-1341.314) -- 0:01:45
      586500 -- (-1340.564) (-1341.352) (-1335.512) [-1347.839] * (-1357.372) (-1339.970) [-1329.454] (-1344.464) -- 0:01:45
      587000 -- (-1341.438) (-1351.126) (-1340.477) [-1313.750] * [-1330.557] (-1347.772) (-1337.829) (-1358.353) -- 0:01:45
      587500 -- (-1340.690) (-1344.938) (-1337.505) [-1307.970] * (-1343.293) (-1334.856) [-1329.409] (-1337.878) -- 0:01:45
      588000 -- (-1332.334) (-1360.485) (-1339.822) [-1302.463] * (-1346.544) (-1329.065) (-1323.621) [-1324.696] -- 0:01:45
      588500 -- (-1352.222) (-1347.634) (-1349.798) [-1319.380] * (-1349.184) (-1342.419) [-1317.963] (-1317.844) -- 0:01:45
      589000 -- [-1336.635] (-1343.761) (-1333.086) (-1338.702) * (-1342.772) [-1311.594] (-1326.628) (-1339.521) -- 0:01:45
      589500 -- (-1331.971) [-1332.017] (-1344.993) (-1344.492) * (-1346.817) (-1343.338) [-1331.763] (-1348.388) -- 0:01:45
      590000 -- [-1336.043] (-1343.676) (-1336.033) (-1342.194) * (-1345.831) (-1348.571) [-1322.207] (-1334.047) -- 0:01:44

      Average standard deviation of split frequencies: 0.009906

      590500 -- (-1344.271) (-1341.632) (-1343.312) [-1321.465] * (-1344.642) (-1343.532) [-1332.904] (-1338.521) -- 0:01:44
      591000 -- [-1337.474] (-1344.039) (-1340.427) (-1319.999) * [-1330.936] (-1344.221) (-1338.579) (-1349.187) -- 0:01:44
      591500 -- (-1357.417) (-1347.919) [-1336.643] (-1330.842) * [-1343.002] (-1351.763) (-1352.561) (-1338.217) -- 0:01:44
      592000 -- (-1342.676) [-1340.452] (-1343.456) (-1330.678) * (-1328.959) (-1348.373) (-1343.765) [-1344.018] -- 0:01:44
      592500 -- (-1343.015) (-1342.823) (-1342.469) [-1319.537] * (-1343.681) (-1351.860) [-1327.359] (-1352.519) -- 0:01:44
      593000 -- (-1342.264) (-1347.870) (-1341.556) [-1324.550] * (-1349.285) (-1344.411) (-1328.351) [-1337.552] -- 0:01:44
      593500 -- (-1345.523) (-1343.786) [-1317.175] (-1344.504) * (-1340.367) [-1337.590] (-1335.960) (-1326.026) -- 0:01:44
      594000 -- [-1325.366] (-1334.962) (-1334.073) (-1346.600) * (-1343.797) (-1340.303) (-1347.059) [-1326.377] -- 0:01:43
      594500 -- (-1345.325) (-1348.340) (-1343.592) [-1339.530] * [-1336.378] (-1341.564) (-1342.475) (-1342.823) -- 0:01:43
      595000 -- (-1358.233) (-1346.178) [-1335.264] (-1346.644) * (-1340.609) [-1336.780] (-1346.015) (-1345.896) -- 0:01:43

      Average standard deviation of split frequencies: 0.009771

      595500 -- (-1341.626) (-1347.461) [-1340.664] (-1338.398) * [-1337.772] (-1341.251) (-1326.040) (-1352.442) -- 0:01:43
      596000 -- (-1356.078) [-1330.014] (-1321.126) (-1339.658) * [-1318.648] (-1343.473) (-1341.797) (-1346.667) -- 0:01:43
      596500 -- (-1340.002) (-1339.119) [-1324.559] (-1344.859) * [-1318.422] (-1346.495) (-1345.512) (-1344.962) -- 0:01:43
      597000 -- (-1339.900) [-1327.846] (-1341.767) (-1355.848) * [-1325.240] (-1343.088) (-1346.062) (-1354.034) -- 0:01:43
      597500 -- (-1343.013) (-1332.311) [-1340.693] (-1354.460) * [-1318.962] (-1335.011) (-1341.527) (-1346.688) -- 0:01:43
      598000 -- (-1349.192) [-1338.996] (-1344.052) (-1342.953) * [-1324.915] (-1336.983) (-1348.369) (-1344.870) -- 0:01:42
      598500 -- [-1344.395] (-1349.109) (-1350.831) (-1329.279) * [-1321.579] (-1356.562) (-1337.638) (-1350.051) -- 0:01:42
      599000 -- (-1342.491) [-1338.116] (-1347.398) (-1334.240) * [-1322.163] (-1350.984) (-1341.827) (-1343.003) -- 0:01:42
      599500 -- (-1342.168) (-1349.812) (-1365.029) [-1328.947] * [-1319.629] (-1355.767) (-1342.196) (-1349.845) -- 0:01:42
      600000 -- (-1352.791) (-1353.320) [-1346.235] (-1342.597) * [-1341.473] (-1344.334) (-1338.348) (-1345.281) -- 0:01:42

      Average standard deviation of split frequencies: 0.009741

      600500 -- (-1353.383) (-1352.917) (-1344.498) [-1334.980] * (-1355.170) (-1354.266) (-1344.763) [-1320.443] -- 0:01:42
      601000 -- (-1347.792) [-1337.817] (-1339.635) (-1349.386) * (-1341.862) (-1343.669) (-1354.308) [-1325.138] -- 0:01:42
      601500 -- (-1345.059) (-1349.077) (-1357.552) [-1336.311] * (-1341.600) (-1345.570) (-1340.940) [-1322.347] -- 0:01:42
      602000 -- [-1337.281] (-1350.492) (-1331.253) (-1339.289) * (-1335.742) (-1348.838) (-1345.134) [-1314.895] -- 0:01:41
      602500 -- (-1345.346) (-1337.831) (-1346.187) [-1322.636] * (-1333.823) (-1355.782) (-1352.716) [-1315.783] -- 0:01:41
      603000 -- (-1349.214) (-1341.715) (-1347.306) [-1320.636] * (-1340.959) (-1346.471) (-1343.915) [-1339.289] -- 0:01:41
      603500 -- (-1351.494) (-1343.259) (-1336.749) [-1330.133] * (-1344.128) (-1345.070) [-1340.208] (-1340.638) -- 0:01:41
      604000 -- (-1346.651) (-1343.315) (-1340.389) [-1337.172] * [-1348.549] (-1341.805) (-1348.040) (-1336.093) -- 0:01:41
      604500 -- [-1328.321] (-1343.279) (-1348.727) (-1345.920) * (-1346.836) [-1332.466] (-1342.769) (-1351.289) -- 0:01:41
      605000 -- [-1333.512] (-1342.712) (-1337.624) (-1324.110) * [-1343.350] (-1342.628) (-1344.889) (-1339.822) -- 0:01:41

      Average standard deviation of split frequencies: 0.009609

      605500 -- (-1344.817) [-1333.469] (-1338.814) (-1333.962) * (-1338.262) [-1335.907] (-1335.299) (-1333.896) -- 0:01:40
      606000 -- (-1348.831) [-1329.608] (-1341.832) (-1333.919) * (-1346.609) (-1347.823) [-1338.796] (-1339.325) -- 0:01:40
      606500 -- (-1351.323) (-1329.881) (-1338.065) [-1336.747] * (-1342.201) (-1337.060) (-1346.745) [-1338.913] -- 0:01:40
      607000 -- (-1345.250) (-1337.410) (-1342.283) [-1328.242] * (-1347.609) (-1337.503) (-1339.420) [-1330.846] -- 0:01:40
      607500 -- (-1340.220) (-1338.752) [-1328.545] (-1336.507) * [-1341.363] (-1331.712) (-1351.451) (-1345.015) -- 0:01:40
      608000 -- (-1356.669) [-1316.494] (-1321.474) (-1345.399) * (-1344.286) (-1339.265) (-1350.536) [-1333.468] -- 0:01:40
      608500 -- (-1340.929) [-1325.192] (-1338.595) (-1348.502) * (-1341.265) (-1339.183) (-1344.736) [-1332.353] -- 0:01:40
      609000 -- (-1346.076) [-1334.843] (-1339.452) (-1341.012) * (-1344.223) (-1343.536) (-1349.964) [-1334.334] -- 0:01:40
      609500 -- (-1346.875) (-1325.636) (-1334.421) [-1339.656] * (-1346.919) (-1348.488) [-1331.832] (-1347.981) -- 0:01:39
      610000 -- (-1341.531) [-1311.040] (-1344.651) (-1346.066) * (-1352.012) (-1339.945) (-1360.212) [-1340.571] -- 0:01:39

      Average standard deviation of split frequencies: 0.009490

      610500 -- (-1350.769) [-1315.096] (-1339.937) (-1343.875) * (-1352.825) [-1337.713] (-1347.051) (-1341.558) -- 0:01:39
      611000 -- (-1340.420) [-1307.972] (-1348.845) (-1337.415) * (-1346.142) [-1325.153] (-1343.290) (-1339.697) -- 0:01:39
      611500 -- (-1335.067) [-1343.478] (-1340.375) (-1346.025) * [-1334.530] (-1344.985) (-1345.856) (-1341.686) -- 0:01:39
      612000 -- (-1347.681) (-1342.413) [-1335.608] (-1332.998) * [-1320.530] (-1348.524) (-1362.184) (-1333.142) -- 0:01:39
      612500 -- (-1350.599) [-1339.762] (-1314.010) (-1341.262) * (-1345.076) (-1346.822) (-1341.645) [-1338.464] -- 0:01:39
      613000 -- (-1333.775) (-1348.753) (-1333.151) [-1336.677] * (-1343.893) (-1344.679) (-1355.666) [-1336.116] -- 0:01:39
      613500 -- (-1349.374) (-1348.074) [-1329.551] (-1335.812) * (-1349.478) [-1335.438] (-1343.712) (-1347.461) -- 0:01:38
      614000 -- (-1339.798) (-1339.331) (-1331.383) [-1318.825] * [-1348.730] (-1340.489) (-1346.247) (-1336.919) -- 0:01:38
      614500 -- (-1342.016) (-1353.073) (-1343.170) [-1343.258] * [-1335.075] (-1348.634) (-1350.173) (-1348.243) -- 0:01:38
      615000 -- (-1339.223) (-1342.334) (-1330.052) [-1342.850] * [-1335.613] (-1342.825) (-1351.552) (-1337.420) -- 0:01:38

      Average standard deviation of split frequencies: 0.009813

      615500 -- (-1342.790) (-1346.541) [-1317.831] (-1336.190) * (-1339.773) [-1342.915] (-1348.291) (-1345.961) -- 0:01:38
      616000 -- (-1346.999) [-1332.619] (-1324.736) (-1349.785) * [-1349.767] (-1346.531) (-1363.714) (-1344.650) -- 0:01:38
      616500 -- (-1333.571) [-1328.942] (-1337.368) (-1336.054) * (-1337.696) [-1332.886] (-1346.618) (-1356.889) -- 0:01:38
      617000 -- [-1325.286] (-1344.983) (-1334.839) (-1338.745) * [-1335.865] (-1345.015) (-1350.470) (-1341.802) -- 0:01:38
      617500 -- (-1328.951) (-1344.596) (-1350.804) [-1324.705] * (-1342.708) [-1349.643] (-1341.158) (-1328.093) -- 0:01:37
      618000 -- (-1341.772) (-1341.282) (-1345.935) [-1323.952] * (-1348.292) (-1345.574) [-1336.423] (-1339.564) -- 0:01:37
      618500 -- (-1350.053) [-1320.395] (-1351.984) (-1344.836) * [-1335.929] (-1345.955) (-1337.915) (-1343.921) -- 0:01:37
      619000 -- (-1343.439) [-1317.578] (-1339.345) (-1355.275) * [-1323.176] (-1345.609) (-1335.025) (-1337.568) -- 0:01:37
      619500 -- (-1347.084) [-1314.722] (-1331.537) (-1351.931) * [-1314.241] (-1349.385) (-1337.313) (-1331.015) -- 0:01:37
      620000 -- (-1339.962) [-1332.733] (-1348.108) (-1354.780) * [-1310.862] (-1360.529) (-1346.322) (-1341.567) -- 0:01:37

      Average standard deviation of split frequencies: 0.010142

      620500 -- (-1356.252) [-1341.218] (-1351.518) (-1350.003) * [-1321.276] (-1351.234) (-1344.953) (-1344.660) -- 0:01:37
      621000 -- [-1331.190] (-1343.984) (-1352.001) (-1345.915) * (-1328.126) (-1347.807) [-1340.461] (-1347.994) -- 0:01:37
      621500 -- [-1346.370] (-1339.307) (-1341.293) (-1337.490) * [-1332.687] (-1352.875) (-1344.664) (-1340.103) -- 0:01:36
      622000 -- (-1345.218) (-1343.805) (-1344.609) [-1338.870] * (-1333.614) (-1343.658) [-1332.341] (-1342.836) -- 0:01:36
      622500 -- [-1340.126] (-1347.423) (-1333.946) (-1337.721) * [-1329.752] (-1348.304) (-1346.643) (-1332.370) -- 0:01:36
      623000 -- [-1335.799] (-1342.344) (-1333.272) (-1344.170) * (-1344.856) (-1337.260) (-1347.563) [-1324.547] -- 0:01:36
      623500 -- (-1354.956) (-1334.555) (-1345.718) [-1323.707] * [-1342.826] (-1355.095) (-1343.835) (-1356.251) -- 0:01:36
      624000 -- (-1335.650) (-1340.696) (-1346.679) [-1333.645] * [-1331.381] (-1356.592) (-1337.803) (-1342.417) -- 0:01:36
      624500 -- (-1351.980) [-1328.988] (-1344.984) (-1332.094) * (-1335.036) (-1348.717) (-1352.703) [-1337.496] -- 0:01:36
      625000 -- (-1345.612) [-1330.566] (-1346.812) (-1350.504) * (-1343.827) (-1349.746) (-1347.433) [-1338.645] -- 0:01:36

      Average standard deviation of split frequencies: 0.010188

      625500 -- (-1352.576) [-1332.839] (-1353.788) (-1344.604) * [-1339.463] (-1357.960) (-1355.795) (-1347.291) -- 0:01:35
      626000 -- (-1350.812) [-1321.746] (-1344.496) (-1343.301) * [-1326.481] (-1350.187) (-1350.945) (-1348.018) -- 0:01:35
      626500 -- (-1355.008) [-1326.866] (-1344.237) (-1351.456) * [-1322.909] (-1351.844) (-1340.240) (-1343.464) -- 0:01:35
      627000 -- [-1336.495] (-1332.238) (-1348.132) (-1342.083) * (-1338.317) (-1358.381) [-1330.711] (-1354.051) -- 0:01:35
      627500 -- (-1317.258) (-1354.103) (-1338.947) [-1339.025] * [-1338.908] (-1342.424) (-1344.203) (-1348.834) -- 0:01:35
      628000 -- (-1344.581) (-1340.264) [-1349.214] (-1344.410) * (-1341.626) (-1352.971) [-1342.813] (-1341.364) -- 0:01:35
      628500 -- (-1347.879) [-1321.890] (-1336.583) (-1342.473) * (-1330.660) (-1352.489) (-1333.645) [-1335.435] -- 0:01:35
      629000 -- (-1346.219) (-1340.409) [-1334.421] (-1346.940) * [-1322.645] (-1342.983) (-1327.534) (-1357.653) -- 0:01:34
      629500 -- (-1344.651) (-1342.288) (-1333.177) [-1345.379] * (-1330.657) (-1341.854) [-1321.712] (-1346.772) -- 0:01:34
      630000 -- (-1353.093) [-1325.081] (-1358.872) (-1344.398) * (-1349.344) (-1344.577) [-1313.446] (-1345.086) -- 0:01:34

      Average standard deviation of split frequencies: 0.008882

      630500 -- (-1336.104) [-1341.909] (-1340.419) (-1340.191) * (-1344.239) [-1333.758] (-1345.074) (-1341.896) -- 0:01:34
      631000 -- (-1352.177) [-1340.556] (-1333.640) (-1345.453) * [-1336.118] (-1343.882) (-1344.201) (-1338.460) -- 0:01:34
      631500 -- [-1337.366] (-1342.483) (-1347.283) (-1350.746) * [-1327.460] (-1346.432) (-1336.889) (-1352.851) -- 0:01:34
      632000 -- (-1339.634) (-1344.866) [-1335.059] (-1350.400) * (-1329.559) (-1348.934) (-1344.470) [-1335.054] -- 0:01:34
      632500 -- (-1336.728) (-1333.703) (-1341.420) [-1334.790] * (-1339.735) (-1345.175) [-1340.038] (-1354.196) -- 0:01:34
      633000 -- [-1340.973] (-1333.511) (-1347.741) (-1348.294) * [-1316.442] (-1360.410) (-1342.219) (-1343.656) -- 0:01:33
      633500 -- (-1337.633) [-1333.226] (-1363.093) (-1342.986) * [-1310.678] (-1344.470) (-1348.961) (-1351.667) -- 0:01:33
      634000 -- (-1350.160) [-1331.595] (-1355.495) (-1335.306) * [-1313.870] (-1338.560) (-1338.130) (-1346.768) -- 0:01:33
      634500 -- (-1335.922) (-1331.876) (-1355.306) [-1339.027] * (-1336.700) [-1339.783] (-1340.634) (-1341.466) -- 0:01:33
      635000 -- [-1332.341] (-1320.406) (-1356.829) (-1348.369) * (-1345.155) [-1339.299] (-1338.316) (-1342.136) -- 0:01:33

      Average standard deviation of split frequencies: 0.007804

      635500 -- [-1335.374] (-1326.920) (-1349.057) (-1338.989) * (-1345.932) [-1330.480] (-1344.167) (-1341.478) -- 0:01:33
      636000 -- (-1345.337) (-1336.976) [-1327.085] (-1347.234) * (-1344.676) [-1329.576] (-1349.608) (-1335.817) -- 0:01:33
      636500 -- (-1340.414) (-1346.241) [-1314.611] (-1343.249) * [-1347.611] (-1345.030) (-1359.568) (-1348.451) -- 0:01:33
      637000 -- [-1335.843] (-1363.447) (-1355.748) (-1343.587) * (-1351.680) (-1326.796) (-1349.749) [-1336.058] -- 0:01:32
      637500 -- [-1324.900] (-1346.046) (-1344.948) (-1338.644) * (-1352.016) (-1332.868) (-1349.444) [-1332.602] -- 0:01:32
      638000 -- [-1314.549] (-1332.308) (-1362.187) (-1331.812) * (-1345.063) [-1324.613] (-1340.820) (-1339.965) -- 0:01:32
      638500 -- [-1341.618] (-1327.120) (-1351.564) (-1329.331) * (-1334.935) (-1345.564) [-1321.027] (-1339.640) -- 0:01:32
      639000 -- (-1339.733) [-1329.919] (-1345.865) (-1339.962) * (-1333.220) (-1337.551) [-1321.588] (-1349.378) -- 0:01:32
      639500 -- (-1340.598) (-1340.168) [-1337.971] (-1347.181) * (-1340.775) (-1328.572) [-1328.874] (-1345.298) -- 0:01:32
      640000 -- [-1339.818] (-1334.896) (-1343.455) (-1344.510) * (-1347.950) (-1337.867) [-1339.693] (-1346.425) -- 0:01:32

      Average standard deviation of split frequencies: 0.008180

      640500 -- (-1339.122) [-1329.828] (-1358.738) (-1342.029) * (-1339.729) (-1341.387) [-1321.787] (-1340.324) -- 0:01:32
      641000 -- (-1340.866) (-1331.495) [-1334.784] (-1346.048) * (-1345.190) (-1344.903) [-1317.469] (-1342.674) -- 0:01:31
      641500 -- [-1345.007] (-1353.968) (-1331.491) (-1348.468) * (-1342.983) (-1336.500) [-1322.732] (-1340.360) -- 0:01:31
      642000 -- (-1352.580) [-1334.943] (-1323.239) (-1344.967) * (-1341.300) (-1342.322) (-1345.406) [-1344.048] -- 0:01:31
      642500 -- (-1340.987) (-1344.540) (-1347.636) [-1341.700] * (-1349.989) (-1334.750) [-1330.388] (-1342.676) -- 0:01:31
      643000 -- (-1345.754) [-1347.002] (-1344.759) (-1342.461) * (-1343.316) (-1344.742) [-1328.933] (-1342.155) -- 0:01:31
      643500 -- [-1323.543] (-1336.773) (-1344.551) (-1357.113) * (-1332.231) [-1338.087] (-1325.015) (-1354.081) -- 0:01:31
      644000 -- (-1329.586) (-1344.011) [-1329.843] (-1353.109) * (-1343.699) (-1342.551) [-1315.224] (-1339.029) -- 0:01:31
      644500 -- (-1330.651) (-1347.064) [-1324.382] (-1334.135) * (-1353.081) [-1331.236] (-1334.454) (-1346.057) -- 0:01:31
      645000 -- (-1341.663) (-1345.892) [-1323.590] (-1338.494) * (-1345.254) (-1335.982) [-1331.151] (-1346.605) -- 0:01:30

      Average standard deviation of split frequencies: 0.007898

      645500 -- (-1356.058) [-1340.365] (-1341.604) (-1334.367) * (-1338.794) (-1344.584) [-1342.314] (-1345.984) -- 0:01:30
      646000 -- (-1337.888) (-1340.997) (-1336.837) [-1342.638] * (-1344.415) [-1334.733] (-1346.835) (-1350.417) -- 0:01:30
      646500 -- (-1344.667) (-1343.135) [-1329.192] (-1344.460) * (-1346.270) [-1327.063] (-1334.591) (-1336.172) -- 0:01:30
      647000 -- (-1345.146) (-1338.221) [-1332.766] (-1343.824) * (-1346.517) (-1338.748) (-1342.047) [-1344.368] -- 0:01:30
      647500 -- (-1335.083) (-1341.256) [-1334.043] (-1345.497) * (-1346.753) [-1334.735] (-1336.277) (-1352.606) -- 0:01:30
      648000 -- (-1334.066) (-1343.947) [-1323.218] (-1350.560) * (-1332.795) (-1341.244) [-1329.498] (-1344.022) -- 0:01:30
      648500 -- (-1336.602) (-1338.819) [-1331.956] (-1344.606) * [-1334.995] (-1351.477) (-1342.270) (-1336.761) -- 0:01:29
      649000 -- (-1334.752) (-1340.106) [-1331.349] (-1348.765) * (-1347.679) (-1337.613) [-1340.454] (-1340.662) -- 0:01:29
      649500 -- (-1354.799) [-1329.781] (-1345.075) (-1344.944) * (-1348.856) [-1336.779] (-1335.906) (-1348.583) -- 0:01:29
      650000 -- (-1337.845) (-1353.261) [-1325.790] (-1335.378) * (-1346.355) (-1325.475) (-1337.794) [-1335.243] -- 0:01:29

      Average standard deviation of split frequencies: 0.007245

      650500 -- (-1352.140) (-1346.747) (-1341.455) [-1316.527] * (-1347.158) (-1325.131) (-1339.217) [-1321.040] -- 0:01:29
      651000 -- (-1341.435) (-1339.042) (-1339.675) [-1334.766] * (-1339.573) (-1334.468) (-1341.706) [-1327.090] -- 0:01:29
      651500 -- (-1341.940) (-1341.980) (-1347.454) [-1339.783] * (-1340.903) (-1332.405) (-1335.371) [-1330.599] -- 0:01:29
      652000 -- (-1338.638) (-1342.442) (-1339.014) [-1335.060] * (-1339.136) (-1337.037) [-1341.748] (-1350.780) -- 0:01:29
      652500 -- (-1345.976) [-1335.654] (-1356.103) (-1346.990) * (-1345.202) (-1322.364) [-1338.522] (-1343.555) -- 0:01:28
      653000 -- (-1334.075) (-1334.587) (-1337.129) [-1341.274] * (-1346.818) (-1330.803) [-1328.365] (-1345.061) -- 0:01:28
      653500 -- (-1333.026) (-1327.469) [-1319.790] (-1342.589) * (-1340.086) [-1332.272] (-1340.323) (-1343.688) -- 0:01:28
      654000 -- (-1341.714) (-1339.611) (-1343.198) [-1338.791] * (-1334.158) [-1333.045] (-1345.599) (-1346.559) -- 0:01:28
      654500 -- (-1339.312) (-1337.276) (-1337.144) [-1328.990] * [-1343.124] (-1335.286) (-1342.786) (-1342.782) -- 0:01:28
      655000 -- (-1339.677) [-1333.833] (-1347.514) (-1347.137) * (-1347.052) (-1342.519) [-1342.016] (-1341.493) -- 0:01:28

      Average standard deviation of split frequencies: 0.007144

      655500 -- (-1337.651) [-1330.179] (-1345.584) (-1353.741) * [-1321.532] (-1333.456) (-1346.446) (-1346.852) -- 0:01:28
      656000 -- (-1342.429) (-1338.855) [-1339.800] (-1347.746) * (-1334.932) [-1341.104] (-1339.343) (-1350.627) -- 0:01:28
      656500 -- (-1348.670) [-1327.250] (-1331.979) (-1345.260) * (-1346.998) (-1334.791) (-1347.055) [-1337.338] -- 0:01:27
      657000 -- (-1336.502) [-1342.957] (-1342.306) (-1339.975) * (-1348.946) [-1330.594] (-1345.861) (-1337.425) -- 0:01:27
      657500 -- [-1320.338] (-1345.347) (-1345.137) (-1337.649) * (-1341.137) [-1323.662] (-1334.401) (-1353.581) -- 0:01:27
      658000 -- (-1334.143) (-1344.536) [-1334.032] (-1351.640) * (-1343.880) [-1333.411] (-1340.087) (-1344.257) -- 0:01:27
      658500 -- [-1330.368] (-1345.197) (-1324.430) (-1346.221) * (-1335.385) (-1343.433) (-1345.316) [-1336.333] -- 0:01:27
      659000 -- (-1324.131) (-1349.898) [-1326.345] (-1342.366) * (-1336.363) (-1347.688) (-1341.340) [-1328.639] -- 0:01:27
      659500 -- (-1347.050) (-1339.715) [-1334.955] (-1343.030) * (-1351.083) (-1344.198) (-1335.153) [-1330.591] -- 0:01:27
      660000 -- [-1343.819] (-1346.722) (-1338.711) (-1343.427) * (-1358.923) (-1339.195) [-1334.506] (-1342.499) -- 0:01:27

      Average standard deviation of split frequencies: 0.007093

      660500 -- (-1343.506) (-1347.125) (-1343.903) [-1342.864] * [-1341.666] (-1343.624) (-1342.369) (-1336.513) -- 0:01:26
      661000 -- (-1347.078) (-1345.638) [-1341.001] (-1340.137) * (-1347.640) (-1348.721) (-1345.076) [-1335.994] -- 0:01:26
      661500 -- (-1342.514) (-1338.694) [-1313.262] (-1343.914) * (-1351.285) (-1333.181) (-1355.360) [-1318.750] -- 0:01:26
      662000 -- (-1353.005) (-1338.195) [-1313.348] (-1352.772) * (-1342.238) (-1346.653) (-1341.379) [-1322.266] -- 0:01:26
      662500 -- (-1352.063) (-1352.373) [-1317.866] (-1349.841) * (-1346.738) (-1344.486) (-1341.069) [-1328.767] -- 0:01:26
      663000 -- [-1328.158] (-1349.778) (-1323.579) (-1350.732) * (-1344.196) (-1343.020) (-1342.385) [-1332.801] -- 0:01:26
      663500 -- (-1337.502) (-1340.307) [-1329.067] (-1341.445) * (-1346.668) (-1332.603) [-1327.782] (-1341.315) -- 0:01:26
      664000 -- (-1340.084) (-1330.441) [-1329.238] (-1345.432) * (-1340.650) [-1344.560] (-1347.562) (-1334.839) -- 0:01:26
      664500 -- (-1341.572) [-1334.622] (-1328.877) (-1350.284) * (-1345.735) (-1356.281) (-1345.402) [-1326.199] -- 0:01:25
      665000 -- (-1343.136) (-1344.946) [-1320.582] (-1338.483) * (-1337.233) [-1334.276] (-1353.010) (-1347.966) -- 0:01:25

      Average standard deviation of split frequencies: 0.007370

      665500 -- (-1343.435) (-1341.664) [-1327.914] (-1349.778) * (-1344.672) (-1339.081) (-1344.797) [-1338.650] -- 0:01:25
      666000 -- (-1350.753) (-1352.341) [-1325.076] (-1347.923) * (-1350.889) [-1330.494] (-1333.399) (-1348.746) -- 0:01:25
      666500 -- [-1335.368] (-1345.694) (-1341.784) (-1344.514) * (-1342.375) [-1320.086] (-1344.870) (-1328.767) -- 0:01:25
      667000 -- (-1340.750) [-1331.135] (-1333.671) (-1346.864) * (-1347.066) [-1335.625] (-1338.586) (-1352.662) -- 0:01:25
      667500 -- (-1345.229) (-1338.180) [-1341.237] (-1352.998) * (-1350.817) (-1339.323) [-1321.336] (-1346.077) -- 0:01:25
      668000 -- [-1336.632] (-1347.828) (-1334.433) (-1349.770) * (-1349.791) (-1352.858) [-1318.093] (-1343.949) -- 0:01:24
      668500 -- (-1353.401) (-1347.003) [-1343.268] (-1362.874) * (-1349.732) (-1334.033) [-1309.309] (-1343.119) -- 0:01:24
      669000 -- [-1337.160] (-1352.880) (-1349.449) (-1343.816) * (-1350.027) (-1339.176) [-1311.100] (-1338.093) -- 0:01:24
      669500 -- (-1347.872) (-1344.049) [-1340.014] (-1347.117) * (-1332.918) (-1331.170) (-1306.658) [-1336.436] -- 0:01:24
      670000 -- (-1350.685) (-1351.316) (-1349.781) [-1344.991] * (-1350.455) (-1336.876) [-1321.989] (-1347.229) -- 0:01:24

      Average standard deviation of split frequencies: 0.007360

      670500 -- (-1354.876) [-1348.848] (-1344.721) (-1339.898) * (-1344.833) (-1337.573) [-1339.573] (-1335.823) -- 0:01:24
      671000 -- (-1351.349) (-1351.328) (-1345.783) [-1338.948] * (-1336.886) (-1337.490) [-1332.840] (-1347.443) -- 0:01:24
      671500 -- (-1321.043) (-1349.708) [-1338.146] (-1345.277) * (-1334.123) (-1338.179) [-1317.345] (-1349.038) -- 0:01:24
      672000 -- (-1326.527) [-1323.649] (-1344.884) (-1338.747) * (-1343.521) (-1331.298) [-1327.797] (-1340.090) -- 0:01:23
      672500 -- [-1325.643] (-1345.329) (-1347.149) (-1328.584) * (-1339.300) [-1321.941] (-1351.180) (-1334.219) -- 0:01:23
      673000 -- (-1328.338) [-1343.798] (-1343.999) (-1341.803) * (-1344.725) [-1332.927] (-1343.704) (-1345.778) -- 0:01:23
      673500 -- (-1331.449) (-1332.114) (-1356.998) [-1343.166] * [-1325.248] (-1344.000) (-1338.678) (-1344.582) -- 0:01:23
      674000 -- [-1335.443] (-1348.175) (-1349.394) (-1342.754) * (-1339.783) (-1353.229) (-1337.995) [-1328.788] -- 0:01:23
      674500 -- (-1333.545) [-1337.688] (-1335.627) (-1347.595) * (-1345.885) (-1342.331) (-1336.668) [-1318.060] -- 0:01:23
      675000 -- (-1332.916) [-1333.057] (-1347.190) (-1350.786) * (-1331.522) (-1340.559) [-1340.364] (-1340.231) -- 0:01:23

      Average standard deviation of split frequencies: 0.007794

      675500 -- (-1340.702) (-1342.972) (-1342.967) [-1337.866] * (-1342.493) [-1344.375] (-1339.163) (-1353.828) -- 0:01:23
      676000 -- (-1340.651) [-1337.465] (-1356.808) (-1343.823) * [-1323.994] (-1347.266) (-1335.620) (-1340.301) -- 0:01:22
      676500 -- (-1341.129) (-1344.732) (-1340.836) [-1338.812] * [-1326.533] (-1348.431) (-1339.480) (-1334.972) -- 0:01:22
      677000 -- (-1338.633) (-1341.009) (-1353.035) [-1334.611] * [-1336.376] (-1341.418) (-1352.494) (-1336.500) -- 0:01:22
      677500 -- (-1343.754) (-1352.310) (-1331.634) [-1322.907] * (-1347.667) (-1337.174) [-1328.504] (-1342.940) -- 0:01:22
      678000 -- (-1346.318) (-1334.716) (-1340.246) [-1338.058] * (-1343.472) (-1341.223) [-1328.344] (-1344.779) -- 0:01:22
      678500 -- (-1337.417) [-1339.837] (-1341.580) (-1349.080) * [-1327.757] (-1340.450) (-1341.861) (-1357.228) -- 0:01:22
      679000 -- (-1345.683) (-1354.199) [-1341.073] (-1349.797) * [-1317.101] (-1338.324) (-1351.405) (-1342.581) -- 0:01:22
      679500 -- (-1356.404) [-1333.917] (-1335.162) (-1340.093) * (-1316.443) (-1343.752) (-1348.103) [-1308.194] -- 0:01:22
      680000 -- (-1345.315) [-1315.759] (-1342.048) (-1341.318) * (-1332.151) (-1325.004) (-1336.904) [-1329.458] -- 0:01:21

      Average standard deviation of split frequencies: 0.008189

      680500 -- (-1343.743) [-1326.226] (-1340.548) (-1346.120) * (-1347.449) (-1344.515) (-1337.428) [-1325.488] -- 0:01:21
      681000 -- (-1359.366) [-1333.895] (-1331.811) (-1345.477) * (-1349.479) (-1350.669) [-1332.304] (-1339.584) -- 0:01:21
      681500 -- (-1337.790) (-1340.307) [-1340.572] (-1340.993) * (-1341.821) (-1352.559) (-1340.903) [-1332.280] -- 0:01:21
      682000 -- (-1337.306) (-1347.785) [-1330.724] (-1345.103) * (-1346.554) (-1354.296) [-1332.736] (-1343.279) -- 0:01:21
      682500 -- (-1333.456) (-1350.371) (-1342.685) [-1341.768] * (-1347.652) (-1360.459) [-1329.205] (-1336.166) -- 0:01:21
      683000 -- (-1327.094) (-1350.120) [-1344.833] (-1345.588) * (-1346.249) (-1341.056) [-1338.714] (-1336.673) -- 0:01:21
      683500 -- (-1334.899) [-1328.589] (-1351.182) (-1348.069) * (-1340.636) (-1340.043) (-1332.981) [-1318.850] -- 0:01:21
      684000 -- [-1333.959] (-1341.193) (-1349.792) (-1353.834) * (-1351.652) (-1350.450) (-1345.481) [-1334.834] -- 0:01:20
      684500 -- (-1337.574) (-1341.148) [-1342.060] (-1345.629) * (-1348.406) (-1341.336) (-1339.677) [-1325.673] -- 0:01:20
      685000 -- [-1340.001] (-1337.736) (-1346.479) (-1342.067) * (-1350.113) (-1346.323) (-1343.394) [-1325.913] -- 0:01:20

      Average standard deviation of split frequencies: 0.007438

      685500 -- (-1346.378) [-1334.590] (-1343.748) (-1353.889) * (-1343.217) (-1341.632) (-1333.449) [-1317.939] -- 0:01:20
      686000 -- (-1335.114) [-1343.684] (-1339.232) (-1343.162) * (-1327.896) (-1349.090) [-1329.517] (-1339.661) -- 0:01:20
      686500 -- [-1344.010] (-1347.355) (-1354.542) (-1340.849) * [-1335.542] (-1344.942) (-1333.379) (-1330.655) -- 0:01:20
      687000 -- [-1344.798] (-1341.666) (-1342.374) (-1348.439) * (-1337.208) (-1341.873) (-1340.818) [-1342.052] -- 0:01:20
      687500 -- (-1347.767) [-1337.127] (-1340.993) (-1347.614) * (-1340.730) (-1359.028) [-1334.265] (-1350.362) -- 0:01:20
      688000 -- (-1345.344) [-1336.271] (-1348.034) (-1345.114) * (-1358.566) (-1354.327) [-1329.047] (-1343.972) -- 0:01:19
      688500 -- [-1323.081] (-1342.593) (-1347.979) (-1351.212) * (-1339.994) (-1335.452) [-1323.176] (-1344.707) -- 0:01:19
      689000 -- (-1332.619) [-1325.467] (-1349.834) (-1347.246) * (-1331.993) (-1336.577) [-1318.121] (-1353.320) -- 0:01:19
      689500 -- [-1339.240] (-1339.801) (-1347.251) (-1349.095) * (-1334.164) (-1343.103) [-1322.987] (-1344.660) -- 0:01:19
      690000 -- (-1347.073) [-1343.624] (-1342.646) (-1348.377) * (-1338.275) (-1346.295) [-1323.974] (-1339.782) -- 0:01:19

      Average standard deviation of split frequencies: 0.007106

      690500 -- (-1345.877) [-1337.900] (-1347.609) (-1344.316) * (-1345.337) (-1340.392) [-1312.334] (-1359.033) -- 0:01:19
      691000 -- (-1345.301) [-1329.325] (-1334.250) (-1342.823) * (-1334.000) (-1352.800) [-1311.802] (-1340.674) -- 0:01:19
      691500 -- [-1334.306] (-1335.664) (-1349.390) (-1348.998) * [-1328.493] (-1355.792) (-1330.300) (-1357.992) -- 0:01:18
      692000 -- [-1347.275] (-1332.031) (-1346.078) (-1357.953) * (-1336.039) [-1336.870] (-1343.669) (-1338.982) -- 0:01:18
      692500 -- [-1337.621] (-1338.316) (-1333.866) (-1354.022) * (-1348.000) (-1346.456) [-1341.562] (-1345.103) -- 0:01:18
      693000 -- (-1357.128) (-1330.190) [-1313.880] (-1343.969) * (-1348.847) (-1341.228) (-1351.076) [-1331.020] -- 0:01:18
      693500 -- (-1343.889) (-1329.681) [-1327.615] (-1343.611) * (-1358.751) (-1337.856) (-1338.817) [-1329.825] -- 0:01:18
      694000 -- (-1340.550) [-1308.299] (-1347.600) (-1348.317) * (-1354.492) (-1345.171) (-1343.473) [-1340.568] -- 0:01:18
      694500 -- (-1350.188) [-1329.883] (-1349.770) (-1350.748) * (-1351.570) (-1361.771) (-1350.607) [-1335.864] -- 0:01:18
      695000 -- [-1339.783] (-1341.425) (-1339.126) (-1341.963) * (-1337.784) [-1347.642] (-1349.926) (-1341.620) -- 0:01:18

      Average standard deviation of split frequencies: 0.007490

      695500 -- (-1350.790) [-1347.674] (-1347.626) (-1347.971) * (-1338.669) (-1326.386) [-1322.074] (-1348.173) -- 0:01:17
      696000 -- (-1350.773) (-1346.266) [-1316.811] (-1349.388) * (-1348.208) [-1318.963] (-1336.722) (-1333.434) -- 0:01:17
      696500 -- (-1355.893) (-1341.610) [-1323.609] (-1346.744) * (-1335.244) (-1329.546) (-1344.414) [-1339.951] -- 0:01:17
      697000 -- (-1347.192) (-1344.259) [-1334.750] (-1344.795) * (-1343.676) [-1330.145] (-1343.697) (-1354.855) -- 0:01:17
      697500 -- (-1339.009) (-1347.813) [-1327.980] (-1350.390) * (-1341.279) [-1316.877] (-1347.474) (-1347.486) -- 0:01:17
      698000 -- [-1337.202] (-1354.843) (-1343.108) (-1346.321) * (-1340.910) [-1335.080] (-1358.128) (-1352.911) -- 0:01:17
      698500 -- [-1338.482] (-1351.045) (-1343.239) (-1350.009) * (-1356.704) [-1321.779] (-1347.307) (-1343.844) -- 0:01:17
      699000 -- (-1344.338) (-1347.145) [-1345.249] (-1353.005) * (-1342.858) [-1329.535] (-1354.867) (-1344.519) -- 0:01:17
      699500 -- [-1341.452] (-1350.748) (-1340.115) (-1348.610) * (-1339.328) (-1335.157) (-1355.332) [-1343.988] -- 0:01:16
      700000 -- [-1331.849] (-1335.647) (-1346.494) (-1348.391) * (-1352.643) [-1333.538] (-1345.635) (-1338.202) -- 0:01:16

      Average standard deviation of split frequencies: 0.006807

      700500 -- [-1338.198] (-1344.755) (-1350.675) (-1342.511) * [-1340.252] (-1344.215) (-1345.858) (-1341.944) -- 0:01:16
      701000 -- [-1336.234] (-1346.139) (-1338.006) (-1342.485) * (-1339.928) [-1320.759] (-1343.225) (-1333.082) -- 0:01:16
      701500 -- (-1345.434) [-1341.120] (-1346.634) (-1347.377) * (-1345.995) [-1320.299] (-1347.031) (-1344.849) -- 0:01:16
      702000 -- (-1343.388) (-1352.872) (-1354.654) [-1343.882] * (-1342.007) (-1344.225) [-1329.571] (-1337.388) -- 0:01:16
      702500 -- (-1345.120) (-1358.335) [-1347.912] (-1343.152) * (-1350.258) [-1325.003] (-1349.858) (-1350.010) -- 0:01:16
      703000 -- (-1346.571) (-1358.416) (-1333.979) [-1343.277] * (-1334.819) (-1349.760) [-1350.663] (-1341.425) -- 0:01:16
      703500 -- (-1350.695) (-1346.964) [-1340.202] (-1349.693) * (-1338.925) (-1340.746) (-1352.856) [-1339.198] -- 0:01:15
      704000 -- (-1351.609) (-1346.415) [-1339.957] (-1354.345) * (-1338.805) [-1334.913] (-1337.363) (-1343.445) -- 0:01:15
      704500 -- (-1343.367) (-1356.619) (-1341.545) [-1335.382] * (-1351.560) [-1329.805] (-1343.369) (-1334.656) -- 0:01:15
      705000 -- [-1336.649] (-1346.121) (-1338.634) (-1346.732) * (-1333.571) (-1328.657) (-1341.099) [-1332.925] -- 0:01:15

      Average standard deviation of split frequencies: 0.007679

      705500 -- [-1333.934] (-1354.444) (-1326.998) (-1348.023) * (-1341.979) [-1331.744] (-1346.370) (-1352.427) -- 0:01:15
      706000 -- (-1332.686) (-1347.823) [-1319.798] (-1349.443) * (-1347.231) (-1339.640) (-1341.063) [-1327.793] -- 0:01:15
      706500 -- (-1338.002) (-1349.666) [-1338.472] (-1363.525) * (-1344.621) (-1343.047) (-1343.316) [-1336.829] -- 0:01:15
      707000 -- (-1349.125) (-1341.073) [-1330.914] (-1343.131) * [-1333.797] (-1342.192) (-1339.786) (-1342.279) -- 0:01:15
      707500 -- (-1337.461) (-1342.512) [-1324.120] (-1346.055) * (-1339.960) [-1343.951] (-1349.957) (-1346.385) -- 0:01:14
      708000 -- (-1345.587) (-1339.546) [-1314.656] (-1357.124) * (-1337.957) (-1344.837) (-1339.559) [-1323.567] -- 0:01:14
      708500 -- (-1342.482) (-1344.821) [-1304.345] (-1340.018) * (-1343.905) (-1337.645) [-1336.591] (-1336.920) -- 0:01:14
      709000 -- (-1350.974) (-1346.562) [-1314.600] (-1334.981) * [-1331.227] (-1336.323) (-1339.750) (-1348.707) -- 0:01:14
      709500 -- (-1350.259) (-1339.387) [-1325.978] (-1336.122) * [-1317.314] (-1350.228) (-1344.814) (-1335.996) -- 0:01:14
      710000 -- (-1345.780) (-1344.936) [-1323.140] (-1343.518) * (-1343.526) (-1343.336) (-1337.201) [-1324.946] -- 0:01:14

      Average standard deviation of split frequencies: 0.007921

      710500 -- (-1350.877) (-1358.055) [-1316.243] (-1343.237) * (-1337.286) (-1343.174) [-1321.341] (-1345.108) -- 0:01:14
      711000 -- (-1341.422) (-1340.396) [-1334.973] (-1344.288) * (-1342.614) (-1342.038) [-1317.164] (-1339.669) -- 0:01:13
      711500 -- (-1344.247) [-1342.963] (-1343.710) (-1334.578) * (-1345.908) (-1358.769) [-1321.608] (-1349.720) -- 0:01:13
      712000 -- (-1337.655) [-1334.070] (-1346.728) (-1337.591) * (-1363.557) (-1350.702) [-1336.703] (-1325.893) -- 0:01:13
      712500 -- (-1339.893) (-1334.547) (-1347.408) [-1342.057] * (-1342.109) (-1345.101) (-1349.022) [-1328.419] -- 0:01:13
      713000 -- (-1337.048) (-1339.284) (-1349.731) [-1326.248] * (-1349.206) [-1333.436] (-1348.992) (-1336.685) -- 0:01:13
      713500 -- (-1341.868) [-1331.524] (-1344.390) (-1337.163) * (-1346.392) (-1331.791) [-1339.931] (-1324.048) -- 0:01:13
      714000 -- (-1344.223) [-1331.894] (-1354.432) (-1339.861) * (-1343.611) [-1328.028] (-1347.385) (-1343.556) -- 0:01:13
      714500 -- (-1345.065) [-1322.574] (-1350.876) (-1351.894) * (-1341.218) (-1349.562) [-1344.446] (-1347.304) -- 0:01:13
      715000 -- (-1350.768) (-1342.153) [-1344.139] (-1340.024) * [-1337.061] (-1344.282) (-1334.297) (-1336.344) -- 0:01:12

      Average standard deviation of split frequencies: 0.008133

      715500 -- (-1337.659) (-1341.594) (-1351.569) [-1340.505] * [-1334.498] (-1342.874) (-1340.862) (-1339.748) -- 0:01:12
      716000 -- [-1325.799] (-1329.691) (-1345.460) (-1343.680) * [-1328.296] (-1339.768) (-1341.467) (-1354.223) -- 0:01:12
      716500 -- [-1342.415] (-1334.827) (-1348.014) (-1352.251) * [-1329.350] (-1356.075) (-1340.953) (-1343.462) -- 0:01:12
      717000 -- [-1321.750] (-1331.812) (-1343.338) (-1342.302) * [-1328.687] (-1349.577) (-1342.327) (-1319.916) -- 0:01:12
      717500 -- (-1337.346) [-1327.630] (-1350.343) (-1330.424) * (-1364.198) (-1345.643) (-1341.530) [-1325.975] -- 0:01:12
      718000 -- (-1349.055) (-1342.135) (-1336.574) [-1320.528] * (-1343.697) (-1340.761) (-1341.514) [-1337.744] -- 0:01:12
      718500 -- (-1344.686) (-1349.360) (-1332.553) [-1329.194] * (-1340.886) (-1342.981) [-1342.108] (-1333.238) -- 0:01:12
      719000 -- (-1355.047) (-1343.067) [-1337.165] (-1340.602) * (-1345.687) (-1349.429) [-1342.101] (-1338.842) -- 0:01:11
      719500 -- (-1338.031) (-1349.537) [-1328.424] (-1346.376) * [-1323.139] (-1341.563) (-1341.327) (-1344.068) -- 0:01:11
      720000 -- (-1339.866) (-1350.762) [-1314.594] (-1343.186) * (-1342.269) [-1321.241] (-1345.729) (-1343.427) -- 0:01:11

      Average standard deviation of split frequencies: 0.007696

      720500 -- [-1340.604] (-1346.464) (-1341.606) (-1349.938) * (-1345.228) (-1348.160) [-1340.679] (-1338.796) -- 0:01:11
      721000 -- (-1341.792) (-1348.592) (-1322.058) [-1340.493] * (-1349.905) (-1341.471) (-1343.329) [-1343.755] -- 0:01:11
      721500 -- (-1345.421) (-1359.814) [-1312.812] (-1337.512) * (-1346.014) [-1335.211] (-1340.905) (-1334.821) -- 0:01:11
      722000 -- (-1339.170) (-1348.086) [-1317.707] (-1341.365) * (-1339.486) (-1316.467) [-1343.204] (-1341.637) -- 0:01:11
      722500 -- (-1348.559) (-1351.776) [-1338.066] (-1346.776) * (-1347.405) [-1336.894] (-1338.106) (-1354.930) -- 0:01:11
      723000 -- [-1338.736] (-1338.597) (-1341.079) (-1344.079) * (-1346.529) [-1334.885] (-1351.964) (-1335.941) -- 0:01:10
      723500 -- [-1339.239] (-1340.644) (-1349.500) (-1347.982) * (-1339.498) [-1341.477] (-1347.750) (-1344.443) -- 0:01:10
      724000 -- [-1336.620] (-1343.702) (-1341.872) (-1348.492) * (-1352.416) [-1321.378] (-1345.579) (-1344.999) -- 0:01:10
      724500 -- [-1341.155] (-1349.890) (-1347.796) (-1337.607) * (-1351.299) [-1324.537] (-1341.807) (-1348.788) -- 0:01:10
      725000 -- (-1338.540) [-1345.173] (-1339.247) (-1338.637) * (-1343.262) (-1337.945) [-1343.060] (-1346.681) -- 0:01:10

      Average standard deviation of split frequencies: 0.007868

      725500 -- [-1339.290] (-1344.865) (-1342.421) (-1341.969) * (-1350.257) [-1337.435] (-1335.802) (-1340.244) -- 0:01:10
      726000 -- [-1336.169] (-1355.378) (-1344.988) (-1343.224) * (-1338.625) (-1353.566) [-1329.601] (-1342.144) -- 0:01:10
      726500 -- [-1325.395] (-1340.023) (-1347.157) (-1349.349) * (-1344.812) (-1349.831) (-1336.865) [-1327.158] -- 0:01:10
      727000 -- (-1340.338) (-1347.525) (-1339.517) [-1331.315] * (-1354.344) (-1352.726) (-1347.448) [-1324.331] -- 0:01:09
      727500 -- (-1351.960) [-1335.535] (-1349.338) (-1319.988) * (-1349.756) (-1338.341) (-1338.029) [-1328.312] -- 0:01:09
      728000 -- (-1350.170) (-1341.041) (-1343.404) [-1331.320] * [-1335.441] (-1340.356) (-1343.476) (-1318.219) -- 0:01:09
      728500 -- (-1340.923) (-1348.518) (-1350.418) [-1339.981] * [-1331.955] (-1352.128) (-1343.750) (-1328.606) -- 0:01:09
      729000 -- (-1349.077) [-1339.802] (-1338.158) (-1341.574) * (-1349.371) [-1347.463] (-1341.859) (-1327.057) -- 0:01:09
      729500 -- (-1345.850) (-1339.102) (-1337.661) [-1326.183] * (-1340.669) [-1338.636] (-1341.719) (-1353.716) -- 0:01:09
      730000 -- [-1337.246] (-1350.794) (-1341.766) (-1335.776) * (-1345.732) [-1340.170] (-1349.062) (-1348.056) -- 0:01:09

      Average standard deviation of split frequencies: 0.007970

      730500 -- (-1330.803) (-1345.828) (-1356.475) [-1326.060] * (-1341.822) [-1337.984] (-1355.411) (-1343.982) -- 0:01:08
      731000 -- (-1339.394) [-1329.633] (-1350.260) (-1320.219) * (-1340.685) (-1347.093) [-1334.071] (-1343.409) -- 0:01:08
      731500 -- (-1348.330) [-1323.800] (-1358.897) (-1326.379) * (-1346.158) [-1337.844] (-1347.893) (-1348.726) -- 0:01:08
      732000 -- (-1349.436) [-1326.331] (-1354.130) (-1328.238) * (-1357.350) [-1319.797] (-1348.271) (-1361.266) -- 0:01:08
      732500 -- (-1346.325) (-1336.131) (-1348.176) [-1314.512] * (-1346.308) [-1340.950] (-1345.218) (-1352.741) -- 0:01:08
      733000 -- (-1344.729) (-1341.149) [-1340.020] (-1313.896) * (-1344.584) [-1326.325] (-1336.716) (-1345.727) -- 0:01:08
      733500 -- (-1337.445) (-1356.048) (-1348.952) [-1325.849] * (-1340.871) [-1332.845] (-1343.173) (-1351.355) -- 0:01:08
      734000 -- (-1331.561) (-1348.129) (-1351.365) [-1313.655] * (-1345.492) [-1341.340] (-1347.968) (-1346.071) -- 0:01:08
      734500 -- (-1339.403) (-1351.770) (-1360.377) [-1325.536] * (-1337.744) [-1325.752] (-1344.372) (-1340.998) -- 0:01:07
      735000 -- (-1347.234) (-1341.582) (-1335.443) [-1323.451] * (-1346.852) (-1346.084) [-1341.269] (-1363.935) -- 0:01:07

      Average standard deviation of split frequencies: 0.008176

      735500 -- (-1352.796) (-1351.535) (-1336.671) [-1333.166] * [-1338.175] (-1344.080) (-1358.741) (-1352.720) -- 0:01:07
      736000 -- (-1342.505) [-1337.656] (-1345.564) (-1353.829) * [-1324.830] (-1340.703) (-1342.781) (-1357.752) -- 0:01:07
      736500 -- (-1354.293) (-1339.049) (-1342.925) [-1340.768] * [-1340.674] (-1345.493) (-1336.525) (-1357.858) -- 0:01:07
      737000 -- (-1351.782) (-1339.750) [-1342.368] (-1345.603) * (-1344.654) [-1339.716] (-1341.912) (-1350.486) -- 0:01:07
      737500 -- (-1349.654) [-1337.672] (-1352.897) (-1347.201) * (-1356.685) [-1337.586] (-1344.432) (-1338.743) -- 0:01:07
      738000 -- (-1343.862) [-1323.535] (-1342.827) (-1338.671) * (-1335.374) [-1329.139] (-1339.840) (-1345.627) -- 0:01:07
      738500 -- (-1343.323) [-1326.307] (-1355.811) (-1351.550) * (-1348.304) [-1323.448] (-1339.896) (-1350.320) -- 0:01:06
      739000 -- (-1336.474) (-1336.974) [-1343.156] (-1348.952) * [-1344.707] (-1348.647) (-1344.319) (-1340.050) -- 0:01:06
      739500 -- (-1338.232) [-1337.376] (-1347.191) (-1332.301) * (-1342.187) [-1337.264] (-1338.131) (-1348.934) -- 0:01:06
      740000 -- (-1333.916) (-1354.491) (-1350.933) [-1332.763] * [-1336.709] (-1347.867) (-1328.898) (-1336.962) -- 0:01:06

      Average standard deviation of split frequencies: 0.008087

      740500 -- (-1345.194) (-1346.065) (-1342.679) [-1322.522] * (-1344.005) (-1346.220) [-1316.510] (-1347.284) -- 0:01:06
      741000 -- (-1337.653) (-1334.090) (-1335.526) [-1328.455] * [-1326.693] (-1341.253) (-1338.587) (-1346.062) -- 0:01:06
      741500 -- (-1346.978) (-1342.279) (-1340.563) [-1332.680] * [-1314.171] (-1357.817) (-1345.822) (-1351.931) -- 0:01:06
      742000 -- (-1343.242) [-1330.245] (-1338.242) (-1346.656) * [-1316.505] (-1348.203) (-1336.692) (-1341.443) -- 0:01:06
      742500 -- (-1353.972) [-1323.233] (-1338.052) (-1338.672) * [-1314.618] (-1343.662) (-1336.430) (-1346.121) -- 0:01:05
      743000 -- (-1334.421) (-1352.982) [-1335.962] (-1343.947) * [-1339.972] (-1354.914) (-1330.705) (-1347.500) -- 0:01:05
      743500 -- (-1341.054) [-1347.355] (-1349.914) (-1353.329) * [-1328.978] (-1345.132) (-1335.067) (-1346.657) -- 0:01:05
      744000 -- [-1327.968] (-1345.303) (-1343.744) (-1346.217) * [-1333.478] (-1345.787) (-1337.031) (-1343.501) -- 0:01:05
      744500 -- (-1339.551) (-1341.670) [-1330.485] (-1343.374) * (-1353.357) [-1340.431] (-1339.739) (-1352.490) -- 0:01:05
      745000 -- (-1337.658) (-1343.576) [-1329.672] (-1346.739) * [-1335.614] (-1348.382) (-1338.504) (-1344.648) -- 0:01:05

      Average standard deviation of split frequencies: 0.007546

      745500 -- [-1340.045] (-1344.799) (-1337.950) (-1345.329) * (-1338.428) (-1348.279) [-1337.046] (-1346.454) -- 0:01:05
      746000 -- [-1345.100] (-1348.170) (-1345.116) (-1344.718) * [-1327.622] (-1345.423) (-1333.211) (-1349.343) -- 0:01:05
      746500 -- (-1340.660) [-1326.543] (-1353.265) (-1345.162) * (-1339.261) (-1331.396) [-1317.703] (-1342.272) -- 0:01:04
      747000 -- (-1342.807) [-1307.302] (-1344.504) (-1340.396) * (-1345.396) (-1344.137) [-1328.808] (-1353.705) -- 0:01:04
      747500 -- [-1339.710] (-1323.061) (-1335.237) (-1328.087) * (-1354.052) [-1339.204] (-1340.420) (-1345.273) -- 0:01:04
      748000 -- (-1345.631) (-1338.654) (-1340.636) [-1331.973] * [-1334.126] (-1346.959) (-1347.308) (-1344.401) -- 0:01:04
      748500 -- (-1343.007) (-1346.379) [-1327.732] (-1341.280) * [-1343.784] (-1340.018) (-1352.145) (-1345.820) -- 0:01:04
      749000 -- (-1340.494) (-1350.997) (-1342.373) [-1338.572] * (-1345.485) (-1338.283) (-1355.788) [-1333.901] -- 0:01:04
      749500 -- (-1330.943) (-1345.549) [-1344.362] (-1340.980) * (-1341.858) (-1349.094) (-1344.075) [-1333.267] -- 0:01:04
      750000 -- (-1334.401) (-1352.385) (-1342.473) [-1331.249] * (-1344.801) (-1342.159) (-1347.878) [-1331.857] -- 0:01:04

      Average standard deviation of split frequencies: 0.007573

      750500 -- (-1341.418) (-1343.700) (-1346.419) [-1329.581] * (-1352.419) (-1341.000) (-1351.928) [-1326.154] -- 0:01:03
      751000 -- [-1323.361] (-1347.635) (-1339.879) (-1338.343) * (-1353.028) (-1342.216) (-1350.588) [-1325.341] -- 0:01:03
      751500 -- (-1353.486) (-1341.465) [-1334.944] (-1343.640) * (-1346.423) [-1336.633] (-1342.111) (-1330.146) -- 0:01:03
      752000 -- (-1346.687) (-1337.827) [-1343.484] (-1343.786) * (-1341.147) [-1341.760] (-1351.456) (-1333.297) -- 0:01:03
      752500 -- (-1362.720) (-1336.729) [-1318.474] (-1330.604) * (-1344.561) (-1346.505) (-1336.977) [-1327.904] -- 0:01:03
      753000 -- (-1350.699) (-1349.220) [-1325.811] (-1340.115) * (-1339.966) (-1343.489) (-1349.670) [-1326.344] -- 0:01:03
      753500 -- (-1339.311) (-1350.206) [-1312.692] (-1336.902) * [-1338.108] (-1348.732) (-1348.444) (-1343.926) -- 0:01:03
      754000 -- (-1342.230) (-1340.156) [-1330.698] (-1330.898) * [-1326.291] (-1351.011) (-1344.168) (-1339.856) -- 0:01:02
      754500 -- (-1339.990) (-1360.355) [-1318.335] (-1344.197) * [-1328.479] (-1350.586) (-1334.422) (-1348.626) -- 0:01:02
      755000 -- (-1336.974) (-1352.590) (-1323.997) [-1335.644] * [-1315.278] (-1357.729) (-1344.260) (-1344.619) -- 0:01:02

      Average standard deviation of split frequencies: 0.007006

      755500 -- (-1336.248) (-1351.791) (-1338.793) [-1333.692] * [-1323.594] (-1350.134) (-1347.379) (-1342.565) -- 0:01:02
      756000 -- [-1320.715] (-1355.098) (-1331.144) (-1338.872) * [-1308.612] (-1356.115) (-1342.979) (-1340.152) -- 0:01:02
      756500 -- [-1339.746] (-1342.509) (-1352.565) (-1330.449) * [-1311.149] (-1330.599) (-1338.106) (-1352.338) -- 0:01:02
      757000 -- (-1329.096) (-1346.067) (-1336.937) [-1343.827] * [-1323.463] (-1329.838) (-1342.267) (-1346.227) -- 0:01:02
      757500 -- [-1329.753] (-1351.709) (-1340.756) (-1346.440) * (-1348.940) [-1332.770] (-1340.597) (-1338.536) -- 0:01:02
      758000 -- [-1330.439] (-1346.128) (-1349.651) (-1341.307) * (-1342.258) (-1344.975) [-1337.198] (-1346.156) -- 0:01:01
      758500 -- (-1342.004) [-1334.739] (-1330.979) (-1344.813) * [-1348.849] (-1345.794) (-1345.530) (-1337.004) -- 0:01:01
      759000 -- (-1343.127) (-1338.083) (-1336.676) [-1338.858] * (-1348.954) [-1336.620] (-1347.845) (-1339.397) -- 0:01:01
      759500 -- (-1349.566) (-1337.728) (-1335.278) [-1320.903] * [-1327.079] (-1347.540) (-1340.541) (-1336.202) -- 0:01:01
      760000 -- (-1335.473) (-1343.593) (-1341.268) [-1315.466] * [-1333.935] (-1342.880) (-1340.684) (-1341.688) -- 0:01:01

      Average standard deviation of split frequencies: 0.006598

      760500 -- (-1327.629) (-1340.978) [-1330.148] (-1331.277) * [-1332.892] (-1345.602) (-1329.506) (-1340.553) -- 0:01:01
      761000 -- (-1346.571) (-1347.865) (-1342.863) [-1313.925] * [-1336.967] (-1333.837) (-1332.179) (-1349.542) -- 0:01:01
      761500 -- [-1318.224] (-1349.963) (-1348.762) (-1329.612) * (-1340.717) [-1324.578] (-1339.406) (-1356.848) -- 0:01:01
      762000 -- [-1313.901] (-1353.938) (-1334.718) (-1329.970) * (-1352.621) [-1321.250] (-1351.660) (-1342.886) -- 0:01:00
      762500 -- [-1325.502] (-1345.648) (-1341.412) (-1340.011) * (-1345.326) [-1348.360] (-1350.449) (-1343.734) -- 0:01:00
      763000 -- [-1317.771] (-1346.432) (-1344.043) (-1339.190) * [-1335.341] (-1344.525) (-1343.964) (-1353.921) -- 0:01:00
      763500 -- (-1340.324) [-1332.146] (-1347.605) (-1354.871) * [-1325.810] (-1342.476) (-1345.176) (-1341.433) -- 0:01:00
      764000 -- [-1335.933] (-1345.999) (-1325.932) (-1349.159) * [-1338.627] (-1337.404) (-1347.278) (-1343.665) -- 0:01:00
      764500 -- (-1347.810) [-1324.653] (-1332.940) (-1345.310) * [-1334.729] (-1337.015) (-1355.987) (-1350.171) -- 0:01:00
      765000 -- (-1344.747) [-1319.281] (-1332.324) (-1345.377) * (-1342.637) (-1344.471) (-1359.755) [-1331.446] -- 0:01:00

      Average standard deviation of split frequencies: 0.006444

      765500 -- (-1342.460) [-1313.020] (-1323.170) (-1339.600) * [-1328.796] (-1344.949) (-1339.507) (-1353.353) -- 0:01:00
      766000 -- (-1337.575) (-1310.354) [-1327.401] (-1344.532) * [-1329.126] (-1347.152) (-1339.477) (-1341.913) -- 0:00:59
      766500 -- (-1352.125) [-1326.401] (-1341.532) (-1338.704) * (-1352.744) (-1351.464) [-1325.417] (-1333.422) -- 0:00:59
      767000 -- (-1345.414) (-1352.818) (-1336.937) [-1341.321] * (-1345.026) [-1341.028] (-1343.674) (-1341.819) -- 0:00:59
      767500 -- (-1349.646) (-1348.169) [-1337.788] (-1337.302) * (-1342.056) (-1342.689) (-1344.242) [-1330.875] -- 0:00:59
      768000 -- (-1337.867) (-1350.241) [-1323.111] (-1341.184) * (-1351.320) (-1345.977) (-1346.311) [-1337.943] -- 0:00:59
      768500 -- [-1333.836] (-1345.092) (-1333.009) (-1345.163) * (-1342.472) (-1350.616) (-1340.775) [-1325.949] -- 0:00:59
      769000 -- (-1337.798) (-1340.570) [-1321.811] (-1345.466) * (-1336.913) (-1346.000) (-1339.534) [-1324.166] -- 0:00:59
      769500 -- (-1344.975) (-1345.779) [-1317.706] (-1352.858) * (-1343.083) (-1347.310) (-1342.744) [-1324.805] -- 0:00:59
      770000 -- (-1347.367) (-1338.367) [-1333.811] (-1341.631) * (-1343.023) (-1345.761) (-1357.754) [-1331.377] -- 0:00:58

      Average standard deviation of split frequencies: 0.006980

      770500 -- (-1349.365) (-1349.824) [-1324.823] (-1338.662) * (-1345.254) (-1340.930) (-1346.794) [-1318.162] -- 0:00:58
      771000 -- (-1352.118) (-1349.573) (-1340.229) [-1340.919] * (-1339.687) (-1335.510) (-1354.538) [-1338.930] -- 0:00:58
      771500 -- [-1329.973] (-1349.614) (-1335.501) (-1350.295) * (-1339.741) (-1341.477) (-1341.131) [-1333.044] -- 0:00:58
      772000 -- [-1320.021] (-1345.007) (-1341.911) (-1338.414) * (-1343.718) (-1341.191) (-1340.940) [-1333.412] -- 0:00:58
      772500 -- [-1317.534] (-1340.129) (-1337.874) (-1358.109) * (-1338.948) [-1334.815] (-1350.533) (-1337.184) -- 0:00:58
      773000 -- [-1318.879] (-1340.890) (-1346.864) (-1345.362) * (-1347.986) (-1341.734) (-1343.379) [-1328.047] -- 0:00:58
      773500 -- (-1330.379) [-1335.924] (-1345.566) (-1342.141) * (-1340.675) [-1322.364] (-1343.303) (-1336.510) -- 0:00:57
      774000 -- (-1341.728) (-1332.345) [-1346.089] (-1339.383) * (-1343.842) [-1321.565] (-1339.666) (-1351.289) -- 0:00:57
      774500 -- (-1353.879) (-1333.557) [-1338.367] (-1337.655) * (-1343.296) [-1329.455] (-1340.729) (-1343.140) -- 0:00:57
      775000 -- (-1342.458) (-1338.393) (-1340.630) [-1337.748] * [-1331.489] (-1335.698) (-1356.914) (-1327.223) -- 0:00:57

      Average standard deviation of split frequencies: 0.006825

      775500 -- (-1347.610) (-1332.950) (-1347.597) [-1341.115] * (-1353.035) (-1344.542) (-1347.014) [-1328.689] -- 0:00:57
      776000 -- (-1351.506) [-1334.922] (-1347.174) (-1335.392) * (-1353.528) (-1342.351) (-1359.070) [-1319.532] -- 0:00:57
      776500 -- (-1335.565) (-1345.970) (-1352.703) [-1325.828] * (-1340.628) (-1335.513) (-1336.447) [-1337.229] -- 0:00:57
      777000 -- (-1349.058) (-1342.541) (-1333.591) [-1331.675] * (-1343.058) (-1345.894) (-1348.256) [-1330.297] -- 0:00:57
      777500 -- (-1347.725) (-1345.227) [-1326.684] (-1350.720) * (-1344.105) (-1336.577) (-1347.259) [-1340.551] -- 0:00:56
      778000 -- (-1347.090) (-1345.238) (-1339.312) [-1327.506] * (-1346.922) (-1338.750) [-1344.422] (-1334.598) -- 0:00:56
      778500 -- (-1340.283) (-1342.083) (-1329.839) [-1324.101] * (-1338.546) (-1350.479) [-1342.105] (-1350.936) -- 0:00:56
      779000 -- (-1343.050) (-1344.387) [-1327.466] (-1349.183) * (-1340.099) (-1345.262) [-1334.952] (-1344.103) -- 0:00:56
      779500 -- (-1351.556) (-1339.230) [-1329.657] (-1343.430) * (-1347.543) (-1341.829) [-1338.987] (-1343.011) -- 0:00:56
      780000 -- (-1343.684) [-1327.632] (-1339.253) (-1343.214) * [-1334.432] (-1349.545) (-1323.376) (-1353.890) -- 0:00:56

      Average standard deviation of split frequencies: 0.007211

      780500 -- (-1345.325) [-1336.438] (-1343.670) (-1350.991) * (-1341.367) (-1348.269) (-1330.184) [-1331.714] -- 0:00:56
      781000 -- (-1346.808) (-1347.333) [-1327.865] (-1340.694) * (-1336.516) (-1342.337) [-1324.100] (-1342.056) -- 0:00:56
      781500 -- (-1342.958) (-1343.584) [-1343.363] (-1351.072) * (-1344.986) (-1340.123) [-1332.455] (-1344.738) -- 0:00:55
      782000 -- [-1343.967] (-1343.542) (-1352.599) (-1341.789) * (-1342.046) [-1329.795] (-1349.541) (-1335.048) -- 0:00:55
      782500 -- [-1338.772] (-1338.101) (-1348.220) (-1344.135) * (-1325.064) (-1341.755) [-1322.052] (-1341.419) -- 0:00:55
      783000 -- [-1332.061] (-1355.835) (-1348.264) (-1349.938) * [-1322.579] (-1349.565) (-1339.467) (-1340.399) -- 0:00:55
      783500 -- (-1335.357) (-1346.198) (-1351.165) [-1350.473] * (-1329.854) (-1351.186) (-1341.394) [-1326.958] -- 0:00:55
      784000 -- (-1340.388) (-1347.727) (-1339.919) [-1319.348] * [-1325.722] (-1340.385) (-1340.404) (-1332.038) -- 0:00:55
      784500 -- (-1344.557) (-1346.431) (-1350.619) [-1342.582] * (-1341.639) (-1338.187) (-1331.548) [-1322.517] -- 0:00:55
      785000 -- (-1333.051) (-1350.594) (-1347.590) [-1333.837] * (-1341.699) [-1327.832] (-1346.443) (-1340.108) -- 0:00:55

      Average standard deviation of split frequencies: 0.007303

      785500 -- (-1337.069) (-1343.455) (-1345.610) [-1339.280] * (-1350.014) (-1336.880) [-1324.755] (-1344.091) -- 0:00:54
      786000 -- (-1331.755) (-1344.870) (-1354.997) [-1335.284] * [-1325.715] (-1336.207) (-1331.261) (-1344.169) -- 0:00:54
      786500 -- (-1340.973) (-1344.707) (-1357.331) [-1333.518] * [-1322.095] (-1332.851) (-1346.031) (-1345.979) -- 0:00:54
      787000 -- (-1337.747) (-1353.537) (-1347.285) [-1329.142] * (-1330.013) (-1343.105) [-1339.060] (-1347.762) -- 0:00:54
      787500 -- (-1341.125) (-1348.730) (-1340.382) [-1325.680] * [-1333.485] (-1345.060) (-1348.296) (-1344.322) -- 0:00:54
      788000 -- (-1348.954) (-1340.164) (-1337.924) [-1333.207] * [-1334.888] (-1347.052) (-1337.428) (-1340.772) -- 0:00:54
      788500 -- (-1354.430) (-1354.049) (-1346.267) [-1323.624] * (-1329.486) (-1345.360) [-1333.241] (-1337.895) -- 0:00:54
      789000 -- (-1341.556) [-1331.644] (-1343.107) (-1344.915) * [-1332.550] (-1328.469) (-1330.988) (-1351.814) -- 0:00:54
      789500 -- (-1343.756) [-1334.999] (-1345.835) (-1341.675) * (-1349.784) (-1347.054) [-1333.865] (-1345.491) -- 0:00:53
      790000 -- (-1348.569) [-1336.264] (-1339.960) (-1339.377) * (-1349.522) [-1334.090] (-1343.272) (-1340.347) -- 0:00:53

      Average standard deviation of split frequencies: 0.007435

      790500 -- [-1334.227] (-1352.416) (-1341.118) (-1345.688) * (-1344.756) (-1344.864) [-1321.742] (-1347.128) -- 0:00:53
      791000 -- (-1341.051) (-1347.367) [-1337.358] (-1345.925) * (-1352.896) [-1330.649] (-1342.441) (-1340.877) -- 0:00:53
      791500 -- (-1351.759) (-1342.533) [-1334.569] (-1352.441) * (-1342.747) (-1338.583) (-1341.396) [-1334.763] -- 0:00:53
      792000 -- (-1351.407) (-1348.122) [-1335.955] (-1343.368) * (-1336.479) (-1339.335) [-1340.628] (-1338.818) -- 0:00:53
      792500 -- (-1342.972) (-1340.743) [-1341.598] (-1343.631) * (-1335.452) [-1336.435] (-1339.568) (-1340.631) -- 0:00:53
      793000 -- [-1340.203] (-1346.862) (-1346.059) (-1340.122) * (-1340.076) (-1342.195) [-1328.145] (-1354.049) -- 0:00:52
      793500 -- (-1344.812) (-1354.227) (-1351.128) [-1331.490] * (-1355.050) (-1345.920) [-1326.406] (-1344.488) -- 0:00:52
      794000 -- (-1335.175) (-1340.785) [-1356.273] (-1343.950) * (-1341.711) [-1325.073] (-1346.810) (-1342.948) -- 0:00:52
      794500 -- (-1342.632) [-1344.856] (-1340.906) (-1346.585) * (-1335.390) [-1341.297] (-1348.212) (-1347.290) -- 0:00:52
      795000 -- [-1339.528] (-1341.498) (-1331.323) (-1346.948) * (-1334.361) [-1340.916] (-1322.850) (-1354.947) -- 0:00:52

      Average standard deviation of split frequencies: 0.007246

      795500 -- (-1343.284) [-1331.201] (-1345.633) (-1357.510) * (-1346.385) (-1349.052) [-1327.068] (-1343.514) -- 0:00:52
      796000 -- [-1339.206] (-1353.380) (-1338.889) (-1351.911) * (-1343.903) (-1340.446) (-1333.326) [-1325.007] -- 0:00:52
      796500 -- (-1332.696) [-1336.173] (-1337.105) (-1355.824) * (-1338.390) (-1336.531) (-1350.340) [-1310.003] -- 0:00:52
      797000 -- (-1342.488) [-1336.477] (-1344.523) (-1350.014) * (-1353.729) (-1332.018) (-1340.884) [-1320.433] -- 0:00:51
      797500 -- (-1338.729) [-1336.401] (-1341.519) (-1336.152) * (-1348.973) (-1345.343) (-1323.337) [-1344.076] -- 0:00:51
      798000 -- (-1338.750) (-1349.164) [-1326.837] (-1346.073) * (-1335.523) (-1346.079) [-1331.225] (-1337.044) -- 0:00:51
      798500 -- [-1337.834] (-1348.215) (-1339.039) (-1355.766) * (-1327.980) (-1344.248) (-1346.112) [-1320.562] -- 0:00:51
      799000 -- [-1345.638] (-1347.403) (-1350.211) (-1340.936) * (-1340.552) [-1344.144] (-1349.801) (-1338.890) -- 0:00:51
      799500 -- [-1333.704] (-1348.304) (-1340.280) (-1356.560) * [-1345.349] (-1358.424) (-1340.137) (-1345.536) -- 0:00:51
      800000 -- (-1340.564) (-1346.628) [-1322.566] (-1350.711) * (-1337.880) (-1333.072) (-1343.822) [-1341.454] -- 0:00:51

      Average standard deviation of split frequencies: 0.007689

      800500 -- (-1348.096) (-1347.204) [-1321.989] (-1345.370) * (-1337.883) [-1333.465] (-1339.393) (-1341.192) -- 0:00:51
      801000 -- (-1342.524) (-1343.019) (-1342.587) [-1337.359] * (-1342.218) [-1329.410] (-1343.615) (-1331.680) -- 0:00:50
      801500 -- (-1353.738) (-1343.217) [-1330.467] (-1335.297) * (-1352.134) (-1337.204) (-1354.145) [-1337.346] -- 0:00:50
      802000 -- (-1337.747) (-1343.761) [-1334.069] (-1342.073) * (-1362.681) (-1336.901) (-1350.759) [-1334.755] -- 0:00:50
      802500 -- (-1343.560) (-1339.427) (-1345.926) [-1333.700] * (-1338.237) [-1315.115] (-1339.890) (-1355.013) -- 0:00:50
      803000 -- (-1354.991) (-1340.109) (-1336.067) [-1321.354] * (-1347.492) [-1324.454] (-1335.115) (-1347.104) -- 0:00:50
      803500 -- (-1350.542) (-1344.892) (-1342.218) [-1321.506] * [-1328.734] (-1341.833) (-1346.901) (-1350.440) -- 0:00:50
      804000 -- (-1363.156) (-1345.550) [-1335.262] (-1321.355) * [-1312.082] (-1334.494) (-1345.239) (-1345.090) -- 0:00:50
      804500 -- (-1349.820) (-1343.264) [-1330.196] (-1346.713) * [-1332.750] (-1323.040) (-1340.521) (-1350.793) -- 0:00:50
      805000 -- (-1348.161) (-1346.599) [-1320.080] (-1352.605) * (-1325.199) [-1321.683] (-1353.664) (-1345.571) -- 0:00:49

      Average standard deviation of split frequencies: 0.007638

      805500 -- (-1345.098) (-1334.725) [-1334.585] (-1344.417) * (-1336.357) [-1336.125] (-1348.332) (-1347.948) -- 0:00:49
      806000 -- (-1340.731) (-1343.786) [-1337.207] (-1352.536) * [-1326.027] (-1337.638) (-1354.163) (-1351.922) -- 0:00:49
      806500 -- (-1338.611) (-1350.664) [-1315.737] (-1350.516) * (-1343.669) (-1329.327) [-1341.213] (-1356.946) -- 0:00:49
      807000 -- (-1340.890) (-1341.883) [-1329.002] (-1355.468) * (-1349.105) [-1330.754] (-1342.847) (-1347.410) -- 0:00:49
      807500 -- (-1338.630) (-1340.525) [-1323.856] (-1352.881) * (-1342.737) (-1339.649) [-1318.762] (-1347.808) -- 0:00:49
      808000 -- (-1345.349) (-1341.389) [-1342.127] (-1347.243) * [-1336.363] (-1338.940) (-1344.735) (-1344.814) -- 0:00:49
      808500 -- (-1343.057) (-1345.366) [-1332.715] (-1353.453) * (-1345.349) (-1348.467) [-1339.323] (-1343.600) -- 0:00:49
      809000 -- [-1329.575] (-1346.087) (-1340.366) (-1344.024) * [-1348.915] (-1335.971) (-1338.615) (-1342.694) -- 0:00:48
      809500 -- [-1330.777] (-1349.002) (-1338.590) (-1341.637) * (-1342.461) [-1338.248] (-1339.606) (-1345.619) -- 0:00:48
      810000 -- (-1344.644) (-1346.661) (-1338.801) [-1332.825] * [-1323.490] (-1335.708) (-1350.141) (-1349.368) -- 0:00:48

      Average standard deviation of split frequencies: 0.007662

      810500 -- (-1357.763) (-1355.268) [-1323.497] (-1345.094) * [-1329.261] (-1349.427) (-1347.636) (-1343.118) -- 0:00:48
      811000 -- (-1339.891) (-1362.649) [-1317.127] (-1334.775) * [-1326.962] (-1344.343) (-1341.785) (-1342.442) -- 0:00:48
      811500 -- (-1345.530) (-1352.045) [-1321.706] (-1340.357) * [-1329.003] (-1340.367) (-1361.333) (-1342.608) -- 0:00:48
      812000 -- (-1349.585) (-1348.717) (-1332.032) [-1344.880] * [-1317.927] (-1320.886) (-1343.143) (-1336.975) -- 0:00:48
      812500 -- (-1345.008) (-1347.216) [-1344.774] (-1342.419) * (-1348.109) [-1315.213] (-1343.175) (-1334.708) -- 0:00:48
      813000 -- [-1346.228] (-1343.579) (-1352.398) (-1339.961) * (-1345.185) [-1313.195] (-1348.856) (-1324.601) -- 0:00:47
      813500 -- [-1336.418] (-1345.372) (-1347.698) (-1340.191) * [-1349.225] (-1345.070) (-1356.125) (-1342.998) -- 0:00:47
      814000 -- [-1329.263] (-1337.709) (-1346.435) (-1341.588) * (-1347.031) [-1343.656] (-1341.315) (-1345.095) -- 0:00:47
      814500 -- (-1334.527) [-1331.921] (-1343.929) (-1350.198) * (-1348.572) [-1336.194] (-1347.520) (-1356.766) -- 0:00:47
      815000 -- [-1327.206] (-1341.729) (-1341.536) (-1334.319) * (-1344.165) (-1339.518) [-1345.442] (-1357.377) -- 0:00:47

      Average standard deviation of split frequencies: 0.008156

      815500 -- (-1350.287) [-1343.627] (-1348.416) (-1344.572) * (-1353.605) (-1353.844) (-1341.312) [-1337.751] -- 0:00:47
      816000 -- [-1329.239] (-1333.595) (-1348.306) (-1351.682) * [-1340.051] (-1349.047) (-1336.313) (-1337.110) -- 0:00:47
      816500 -- (-1326.073) (-1347.292) (-1337.650) [-1335.214] * (-1358.226) (-1341.850) (-1340.345) [-1323.525] -- 0:00:46
      817000 -- [-1322.236] (-1342.795) (-1342.358) (-1349.222) * (-1348.938) [-1340.254] (-1355.111) (-1332.977) -- 0:00:46
      817500 -- (-1338.140) (-1338.372) (-1347.286) [-1324.938] * (-1348.187) [-1328.549] (-1352.927) (-1339.583) -- 0:00:46
      818000 -- (-1339.690) (-1341.015) [-1325.487] (-1350.000) * (-1335.246) (-1341.405) [-1344.989] (-1348.342) -- 0:00:46
      818500 -- (-1347.776) (-1345.209) [-1327.700] (-1341.422) * [-1331.564] (-1348.427) (-1343.358) (-1352.934) -- 0:00:46
      819000 -- (-1344.133) (-1346.479) (-1336.515) [-1348.711] * [-1325.382] (-1356.141) (-1349.326) (-1333.132) -- 0:00:46
      819500 -- (-1351.452) [-1341.218] (-1342.221) (-1338.044) * (-1328.930) (-1341.392) (-1334.315) [-1330.364] -- 0:00:46
      820000 -- (-1344.120) [-1332.562] (-1344.654) (-1338.589) * [-1326.441] (-1355.279) (-1342.513) (-1336.248) -- 0:00:46

      Average standard deviation of split frequencies: 0.008211

      820500 -- (-1341.973) [-1335.345] (-1352.663) (-1344.125) * [-1335.794] (-1347.968) (-1342.739) (-1345.537) -- 0:00:45
      821000 -- (-1336.953) (-1351.585) [-1337.009] (-1338.783) * (-1340.017) (-1347.870) [-1336.895] (-1345.912) -- 0:00:45
      821500 -- (-1343.226) (-1351.772) (-1336.232) [-1339.662] * (-1342.751) (-1339.174) (-1341.912) [-1338.686] -- 0:00:45
      822000 -- (-1352.480) (-1348.163) (-1351.181) [-1340.968] * (-1343.124) (-1343.891) (-1331.717) [-1331.521] -- 0:00:45
      822500 -- (-1340.107) (-1347.677) (-1355.849) [-1341.478] * (-1354.697) (-1348.180) [-1331.714] (-1341.756) -- 0:00:45
      823000 -- (-1346.995) (-1349.822) (-1362.678) [-1316.836] * (-1352.836) [-1343.054] (-1352.974) (-1345.548) -- 0:00:45
      823500 -- (-1354.367) (-1364.469) (-1332.613) [-1329.710] * (-1347.136) (-1354.408) (-1336.699) [-1319.263] -- 0:00:45
      824000 -- [-1339.034] (-1335.048) (-1360.239) (-1329.305) * (-1345.653) (-1339.151) [-1340.055] (-1346.399) -- 0:00:45
      824500 -- [-1329.151] (-1344.339) (-1352.182) (-1342.056) * [-1329.038] (-1347.098) (-1342.329) (-1344.120) -- 0:00:44
      825000 -- (-1352.258) [-1342.335] (-1346.438) (-1336.845) * [-1336.644] (-1335.990) (-1345.073) (-1348.259) -- 0:00:44

      Average standard deviation of split frequencies: 0.008258

      825500 -- (-1347.964) (-1349.594) (-1334.534) [-1341.829] * [-1342.111] (-1338.375) (-1334.390) (-1349.736) -- 0:00:44
      826000 -- [-1329.051] (-1348.599) (-1346.071) (-1346.214) * (-1340.649) (-1341.221) [-1340.635] (-1350.828) -- 0:00:44
      826500 -- (-1335.019) (-1349.960) [-1333.082] (-1347.103) * (-1340.701) (-1344.526) [-1341.756] (-1341.784) -- 0:00:44
      827000 -- (-1338.777) (-1361.023) [-1335.936] (-1340.013) * (-1341.182) (-1345.060) (-1340.177) [-1335.147] -- 0:00:44
      827500 -- [-1319.431] (-1346.080) (-1347.369) (-1347.663) * (-1341.923) (-1343.443) (-1345.607) [-1340.000] -- 0:00:44
      828000 -- (-1338.211) (-1345.871) [-1333.773] (-1347.697) * [-1331.440] (-1346.462) (-1348.970) (-1347.245) -- 0:00:44
      828500 -- [-1340.854] (-1346.693) (-1343.284) (-1340.444) * (-1338.649) (-1345.126) [-1335.527] (-1347.676) -- 0:00:43
      829000 -- (-1354.349) [-1338.697] (-1349.408) (-1342.052) * [-1335.754] (-1345.306) (-1343.836) (-1336.312) -- 0:00:43
      829500 -- (-1344.606) [-1337.771] (-1337.525) (-1345.522) * (-1346.235) (-1353.452) [-1345.984] (-1348.745) -- 0:00:43
      830000 -- (-1338.569) (-1346.568) (-1347.711) [-1342.590] * (-1345.725) (-1345.140) [-1350.036] (-1348.804) -- 0:00:43

      Average standard deviation of split frequencies: 0.008346

      830500 -- [-1333.689] (-1342.003) (-1345.457) (-1345.676) * (-1333.018) (-1351.155) (-1342.600) [-1342.539] -- 0:00:43
      831000 -- [-1338.210] (-1350.857) (-1345.168) (-1347.842) * (-1337.778) (-1353.774) [-1326.378] (-1346.436) -- 0:00:43
      831500 -- (-1339.137) (-1341.888) [-1328.945] (-1341.713) * [-1338.817] (-1348.436) (-1341.593) (-1347.428) -- 0:00:43
      832000 -- [-1321.872] (-1352.363) (-1331.030) (-1347.615) * [-1336.530] (-1339.069) (-1348.944) (-1346.045) -- 0:00:43
      832500 -- (-1338.413) [-1345.734] (-1344.882) (-1348.232) * (-1331.226) (-1350.390) [-1308.406] (-1351.035) -- 0:00:42
      833000 -- (-1347.098) [-1334.686] (-1354.353) (-1348.321) * (-1330.602) (-1345.795) (-1338.018) [-1332.760] -- 0:00:42
      833500 -- [-1340.372] (-1344.689) (-1353.237) (-1339.070) * (-1332.163) (-1340.373) (-1340.115) [-1330.753] -- 0:00:42
      834000 -- [-1336.724] (-1335.565) (-1358.751) (-1337.988) * (-1350.731) (-1348.147) (-1333.896) [-1335.524] -- 0:00:42
      834500 -- (-1336.874) (-1334.144) (-1346.693) [-1343.854] * (-1337.036) (-1340.432) [-1341.269] (-1350.501) -- 0:00:42
      835000 -- (-1335.787) [-1332.821] (-1335.888) (-1347.030) * (-1350.921) (-1339.452) [-1334.424] (-1343.006) -- 0:00:42

      Average standard deviation of split frequencies: 0.008558

      835500 -- [-1323.922] (-1347.732) (-1339.858) (-1347.361) * (-1351.258) [-1341.407] (-1350.233) (-1344.978) -- 0:00:42
      836000 -- (-1325.806) (-1350.236) [-1323.811] (-1342.556) * (-1353.388) (-1343.463) (-1340.211) [-1336.318] -- 0:00:41
      836500 -- (-1337.575) [-1342.450] (-1349.849) (-1341.122) * (-1349.992) (-1340.505) [-1336.256] (-1342.994) -- 0:00:41
      837000 -- (-1333.394) (-1341.371) (-1349.659) [-1334.610] * (-1358.507) (-1343.486) [-1337.765] (-1349.580) -- 0:00:41
      837500 -- [-1330.396] (-1350.028) (-1342.742) (-1344.683) * (-1349.770) (-1339.095) (-1338.379) [-1328.972] -- 0:00:41
      838000 -- (-1346.900) [-1337.193] (-1331.452) (-1348.032) * (-1340.022) (-1334.312) (-1341.892) [-1343.612] -- 0:00:41
      838500 -- (-1344.751) [-1338.075] (-1348.039) (-1354.096) * (-1328.083) (-1343.902) (-1344.164) [-1332.368] -- 0:00:41
      839000 -- [-1326.880] (-1336.365) (-1344.098) (-1347.447) * [-1340.624] (-1361.431) (-1332.909) (-1335.172) -- 0:00:41
      839500 -- (-1338.297) (-1350.777) (-1336.268) [-1329.094] * (-1365.511) (-1347.778) [-1339.517] (-1339.508) -- 0:00:41
      840000 -- (-1340.914) (-1346.750) [-1336.882] (-1339.112) * (-1345.296) (-1340.075) [-1321.671] (-1347.891) -- 0:00:40

      Average standard deviation of split frequencies: 0.008114

      840500 -- [-1332.880] (-1343.264) (-1350.661) (-1347.550) * [-1332.525] (-1344.586) (-1342.096) (-1330.585) -- 0:00:40
      841000 -- (-1338.016) [-1342.454] (-1351.682) (-1339.612) * (-1336.570) (-1349.321) (-1345.515) [-1330.587] -- 0:00:40
      841500 -- (-1339.388) (-1342.886) (-1342.061) [-1323.724] * [-1327.356] (-1346.986) (-1341.989) (-1340.196) -- 0:00:40
      842000 -- (-1348.138) (-1338.906) [-1340.236] (-1322.474) * (-1342.273) [-1336.777] (-1338.025) (-1336.429) -- 0:00:40
      842500 -- (-1353.231) (-1347.725) [-1332.320] (-1328.602) * (-1328.009) [-1336.210] (-1343.187) (-1350.680) -- 0:00:40
      843000 -- [-1336.890] (-1347.543) (-1344.840) (-1341.076) * [-1333.065] (-1336.380) (-1334.159) (-1361.931) -- 0:00:40
      843500 -- [-1332.307] (-1349.885) (-1336.771) (-1351.108) * (-1337.009) (-1333.968) [-1329.104] (-1350.741) -- 0:00:40
      844000 -- (-1340.587) (-1345.805) (-1349.467) [-1331.654] * [-1328.872] (-1339.232) (-1348.231) (-1345.392) -- 0:00:39
      844500 -- (-1349.758) (-1341.441) (-1340.449) [-1343.681] * (-1340.703) [-1331.528] (-1335.255) (-1347.695) -- 0:00:39
      845000 -- [-1345.381] (-1349.375) (-1342.372) (-1333.693) * (-1337.795) (-1343.134) [-1326.341] (-1346.297) -- 0:00:39

      Average standard deviation of split frequencies: 0.008293

      845500 -- (-1337.406) (-1352.613) (-1350.687) [-1333.284] * [-1327.673] (-1346.981) (-1357.759) (-1338.930) -- 0:00:39
      846000 -- (-1347.078) (-1358.834) (-1338.700) [-1338.034] * (-1328.609) (-1342.692) [-1329.886] (-1348.814) -- 0:00:39
      846500 -- [-1337.487] (-1347.294) (-1347.615) (-1338.813) * (-1336.345) [-1333.536] (-1356.512) (-1345.622) -- 0:00:39
      847000 -- (-1337.286) (-1348.174) [-1342.156] (-1352.626) * (-1325.910) (-1349.605) [-1348.540] (-1345.727) -- 0:00:39
      847500 -- (-1335.976) (-1346.019) (-1345.867) [-1339.794] * [-1335.878] (-1355.018) (-1340.970) (-1336.101) -- 0:00:39
      848000 -- (-1343.533) [-1339.532] (-1336.477) (-1341.689) * [-1340.618] (-1351.194) (-1349.664) (-1345.101) -- 0:00:38
      848500 -- [-1330.771] (-1332.330) (-1353.433) (-1338.440) * (-1341.415) [-1334.297] (-1355.785) (-1347.422) -- 0:00:38
      849000 -- (-1341.820) (-1332.189) (-1355.621) [-1334.704] * [-1323.677] (-1344.664) (-1350.488) (-1346.680) -- 0:00:38
      849500 -- [-1340.489] (-1332.476) (-1359.016) (-1342.002) * (-1340.765) (-1350.650) (-1351.269) [-1337.609] -- 0:00:38
      850000 -- (-1331.283) (-1346.579) (-1346.497) [-1343.927] * [-1319.051] (-1350.305) (-1345.331) (-1339.886) -- 0:00:38

      Average standard deviation of split frequencies: 0.008182

      850500 -- [-1336.887] (-1340.885) (-1355.383) (-1321.132) * [-1320.807] (-1343.180) (-1340.874) (-1331.717) -- 0:00:38
      851000 -- [-1331.115] (-1361.700) (-1338.635) (-1346.941) * [-1332.752] (-1346.164) (-1344.230) (-1344.931) -- 0:00:38
      851500 -- (-1345.541) [-1343.482] (-1342.860) (-1338.616) * [-1339.819] (-1331.500) (-1347.204) (-1347.447) -- 0:00:38
      852000 -- (-1351.889) [-1318.269] (-1348.326) (-1352.465) * (-1338.781) [-1331.513] (-1346.395) (-1346.625) -- 0:00:37
      852500 -- [-1340.797] (-1321.149) (-1339.065) (-1347.244) * (-1338.316) [-1335.354] (-1344.444) (-1347.510) -- 0:00:37
      853000 -- (-1336.073) [-1323.234] (-1347.705) (-1345.401) * (-1329.211) (-1350.127) (-1350.176) [-1341.504] -- 0:00:37
      853500 -- (-1341.927) (-1344.542) [-1321.042] (-1345.184) * [-1333.462] (-1351.789) (-1349.488) (-1337.553) -- 0:00:37
      854000 -- (-1341.540) (-1352.546) [-1332.580] (-1335.755) * [-1324.102] (-1358.965) (-1351.894) (-1340.368) -- 0:00:37
      854500 -- (-1343.241) (-1349.898) [-1343.884] (-1348.043) * (-1335.621) (-1340.100) (-1348.166) [-1343.344] -- 0:00:37
      855000 -- [-1333.266] (-1344.625) (-1354.075) (-1344.359) * [-1320.665] (-1346.584) (-1341.866) (-1354.549) -- 0:00:37

      Average standard deviation of split frequencies: 0.008131

      855500 -- (-1329.910) (-1340.811) [-1336.231] (-1346.326) * [-1319.190] (-1349.069) (-1350.907) (-1342.097) -- 0:00:36
      856000 -- [-1337.421] (-1335.673) (-1351.846) (-1333.641) * (-1328.529) (-1353.297) [-1343.233] (-1342.388) -- 0:00:36
      856500 -- [-1338.143] (-1348.599) (-1361.292) (-1351.651) * (-1335.703) [-1342.655] (-1347.509) (-1350.059) -- 0:00:36
      857000 -- [-1320.738] (-1323.606) (-1352.695) (-1343.919) * [-1337.980] (-1350.896) (-1346.856) (-1352.158) -- 0:00:36
      857500 -- (-1342.724) [-1338.511] (-1342.099) (-1338.492) * [-1335.535] (-1340.806) (-1356.700) (-1339.634) -- 0:00:36
      858000 -- [-1332.230] (-1339.138) (-1343.188) (-1342.574) * [-1330.490] (-1352.469) (-1350.017) (-1341.305) -- 0:00:36
      858500 -- (-1347.792) (-1345.522) (-1356.190) [-1329.257] * [-1326.136] (-1349.156) (-1345.028) (-1342.658) -- 0:00:36
      859000 -- (-1347.739) (-1341.491) (-1352.607) [-1328.069] * [-1309.854] (-1344.408) (-1343.339) (-1360.832) -- 0:00:36
      859500 -- [-1339.587] (-1336.217) (-1349.868) (-1349.337) * (-1345.514) (-1341.586) [-1339.918] (-1341.018) -- 0:00:35
      860000 -- (-1337.319) (-1342.415) [-1335.696] (-1343.564) * (-1341.736) [-1336.850] (-1339.388) (-1345.858) -- 0:00:35

      Average standard deviation of split frequencies: 0.008151

      860500 -- (-1358.345) (-1353.192) (-1334.418) [-1343.380] * [-1347.045] (-1336.614) (-1349.273) (-1347.366) -- 0:00:35
      861000 -- (-1344.220) (-1334.194) [-1327.920] (-1341.919) * (-1347.338) [-1329.256] (-1341.586) (-1350.291) -- 0:00:35
      861500 -- [-1333.059] (-1339.334) (-1337.218) (-1354.313) * (-1352.685) [-1336.262] (-1348.597) (-1343.144) -- 0:00:35
      862000 -- [-1327.518] (-1345.280) (-1341.592) (-1340.226) * (-1344.588) (-1326.470) (-1352.815) [-1334.910] -- 0:00:35
      862500 -- [-1325.375] (-1333.297) (-1351.103) (-1339.488) * (-1345.740) (-1339.570) (-1336.720) [-1343.681] -- 0:00:35
      863000 -- (-1337.184) [-1330.157] (-1352.904) (-1334.580) * (-1339.689) (-1338.378) [-1336.896] (-1346.009) -- 0:00:35
      863500 -- (-1342.298) [-1321.762] (-1349.655) (-1339.325) * (-1340.479) (-1346.021) [-1326.962] (-1347.601) -- 0:00:34
      864000 -- [-1340.625] (-1339.397) (-1341.207) (-1341.121) * (-1335.626) [-1348.972] (-1349.846) (-1353.789) -- 0:00:34
      864500 -- (-1343.618) (-1337.631) (-1344.169) [-1343.390] * (-1339.761) [-1345.907] (-1356.640) (-1349.004) -- 0:00:34
      865000 -- (-1341.437) [-1310.427] (-1351.776) (-1350.239) * (-1345.302) [-1341.110] (-1342.173) (-1344.737) -- 0:00:34

      Average standard deviation of split frequencies: 0.008485

      865500 -- (-1345.116) [-1323.642] (-1356.022) (-1339.418) * (-1348.991) [-1333.735] (-1341.316) (-1346.534) -- 0:00:34
      866000 -- (-1346.836) (-1324.131) (-1350.724) [-1320.057] * (-1332.960) [-1343.699] (-1353.315) (-1348.148) -- 0:00:34
      866500 -- (-1352.654) (-1331.093) (-1351.543) [-1322.806] * [-1330.446] (-1344.059) (-1343.969) (-1352.915) -- 0:00:34
      867000 -- (-1349.344) [-1341.246] (-1346.929) (-1340.978) * (-1338.908) (-1344.470) (-1349.739) [-1343.297] -- 0:00:34
      867500 -- (-1349.458) [-1341.905] (-1341.452) (-1340.552) * (-1336.364) (-1346.908) [-1328.723] (-1347.211) -- 0:00:33
      868000 -- (-1353.053) (-1353.468) (-1343.827) [-1338.996] * [-1303.539] (-1341.727) (-1350.687) (-1341.745) -- 0:00:33
      868500 -- (-1340.706) [-1337.511] (-1348.369) (-1338.637) * [-1340.098] (-1345.403) (-1348.017) (-1344.841) -- 0:00:33
      869000 -- (-1342.480) [-1311.947] (-1341.904) (-1342.168) * [-1323.283] (-1335.459) (-1344.696) (-1351.617) -- 0:00:33
      869500 -- (-1342.891) (-1318.658) [-1326.233] (-1351.952) * (-1322.902) [-1341.976] (-1353.555) (-1341.392) -- 0:00:33
      870000 -- (-1346.008) [-1311.518] (-1343.946) (-1339.922) * (-1347.007) [-1347.612] (-1343.430) (-1342.980) -- 0:00:33

      Average standard deviation of split frequencies: 0.008408

      870500 -- (-1338.603) [-1341.190] (-1352.719) (-1329.525) * (-1333.298) (-1337.116) [-1344.741] (-1335.204) -- 0:00:33
      871000 -- (-1350.540) [-1340.527] (-1339.681) (-1331.140) * (-1338.776) [-1333.049] (-1341.601) (-1341.350) -- 0:00:33
      871500 -- (-1344.458) (-1334.943) (-1349.615) [-1335.041] * (-1339.617) [-1340.562] (-1343.163) (-1346.843) -- 0:00:32
      872000 -- (-1338.124) (-1343.689) (-1341.480) [-1325.088] * (-1337.430) (-1349.831) [-1340.246] (-1323.579) -- 0:00:32
      872500 -- (-1341.322) (-1333.843) (-1332.279) [-1324.573] * (-1338.788) (-1347.744) (-1341.068) [-1325.291] -- 0:00:32
      873000 -- (-1362.750) (-1338.097) (-1342.334) [-1324.178] * [-1334.284] (-1346.586) (-1334.838) (-1341.309) -- 0:00:32
      873500 -- (-1351.175) (-1346.862) [-1345.974] (-1332.776) * [-1336.443] (-1353.090) (-1345.899) (-1348.916) -- 0:00:32
      874000 -- (-1346.355) [-1332.364] (-1345.553) (-1340.500) * [-1338.488] (-1348.176) (-1336.644) (-1340.523) -- 0:00:32
      874500 -- (-1349.509) [-1332.100] (-1350.180) (-1350.138) * (-1345.364) [-1338.103] (-1335.877) (-1341.998) -- 0:00:32
      875000 -- (-1347.337) (-1336.288) (-1341.605) [-1346.364] * [-1348.272] (-1349.943) (-1338.784) (-1340.313) -- 0:00:32

      Average standard deviation of split frequencies: 0.008262

      875500 -- (-1346.120) (-1340.950) [-1339.816] (-1355.394) * (-1345.067) (-1355.839) [-1328.431] (-1348.908) -- 0:00:31
      876000 -- (-1335.217) (-1340.636) [-1334.104] (-1351.507) * (-1332.540) (-1358.453) [-1318.118] (-1344.305) -- 0:00:31
      876500 -- (-1332.976) (-1348.790) (-1344.281) [-1334.879] * (-1344.229) (-1353.205) [-1333.926] (-1340.140) -- 0:00:31
      877000 -- (-1344.649) (-1345.037) [-1338.774] (-1336.973) * (-1343.962) (-1340.356) [-1339.081] (-1347.283) -- 0:00:31
      877500 -- (-1345.659) (-1336.942) [-1328.497] (-1350.651) * (-1346.976) (-1342.598) [-1326.667] (-1338.281) -- 0:00:31
      878000 -- (-1347.523) (-1345.445) [-1309.333] (-1344.617) * (-1344.566) (-1337.528) [-1322.213] (-1350.056) -- 0:00:31
      878500 -- (-1335.186) [-1338.352] (-1348.954) (-1350.391) * (-1342.589) [-1342.356] (-1323.843) (-1347.426) -- 0:00:31
      879000 -- [-1342.799] (-1340.443) (-1335.469) (-1345.662) * (-1346.920) (-1353.369) [-1323.252] (-1332.517) -- 0:00:30
      879500 -- (-1336.321) (-1352.532) [-1331.189] (-1344.134) * (-1351.299) (-1333.328) [-1325.776] (-1343.853) -- 0:00:30
      880000 -- (-1331.059) (-1347.874) (-1339.894) [-1336.833] * (-1350.011) (-1352.132) [-1321.798] (-1350.491) -- 0:00:30

      Average standard deviation of split frequencies: 0.007683

      880500 -- (-1334.901) [-1338.202] (-1346.640) (-1340.438) * (-1340.913) (-1342.286) (-1348.353) [-1336.422] -- 0:00:30
      881000 -- [-1322.457] (-1340.801) (-1331.618) (-1341.166) * (-1343.069) (-1341.229) (-1349.088) [-1331.476] -- 0:00:30
      881500 -- [-1345.495] (-1342.507) (-1362.403) (-1344.904) * (-1350.510) (-1344.493) (-1345.046) [-1322.194] -- 0:00:30
      882000 -- (-1341.015) [-1330.214] (-1350.465) (-1340.128) * (-1352.617) (-1337.295) (-1344.294) [-1342.614] -- 0:00:30
      882500 -- (-1336.360) [-1315.081] (-1341.134) (-1343.029) * (-1346.248) (-1348.874) (-1345.008) [-1332.639] -- 0:00:30
      883000 -- [-1345.578] (-1321.835) (-1354.053) (-1341.737) * (-1339.250) (-1341.661) (-1343.708) [-1346.255] -- 0:00:29
      883500 -- (-1340.010) [-1331.518] (-1340.511) (-1341.297) * (-1344.274) (-1358.485) [-1343.373] (-1350.068) -- 0:00:29
      884000 -- (-1345.272) (-1336.200) (-1351.475) [-1336.840] * (-1345.064) (-1348.125) [-1329.750] (-1347.396) -- 0:00:29
      884500 -- [-1338.232] (-1344.072) (-1347.399) (-1338.339) * (-1342.389) (-1345.799) [-1314.568] (-1332.553) -- 0:00:29
      885000 -- [-1339.900] (-1341.196) (-1346.099) (-1345.666) * (-1341.459) (-1334.684) (-1343.757) [-1334.608] -- 0:00:29

      Average standard deviation of split frequencies: 0.007105

      885500 -- [-1333.767] (-1343.107) (-1349.789) (-1329.757) * [-1331.394] (-1340.295) (-1349.823) (-1356.550) -- 0:00:29
      886000 -- [-1321.243] (-1354.485) (-1355.854) (-1333.200) * [-1337.101] (-1329.959) (-1349.459) (-1346.589) -- 0:00:29
      886500 -- (-1335.215) [-1355.891] (-1351.299) (-1346.525) * [-1338.089] (-1346.328) (-1350.497) (-1346.033) -- 0:00:29
      887000 -- (-1347.292) (-1339.177) (-1360.517) [-1331.372] * (-1348.361) [-1326.316] (-1359.014) (-1352.958) -- 0:00:28
      887500 -- (-1335.303) (-1337.092) (-1355.795) [-1331.804] * (-1346.908) [-1323.104] (-1353.575) (-1348.474) -- 0:00:28
      888000 -- (-1342.654) [-1335.609] (-1344.566) (-1345.608) * (-1341.086) [-1324.490] (-1361.647) (-1346.381) -- 0:00:28
      888500 -- (-1333.653) [-1322.224] (-1345.128) (-1336.247) * (-1347.354) [-1330.460] (-1347.128) (-1349.719) -- 0:00:28
      889000 -- (-1346.662) (-1349.496) (-1352.545) [-1328.155] * [-1340.925] (-1351.178) (-1337.811) (-1346.582) -- 0:00:28
      889500 -- (-1342.777) (-1337.086) (-1346.221) [-1324.234] * (-1331.243) [-1342.197] (-1345.827) (-1345.974) -- 0:00:28
      890000 -- (-1350.305) (-1320.856) (-1337.772) [-1336.607] * (-1340.252) (-1342.394) [-1322.105] (-1340.338) -- 0:00:28

      Average standard deviation of split frequencies: 0.006787

      890500 -- (-1338.148) [-1344.011] (-1331.503) (-1342.885) * [-1335.465] (-1337.808) (-1327.314) (-1346.567) -- 0:00:28
      891000 -- (-1344.968) [-1340.603] (-1346.972) (-1348.104) * [-1320.440] (-1346.295) (-1351.543) (-1346.764) -- 0:00:27
      891500 -- (-1349.411) (-1350.118) (-1344.568) [-1335.337] * [-1316.302] (-1341.868) (-1346.988) (-1339.353) -- 0:00:27
      892000 -- (-1342.091) (-1364.440) (-1341.644) [-1332.366] * [-1324.496] (-1335.735) (-1349.603) (-1351.872) -- 0:00:27
      892500 -- (-1344.600) (-1344.125) (-1337.508) [-1328.150] * [-1329.285] (-1343.162) (-1342.826) (-1362.106) -- 0:00:27
      893000 -- [-1332.882] (-1349.935) (-1341.653) (-1334.334) * (-1334.172) (-1345.469) [-1342.818] (-1351.174) -- 0:00:27
      893500 -- (-1346.918) (-1342.339) (-1349.552) [-1319.089] * [-1331.911] (-1349.989) (-1338.453) (-1348.095) -- 0:00:27
      894000 -- (-1342.176) (-1345.282) (-1337.011) [-1326.214] * [-1333.938] (-1344.179) (-1347.230) (-1346.353) -- 0:00:27
      894500 -- (-1355.298) (-1353.828) (-1339.474) [-1323.164] * (-1340.250) (-1351.257) [-1337.275] (-1340.331) -- 0:00:27
      895000 -- (-1347.131) (-1336.911) (-1344.903) [-1315.144] * (-1341.727) [-1344.092] (-1347.353) (-1341.081) -- 0:00:26

      Average standard deviation of split frequencies: 0.007118

      895500 -- [-1349.185] (-1353.767) (-1355.387) (-1341.205) * [-1325.854] (-1347.872) (-1343.214) (-1345.131) -- 0:00:26
      896000 -- [-1343.665] (-1349.773) (-1345.557) (-1338.397) * [-1330.810] (-1339.379) (-1337.234) (-1348.595) -- 0:00:26
      896500 -- (-1335.923) (-1347.540) (-1339.111) [-1330.311] * (-1334.168) (-1349.652) [-1319.491] (-1350.845) -- 0:00:26
      897000 -- (-1339.256) (-1338.558) (-1354.961) [-1328.315] * (-1320.564) (-1353.278) [-1325.505] (-1346.940) -- 0:00:26
      897500 -- [-1326.070] (-1354.243) (-1345.953) (-1327.613) * [-1335.125] (-1331.768) (-1346.107) (-1345.710) -- 0:00:26
      898000 -- (-1353.074) (-1345.181) [-1332.466] (-1337.963) * (-1350.865) [-1332.192] (-1354.371) (-1334.432) -- 0:00:26
      898500 -- (-1339.666) (-1350.649) [-1314.580] (-1335.690) * (-1333.379) (-1326.578) (-1336.262) [-1332.164] -- 0:00:25
      899000 -- (-1338.045) (-1355.853) [-1326.760] (-1343.668) * (-1347.266) (-1343.702) (-1339.558) [-1324.025] -- 0:00:25
      899500 -- (-1348.041) (-1329.935) [-1327.659] (-1335.500) * (-1340.875) (-1340.322) [-1335.188] (-1343.631) -- 0:00:25
      900000 -- (-1352.241) (-1333.805) [-1338.005] (-1353.946) * (-1344.156) (-1336.982) [-1331.382] (-1355.067) -- 0:00:25

      Average standard deviation of split frequencies: 0.007328

      900500 -- [-1344.558] (-1347.672) (-1335.182) (-1336.167) * (-1345.119) (-1350.241) [-1334.274] (-1336.335) -- 0:00:25
      901000 -- (-1340.761) (-1346.026) [-1320.921] (-1344.734) * (-1351.378) (-1339.888) [-1329.747] (-1328.308) -- 0:00:25
      901500 -- (-1345.221) (-1340.464) [-1328.185] (-1348.300) * (-1332.317) (-1350.804) [-1330.924] (-1334.197) -- 0:00:25
      902000 -- (-1347.987) (-1342.093) [-1328.831] (-1346.418) * (-1348.785) (-1341.536) (-1330.893) [-1331.666] -- 0:00:25
      902500 -- (-1343.009) [-1320.646] (-1334.267) (-1344.905) * (-1347.539) (-1344.586) [-1332.756] (-1342.117) -- 0:00:24
      903000 -- (-1334.932) [-1315.402] (-1332.409) (-1344.929) * (-1341.272) (-1337.510) [-1344.793] (-1352.365) -- 0:00:24
      903500 -- (-1343.835) (-1327.204) [-1339.656] (-1339.123) * (-1342.053) [-1338.644] (-1360.444) (-1339.275) -- 0:00:24
      904000 -- (-1350.344) (-1344.657) [-1318.985] (-1326.797) * (-1346.740) (-1343.153) (-1357.373) [-1325.479] -- 0:00:24
      904500 -- [-1347.160] (-1325.268) (-1358.166) (-1332.056) * (-1345.296) (-1332.435) (-1343.727) [-1325.309] -- 0:00:24
      905000 -- (-1352.811) (-1326.625) (-1344.556) [-1331.401] * (-1349.591) (-1349.950) (-1333.879) [-1331.154] -- 0:00:24

      Average standard deviation of split frequencies: 0.007193

      905500 -- (-1354.288) (-1345.391) [-1340.179] (-1348.179) * (-1341.298) (-1357.339) (-1337.090) [-1322.943] -- 0:00:24
      906000 -- (-1343.925) (-1337.894) [-1324.089] (-1340.419) * (-1345.237) (-1345.402) (-1338.610) [-1326.440] -- 0:00:24
      906500 -- (-1352.817) (-1333.385) [-1328.583] (-1359.620) * (-1338.342) (-1345.221) [-1335.697] (-1341.061) -- 0:00:23
      907000 -- (-1353.206) (-1338.299) [-1334.836] (-1344.957) * (-1336.340) (-1340.024) [-1323.303] (-1338.670) -- 0:00:23
      907500 -- (-1350.409) (-1335.239) [-1331.477] (-1359.295) * (-1346.156) (-1328.972) [-1314.795] (-1349.767) -- 0:00:23
      908000 -- (-1346.297) (-1341.216) [-1321.142] (-1346.679) * (-1344.126) (-1347.819) [-1316.748] (-1344.405) -- 0:00:23
      908500 -- (-1347.125) (-1334.750) [-1331.967] (-1335.921) * (-1347.269) (-1343.628) [-1345.122] (-1337.520) -- 0:00:23
      909000 -- (-1343.561) [-1329.172] (-1325.557) (-1352.645) * [-1344.347] (-1343.572) (-1347.591) (-1341.131) -- 0:00:23
      909500 -- (-1346.757) [-1324.796] (-1339.433) (-1344.885) * (-1342.116) (-1349.243) (-1348.261) [-1341.261] -- 0:00:23
      910000 -- (-1341.287) [-1321.554] (-1341.506) (-1348.881) * (-1340.196) (-1340.041) (-1339.884) [-1337.001] -- 0:00:23

      Average standard deviation of split frequencies: 0.006699

      910500 -- (-1348.163) [-1341.499] (-1328.580) (-1342.194) * [-1313.634] (-1347.760) (-1342.735) (-1323.183) -- 0:00:22
      911000 -- (-1345.615) [-1334.950] (-1332.648) (-1342.290) * [-1314.026] (-1339.007) (-1345.766) (-1344.015) -- 0:00:22
      911500 -- (-1347.082) (-1333.941) (-1335.785) [-1331.658] * [-1332.696] (-1343.490) (-1343.885) (-1344.558) -- 0:00:22
      912000 -- (-1347.232) [-1335.492] (-1344.517) (-1342.700) * (-1344.501) (-1335.926) [-1333.236] (-1347.437) -- 0:00:22
      912500 -- (-1349.630) [-1334.452] (-1348.291) (-1343.501) * (-1345.508) (-1356.513) (-1337.541) [-1343.042] -- 0:00:22
      913000 -- [-1337.749] (-1348.805) (-1338.608) (-1348.885) * [-1339.802] (-1340.098) (-1343.769) (-1340.303) -- 0:00:22
      913500 -- (-1353.611) (-1346.989) [-1344.116] (-1351.126) * (-1347.142) (-1352.768) [-1337.106] (-1341.190) -- 0:00:22
      914000 -- (-1330.053) [-1326.638] (-1347.071) (-1337.037) * (-1343.320) (-1338.715) (-1344.731) [-1332.004] -- 0:00:22
      914500 -- (-1338.125) (-1337.190) [-1328.825] (-1348.621) * (-1352.129) (-1334.568) (-1348.073) [-1331.106] -- 0:00:21
      915000 -- (-1338.093) (-1326.537) [-1321.643] (-1336.737) * (-1343.187) [-1322.222] (-1338.910) (-1329.205) -- 0:00:21

      Average standard deviation of split frequencies: 0.006872

      915500 -- (-1342.333) (-1325.670) [-1322.543] (-1352.824) * (-1348.064) (-1338.999) (-1350.848) [-1328.914] -- 0:00:21
      916000 -- (-1338.346) [-1330.131] (-1346.244) (-1338.787) * (-1350.915) [-1332.764] (-1346.946) (-1342.717) -- 0:00:21
      916500 -- (-1339.895) (-1335.057) [-1336.450] (-1341.587) * (-1352.701) [-1341.152] (-1345.173) (-1344.458) -- 0:00:21
      917000 -- [-1326.202] (-1330.381) (-1345.071) (-1350.832) * (-1343.933) [-1332.014] (-1343.126) (-1339.983) -- 0:00:21
      917500 -- [-1335.674] (-1337.846) (-1347.083) (-1340.603) * (-1346.448) (-1342.827) (-1354.543) [-1318.984] -- 0:00:21
      918000 -- [-1347.574] (-1340.516) (-1336.978) (-1353.074) * [-1330.217] (-1337.689) (-1360.429) (-1336.320) -- 0:00:20
      918500 -- (-1337.063) (-1337.009) [-1334.301] (-1352.185) * (-1348.102) [-1336.860] (-1347.059) (-1338.908) -- 0:00:20
      919000 -- (-1336.011) (-1340.073) (-1335.395) [-1338.718] * (-1345.736) (-1345.782) [-1326.908] (-1346.412) -- 0:00:20
      919500 -- (-1341.642) (-1336.551) [-1333.137] (-1353.308) * (-1343.042) (-1350.770) [-1333.517] (-1347.443) -- 0:00:20
      920000 -- (-1347.555) (-1335.864) [-1341.310] (-1345.742) * (-1343.184) (-1348.847) [-1330.368] (-1346.052) -- 0:00:20

      Average standard deviation of split frequencies: 0.006054

      920500 -- (-1338.963) [-1342.531] (-1341.946) (-1346.742) * (-1346.738) (-1341.000) (-1328.791) [-1340.011] -- 0:00:20
      921000 -- (-1339.827) (-1332.677) [-1330.901] (-1337.832) * (-1341.520) (-1354.658) [-1323.329] (-1348.881) -- 0:00:20
      921500 -- [-1336.258] (-1353.172) (-1349.000) (-1342.907) * (-1346.756) [-1339.669] (-1335.839) (-1347.040) -- 0:00:20
      922000 -- [-1319.434] (-1338.482) (-1345.119) (-1348.205) * [-1348.073] (-1338.969) (-1342.101) (-1340.560) -- 0:00:19
      922500 -- [-1324.072] (-1333.759) (-1328.870) (-1350.155) * (-1354.545) [-1319.772] (-1341.042) (-1337.092) -- 0:00:19
      923000 -- [-1344.673] (-1351.057) (-1329.824) (-1349.197) * (-1343.761) [-1317.273] (-1348.478) (-1344.588) -- 0:00:19
      923500 -- (-1343.484) (-1343.500) [-1334.017] (-1341.020) * (-1345.745) [-1326.542] (-1347.760) (-1350.697) -- 0:00:19
      924000 -- (-1340.992) (-1341.761) [-1317.053] (-1351.059) * (-1348.057) (-1332.795) [-1346.245] (-1351.856) -- 0:00:19
      924500 -- (-1352.820) (-1344.996) [-1337.803] (-1348.424) * [-1341.619] (-1335.263) (-1342.087) (-1357.992) -- 0:00:19
      925000 -- [-1337.100] (-1347.079) (-1338.832) (-1341.824) * (-1341.597) [-1333.609] (-1345.479) (-1350.761) -- 0:00:19

      Average standard deviation of split frequencies: 0.006199

      925500 -- (-1346.167) (-1334.270) [-1330.346] (-1344.225) * [-1343.033] (-1342.607) (-1344.270) (-1346.040) -- 0:00:19
      926000 -- (-1351.248) (-1338.908) [-1325.928] (-1347.659) * (-1340.406) (-1347.218) (-1342.695) [-1334.176] -- 0:00:18
      926500 -- (-1338.467) (-1342.393) [-1319.443] (-1348.028) * (-1349.724) [-1347.228] (-1353.046) (-1336.822) -- 0:00:18
      927000 -- (-1348.602) (-1343.970) [-1340.263] (-1335.085) * (-1349.146) (-1349.546) (-1345.934) [-1332.660] -- 0:00:18
      927500 -- [-1338.574] (-1349.881) (-1343.304) (-1345.450) * (-1346.865) (-1342.348) (-1347.910) [-1324.420] -- 0:00:18
      928000 -- (-1342.037) (-1342.215) (-1310.100) [-1332.538] * (-1345.351) (-1347.551) (-1350.094) [-1330.680] -- 0:00:18
      928500 -- (-1350.757) (-1349.430) (-1325.663) [-1327.754] * (-1341.992) [-1334.792] (-1349.270) (-1342.640) -- 0:00:18
      929000 -- (-1351.635) [-1337.080] (-1334.901) (-1354.264) * (-1341.583) (-1350.984) (-1341.727) [-1337.087] -- 0:00:18
      929500 -- (-1348.364) (-1346.886) [-1319.966] (-1351.336) * (-1340.715) (-1342.510) (-1341.768) [-1333.592] -- 0:00:18
      930000 -- (-1348.952) (-1341.936) [-1340.127] (-1342.031) * (-1341.303) (-1345.324) (-1343.249) [-1326.503] -- 0:00:17

      Average standard deviation of split frequencies: 0.005870

      930500 -- (-1346.759) (-1348.887) [-1335.405] (-1343.393) * (-1336.719) (-1345.880) (-1346.097) [-1338.041] -- 0:00:17
      931000 -- (-1350.682) (-1340.356) [-1331.049] (-1340.631) * (-1330.623) (-1347.355) (-1342.803) [-1319.912] -- 0:00:17
      931500 -- [-1342.164] (-1346.052) (-1334.154) (-1346.950) * (-1338.814) [-1337.204] (-1346.459) (-1324.991) -- 0:00:17
      932000 -- (-1352.855) (-1344.547) [-1322.852] (-1348.349) * [-1338.846] (-1350.227) (-1350.855) (-1317.586) -- 0:00:17
      932500 -- (-1344.749) (-1338.181) [-1331.345] (-1341.329) * (-1339.970) (-1348.749) (-1352.429) [-1336.767] -- 0:00:17
      933000 -- (-1342.462) (-1349.030) (-1335.714) [-1336.554] * (-1347.968) [-1335.547] (-1356.320) (-1338.912) -- 0:00:17
      933500 -- (-1334.254) (-1347.934) [-1328.622] (-1334.962) * (-1348.926) (-1342.067) (-1346.493) [-1332.843] -- 0:00:17
      934000 -- (-1340.269) (-1344.899) [-1335.033] (-1335.927) * (-1352.818) [-1335.526] (-1345.301) (-1331.356) -- 0:00:16
      934500 -- (-1353.985) (-1336.267) (-1339.016) [-1321.129] * (-1352.430) (-1323.527) (-1347.604) [-1329.602] -- 0:00:16
      935000 -- (-1343.811) (-1342.497) (-1352.329) [-1319.284] * (-1351.201) [-1344.475] (-1326.250) (-1354.076) -- 0:00:16

      Average standard deviation of split frequencies: 0.005570

      935500 -- (-1341.611) (-1343.951) (-1335.608) [-1322.237] * (-1354.921) (-1353.041) (-1329.659) [-1321.441] -- 0:00:16
      936000 -- (-1331.363) (-1347.337) [-1320.899] (-1334.563) * (-1344.858) (-1352.711) (-1340.047) [-1329.620] -- 0:00:16
      936500 -- (-1332.363) (-1340.546) [-1323.851] (-1334.407) * (-1346.948) (-1354.653) (-1356.053) [-1324.671] -- 0:00:16
      937000 -- [-1329.076] (-1346.581) (-1325.119) (-1359.671) * (-1352.651) (-1365.667) (-1345.485) [-1325.437] -- 0:00:16
      937500 -- (-1338.029) (-1348.002) [-1324.143] (-1341.982) * [-1327.830] (-1347.092) (-1342.063) (-1328.773) -- 0:00:16
      938000 -- (-1333.514) (-1350.393) (-1336.152) [-1316.331] * [-1333.574] (-1342.949) (-1335.740) (-1344.407) -- 0:00:15
      938500 -- (-1336.094) (-1347.592) (-1341.359) [-1317.041] * (-1352.987) (-1347.121) (-1335.694) [-1334.849] -- 0:00:15
      939000 -- (-1348.750) (-1356.572) (-1342.441) [-1316.266] * [-1335.688] (-1342.649) (-1354.238) (-1336.304) -- 0:00:15
      939500 -- (-1341.181) (-1336.464) (-1359.221) [-1309.817] * [-1316.712] (-1336.952) (-1339.395) (-1329.550) -- 0:00:15
      940000 -- (-1337.638) (-1339.137) (-1355.997) [-1315.193] * (-1342.082) [-1339.824] (-1354.536) (-1338.158) -- 0:00:15

      Average standard deviation of split frequencies: 0.005542

      940500 -- (-1348.609) (-1337.587) (-1338.677) [-1339.297] * (-1348.562) (-1336.037) [-1334.545] (-1337.107) -- 0:00:15
      941000 -- [-1341.991] (-1334.063) (-1350.170) (-1347.888) * (-1337.233) (-1349.441) (-1330.436) [-1311.873] -- 0:00:15
      941500 -- (-1338.749) (-1350.271) (-1356.388) [-1332.087] * [-1335.680] (-1349.835) (-1341.737) (-1332.390) -- 0:00:14
      942000 -- (-1346.373) [-1326.056] (-1353.133) (-1334.332) * (-1347.335) (-1327.975) [-1345.547] (-1331.798) -- 0:00:14
      942500 -- (-1348.426) [-1314.353] (-1338.714) (-1333.612) * (-1337.575) (-1339.438) [-1336.965] (-1338.213) -- 0:00:14
      943000 -- (-1344.582) [-1313.347] (-1325.217) (-1345.284) * (-1336.916) (-1350.597) [-1318.149] (-1332.673) -- 0:00:14
      943500 -- (-1346.205) (-1330.021) [-1333.952] (-1344.662) * (-1351.339) (-1352.443) [-1325.588] (-1338.652) -- 0:00:14
      944000 -- (-1348.778) (-1337.554) (-1339.780) [-1333.337] * (-1338.335) (-1335.262) [-1302.738] (-1341.992) -- 0:00:14
      944500 -- (-1347.915) (-1340.255) (-1336.942) [-1324.123] * (-1343.007) (-1342.436) [-1322.587] (-1337.709) -- 0:00:14
      945000 -- (-1335.709) (-1351.264) [-1337.593] (-1347.346) * (-1344.222) (-1348.408) [-1324.571] (-1325.608) -- 0:00:14

      Average standard deviation of split frequencies: 0.005511

      945500 -- (-1344.185) (-1340.036) [-1319.047] (-1358.024) * (-1342.355) (-1343.034) (-1325.694) [-1329.206] -- 0:00:13
      946000 -- (-1348.195) (-1344.825) [-1323.621] (-1350.487) * (-1336.594) (-1335.299) (-1348.780) [-1329.253] -- 0:00:13
      946500 -- (-1336.748) (-1354.246) [-1321.233] (-1342.236) * (-1343.416) (-1338.953) [-1337.789] (-1343.738) -- 0:00:13
      947000 -- (-1340.539) (-1353.215) [-1327.929] (-1344.019) * (-1347.527) [-1331.571] (-1330.902) (-1343.468) -- 0:00:13
      947500 -- (-1344.197) [-1332.399] (-1331.987) (-1343.459) * (-1349.029) (-1350.557) (-1332.422) [-1330.166] -- 0:00:13
      948000 -- [-1332.450] (-1335.742) (-1349.071) (-1344.954) * (-1340.367) (-1359.528) [-1334.712] (-1323.448) -- 0:00:13
      948500 -- [-1342.626] (-1343.777) (-1351.792) (-1343.510) * (-1344.319) (-1346.471) [-1338.145] (-1316.410) -- 0:00:13
      949000 -- (-1339.636) [-1331.920] (-1348.701) (-1328.770) * (-1349.400) (-1363.326) (-1337.195) [-1324.821] -- 0:00:13
      949500 -- (-1343.534) (-1345.583) (-1345.420) [-1323.221] * (-1349.942) (-1355.355) [-1331.328] (-1340.093) -- 0:00:12
      950000 -- (-1341.469) [-1337.350] (-1345.463) (-1328.399) * [-1339.056] (-1341.597) (-1345.992) (-1344.937) -- 0:00:12

      Average standard deviation of split frequencies: 0.005396

      950500 -- (-1333.482) (-1337.552) (-1338.772) [-1341.224] * [-1332.357] (-1345.728) (-1354.368) (-1339.416) -- 0:00:12
      951000 -- (-1346.370) (-1348.778) [-1333.045] (-1344.914) * (-1332.780) [-1337.011] (-1359.125) (-1340.615) -- 0:00:12
      951500 -- (-1348.478) (-1345.185) [-1345.826] (-1341.703) * [-1331.944] (-1340.229) (-1351.373) (-1342.473) -- 0:00:12
      952000 -- (-1353.038) (-1344.474) (-1350.695) [-1336.404] * (-1344.756) (-1332.487) [-1326.840] (-1345.703) -- 0:00:12
      952500 -- (-1341.836) [-1334.678] (-1360.971) (-1346.063) * (-1353.883) [-1339.852] (-1330.282) (-1340.550) -- 0:00:12
      953000 -- (-1340.967) [-1330.618] (-1344.051) (-1337.494) * (-1354.576) (-1357.566) [-1320.229] (-1346.380) -- 0:00:12
      953500 -- [-1346.821] (-1330.978) (-1348.516) (-1341.754) * (-1355.264) (-1353.401) (-1350.465) [-1338.967] -- 0:00:11
      954000 -- (-1346.537) [-1343.097] (-1326.213) (-1349.804) * (-1335.103) [-1323.393] (-1338.311) (-1325.385) -- 0:00:11
      954500 -- (-1346.268) (-1343.777) [-1320.288] (-1336.092) * (-1345.701) (-1345.145) (-1345.241) [-1310.817] -- 0:00:11
      955000 -- (-1336.672) (-1340.652) [-1339.274] (-1340.560) * (-1348.620) (-1345.280) [-1319.677] (-1322.477) -- 0:00:11

      Average standard deviation of split frequencies: 0.005511

      955500 -- (-1341.720) [-1339.609] (-1348.620) (-1339.465) * [-1337.186] (-1344.922) (-1336.927) (-1323.528) -- 0:00:11
      956000 -- (-1348.977) [-1324.278] (-1341.223) (-1341.849) * (-1338.938) (-1352.073) (-1352.757) [-1323.146] -- 0:00:11
      956500 -- (-1338.312) [-1322.853] (-1341.919) (-1356.190) * (-1345.997) (-1354.961) (-1344.843) [-1325.754] -- 0:00:11
      957000 -- (-1356.165) (-1328.242) [-1329.520] (-1354.290) * (-1345.438) [-1337.400] (-1342.568) (-1333.449) -- 0:00:11
      957500 -- (-1343.151) [-1316.311] (-1347.368) (-1349.980) * (-1350.386) (-1341.983) (-1341.885) [-1327.118] -- 0:00:10
      958000 -- (-1344.084) (-1322.620) [-1323.086] (-1353.637) * (-1344.427) (-1346.708) (-1348.121) [-1320.364] -- 0:00:10
      958500 -- (-1344.022) (-1314.727) [-1335.432] (-1348.416) * (-1336.184) (-1329.263) (-1353.290) [-1329.057] -- 0:00:10
      959000 -- [-1335.475] (-1323.253) (-1329.125) (-1340.597) * (-1344.289) [-1334.794] (-1343.695) (-1335.380) -- 0:00:10
      959500 -- (-1331.472) (-1334.107) [-1328.034] (-1339.099) * [-1343.425] (-1340.481) (-1347.268) (-1337.342) -- 0:00:10
      960000 -- (-1345.809) [-1325.232] (-1335.588) (-1351.695) * (-1345.252) [-1337.705] (-1341.098) (-1337.616) -- 0:00:10

      Average standard deviation of split frequencies: 0.005831

      960500 -- (-1344.695) [-1319.374] (-1348.500) (-1355.514) * (-1346.788) (-1341.682) [-1339.001] (-1349.983) -- 0:00:10
      961000 -- (-1347.398) [-1327.121] (-1330.692) (-1343.821) * (-1342.037) [-1342.901] (-1350.521) (-1352.449) -- 0:00:09
      961500 -- (-1345.676) [-1324.224] (-1342.515) (-1353.287) * (-1339.786) [-1312.460] (-1348.047) (-1343.878) -- 0:00:09
      962000 -- (-1344.593) [-1329.914] (-1338.824) (-1339.482) * (-1340.155) [-1322.907] (-1349.622) (-1339.129) -- 0:00:09
      962500 -- (-1362.252) (-1329.044) (-1343.763) [-1327.098] * (-1343.356) (-1330.334) (-1347.852) [-1339.616] -- 0:00:09
      963000 -- [-1351.081] (-1340.433) (-1341.519) (-1329.723) * [-1331.768] (-1346.222) (-1340.015) (-1338.790) -- 0:00:09
      963500 -- (-1339.425) (-1349.141) (-1338.456) [-1322.605] * [-1337.037] (-1341.767) (-1341.926) (-1357.581) -- 0:00:09
      964000 -- (-1337.427) (-1342.189) (-1346.001) [-1329.954] * [-1325.078] (-1341.454) (-1348.325) (-1336.981) -- 0:00:09
      964500 -- (-1331.720) (-1348.182) (-1344.204) [-1333.487] * [-1329.239] (-1342.903) (-1338.887) (-1351.573) -- 0:00:09
      965000 -- [-1345.913] (-1345.706) (-1348.478) (-1330.313) * [-1330.564] (-1347.605) (-1333.073) (-1351.591) -- 0:00:08

      Average standard deviation of split frequencies: 0.005971

      965500 -- (-1335.092) (-1345.140) (-1357.291) [-1332.833] * [-1319.143] (-1338.112) (-1331.436) (-1350.339) -- 0:00:08
      966000 -- (-1337.986) (-1346.136) (-1348.572) [-1319.039] * (-1332.679) (-1351.720) [-1331.971] (-1352.592) -- 0:00:08
      966500 -- (-1336.500) (-1350.915) (-1347.786) [-1330.190] * (-1338.302) (-1346.873) [-1324.276] (-1344.188) -- 0:00:08
      967000 -- (-1342.552) (-1340.463) (-1346.247) [-1328.283] * [-1338.283] (-1338.558) (-1352.412) (-1333.593) -- 0:00:08
      967500 -- [-1337.500] (-1348.639) (-1336.724) (-1342.935) * (-1344.295) [-1335.436] (-1351.256) (-1328.526) -- 0:00:08
      968000 -- (-1337.252) (-1348.993) [-1329.097] (-1338.462) * (-1350.013) (-1349.133) (-1339.939) [-1329.160] -- 0:00:08
      968500 -- (-1349.020) [-1334.858] (-1348.108) (-1338.608) * (-1346.132) (-1350.046) [-1335.080] (-1335.063) -- 0:00:08
      969000 -- (-1339.336) (-1333.611) (-1349.546) [-1331.945] * (-1334.459) [-1340.176] (-1346.632) (-1343.270) -- 0:00:07
      969500 -- (-1334.923) (-1341.663) (-1340.718) [-1341.686] * (-1343.902) [-1336.397] (-1346.112) (-1365.259) -- 0:00:07
      970000 -- (-1340.847) (-1324.452) (-1340.175) [-1343.363] * [-1334.484] (-1335.870) (-1348.475) (-1343.356) -- 0:00:07

      Average standard deviation of split frequencies: 0.006285

      970500 -- (-1347.890) (-1324.743) (-1343.240) [-1327.663] * (-1349.218) [-1343.298] (-1344.263) (-1352.883) -- 0:00:07
      971000 -- (-1351.355) (-1332.280) (-1342.289) [-1324.108] * (-1355.884) (-1330.087) (-1337.371) [-1333.763] -- 0:00:07
      971500 -- (-1347.131) (-1333.904) (-1343.687) [-1323.179] * (-1346.603) (-1350.937) [-1338.127] (-1347.496) -- 0:00:07
      972000 -- (-1343.664) (-1347.931) [-1338.487] (-1349.538) * (-1345.619) (-1336.592) (-1348.293) [-1313.498] -- 0:00:07
      972500 -- (-1344.501) (-1351.567) (-1341.485) [-1343.185] * (-1351.941) (-1342.792) (-1362.088) [-1324.763] -- 0:00:07
      973000 -- [-1342.327] (-1340.202) (-1332.705) (-1350.929) * (-1344.652) (-1345.248) (-1345.118) [-1325.984] -- 0:00:06
      973500 -- (-1344.179) (-1337.205) (-1342.741) [-1327.596] * (-1348.873) (-1345.838) (-1339.917) [-1340.566] -- 0:00:06
      974000 -- (-1340.060) (-1341.604) (-1345.664) [-1338.167] * (-1344.955) (-1341.693) (-1335.529) [-1338.607] -- 0:00:06
      974500 -- [-1327.747] (-1355.211) (-1343.876) (-1344.475) * (-1352.894) (-1341.921) (-1347.967) [-1332.859] -- 0:00:06
      975000 -- (-1345.699) (-1351.191) (-1342.247) [-1331.825] * (-1344.436) (-1341.150) [-1345.863] (-1336.545) -- 0:00:06

      Average standard deviation of split frequencies: 0.006336

      975500 -- (-1342.995) (-1348.785) (-1346.763) [-1337.192] * (-1344.241) (-1340.289) (-1328.808) [-1344.819] -- 0:00:06
      976000 -- (-1347.600) [-1342.268] (-1346.367) (-1342.202) * (-1342.804) [-1325.284] (-1337.297) (-1342.716) -- 0:00:06
      976500 -- [-1342.453] (-1342.650) (-1352.571) (-1346.381) * (-1340.710) (-1340.771) [-1336.321] (-1340.185) -- 0:00:06
      977000 -- [-1328.439] (-1355.294) (-1350.774) (-1350.797) * (-1335.521) (-1331.191) [-1342.070] (-1358.167) -- 0:00:05
      977500 -- [-1337.410] (-1343.522) (-1347.006) (-1345.131) * (-1339.737) [-1339.057] (-1342.467) (-1349.866) -- 0:00:05
      978000 -- (-1346.633) [-1343.560] (-1340.756) (-1351.042) * (-1347.222) [-1347.407] (-1341.217) (-1338.580) -- 0:00:05
      978500 -- (-1341.707) (-1343.811) [-1336.567] (-1350.562) * (-1351.488) (-1345.713) [-1328.537] (-1355.379) -- 0:00:05
      979000 -- (-1345.971) (-1353.052) (-1342.228) [-1326.758] * (-1325.757) (-1353.383) [-1307.022] (-1350.636) -- 0:00:05
      979500 -- (-1345.222) [-1341.897] (-1349.820) (-1346.390) * (-1329.941) (-1345.393) (-1324.006) [-1334.139] -- 0:00:05
      980000 -- (-1350.720) (-1339.393) (-1343.647) [-1322.884] * [-1323.694] (-1345.478) (-1329.146) (-1341.154) -- 0:00:05

      Average standard deviation of split frequencies: 0.006419

      980500 -- (-1349.227) (-1346.703) (-1334.044) [-1324.569] * [-1320.539] (-1352.787) (-1346.256) (-1340.755) -- 0:00:05
      981000 -- (-1340.657) (-1357.547) [-1325.730] (-1327.860) * [-1333.214] (-1354.680) (-1339.321) (-1346.714) -- 0:00:04
      981500 -- (-1345.945) (-1351.358) (-1321.499) [-1322.198] * (-1345.996) (-1341.796) (-1355.382) [-1339.653] -- 0:00:04
      982000 -- (-1354.534) (-1343.001) (-1327.304) [-1323.958] * (-1324.137) [-1320.800] (-1341.924) (-1346.492) -- 0:00:04
      982500 -- (-1351.919) (-1341.988) (-1345.679) [-1316.527] * [-1315.694] (-1341.492) (-1341.377) (-1344.408) -- 0:00:04
      983000 -- (-1349.546) (-1334.390) (-1348.023) [-1345.591] * [-1323.491] (-1346.576) (-1350.501) (-1346.770) -- 0:00:04
      983500 -- [-1346.755] (-1343.145) (-1347.790) (-1344.067) * [-1324.185] (-1336.125) (-1340.229) (-1333.801) -- 0:00:04
      984000 -- (-1347.312) (-1342.206) [-1340.446] (-1340.792) * [-1324.633] (-1337.015) (-1341.517) (-1342.199) -- 0:00:04
      984500 -- (-1342.375) (-1347.999) [-1336.069] (-1329.225) * [-1336.781] (-1359.967) (-1350.620) (-1327.753) -- 0:00:03
      985000 -- (-1351.561) [-1339.379] (-1341.315) (-1310.170) * (-1344.835) (-1357.183) (-1353.243) [-1334.536] -- 0:00:03

      Average standard deviation of split frequencies: 0.005737

      985500 -- (-1343.075) (-1333.890) (-1340.955) [-1315.565] * (-1331.454) (-1352.496) (-1346.329) [-1334.717] -- 0:00:03
      986000 -- (-1346.178) (-1339.369) (-1343.757) [-1318.235] * (-1331.970) (-1346.798) (-1345.170) [-1326.150] -- 0:00:03
      986500 -- (-1354.389) [-1340.314] (-1337.057) (-1325.126) * (-1334.718) (-1344.162) (-1350.246) [-1335.570] -- 0:00:03
      987000 -- (-1344.983) [-1328.422] (-1341.614) (-1338.376) * (-1352.189) (-1336.809) (-1352.745) [-1333.236] -- 0:00:03
      987500 -- (-1335.562) [-1342.474] (-1346.927) (-1349.080) * (-1351.653) (-1352.873) (-1347.338) [-1336.375] -- 0:00:03
      988000 -- [-1336.324] (-1337.021) (-1347.571) (-1346.257) * (-1343.960) [-1332.419] (-1348.778) (-1342.047) -- 0:00:03
      988500 -- [-1331.703] (-1340.691) (-1345.871) (-1346.216) * (-1349.143) [-1318.041] (-1349.465) (-1337.551) -- 0:00:02
      989000 -- [-1337.772] (-1335.172) (-1342.502) (-1342.340) * (-1343.610) [-1315.286] (-1356.463) (-1337.205) -- 0:00:02
      989500 -- (-1335.355) [-1334.945] (-1344.388) (-1341.195) * (-1339.512) (-1336.576) (-1346.475) [-1342.365] -- 0:00:02
      990000 -- (-1337.630) (-1337.241) [-1335.962] (-1350.834) * [-1321.710] (-1335.296) (-1350.303) (-1352.150) -- 0:00:02

      Average standard deviation of split frequencies: 0.005486

      990500 -- [-1326.984] (-1342.542) (-1349.757) (-1342.193) * [-1320.129] (-1352.636) (-1339.644) (-1350.023) -- 0:00:02
      991000 -- [-1317.044] (-1342.920) (-1353.472) (-1348.035) * [-1336.061] (-1355.998) (-1345.276) (-1346.716) -- 0:00:02
      991500 -- (-1348.305) (-1350.523) (-1347.760) [-1322.638] * [-1327.492] (-1346.899) (-1333.995) (-1345.053) -- 0:00:02
      992000 -- (-1340.434) [-1333.156] (-1354.615) (-1328.557) * [-1330.259] (-1347.529) (-1339.744) (-1344.567) -- 0:00:02
      992500 -- (-1344.064) (-1345.902) (-1346.943) [-1335.859] * (-1335.960) (-1357.770) (-1347.014) [-1310.984] -- 0:00:01
      993000 -- (-1352.310) (-1346.800) (-1342.682) [-1346.387] * (-1320.982) (-1355.113) (-1347.721) [-1321.907] -- 0:00:01
      993500 -- (-1341.684) (-1350.509) (-1346.356) [-1336.588] * (-1333.807) (-1341.185) (-1341.691) [-1320.715] -- 0:00:01
      994000 -- (-1351.117) (-1352.166) (-1346.855) [-1336.673] * (-1336.049) (-1363.092) (-1343.400) [-1329.379] -- 0:00:01
      994500 -- (-1353.538) [-1344.634] (-1340.381) (-1335.351) * [-1320.604] (-1349.008) (-1345.634) (-1333.482) -- 0:00:01
      995000 -- [-1336.430] (-1353.461) (-1346.886) (-1339.985) * [-1320.825] (-1354.371) (-1337.748) (-1331.967) -- 0:00:01

      Average standard deviation of split frequencies: 0.005011

      995500 -- [-1333.574] (-1353.059) (-1344.769) (-1350.400) * [-1327.072] (-1348.811) (-1341.851) (-1332.921) -- 0:00:01
      996000 -- [-1336.150] (-1343.468) (-1337.228) (-1344.988) * [-1321.108] (-1351.577) (-1339.109) (-1341.719) -- 0:00:01
      996500 -- (-1347.179) (-1350.077) [-1335.886] (-1346.969) * (-1342.745) [-1334.277] (-1339.275) (-1365.054) -- 0:00:00
      997000 -- (-1338.788) (-1347.210) (-1343.849) [-1337.367] * (-1331.519) [-1333.340] (-1341.984) (-1350.267) -- 0:00:00
      997500 -- (-1346.323) (-1348.602) [-1338.869] (-1340.138) * (-1345.862) [-1342.710] (-1347.330) (-1342.253) -- 0:00:00
      998000 -- (-1345.314) (-1348.877) (-1341.310) [-1341.020] * (-1334.383) (-1342.218) [-1347.877] (-1347.146) -- 0:00:00
      998500 -- (-1346.804) (-1342.080) [-1343.838] (-1343.759) * (-1345.442) (-1335.548) (-1349.090) [-1343.340] -- 0:00:00
      999000 -- (-1343.556) (-1343.975) [-1324.796] (-1338.297) * (-1342.813) (-1332.164) (-1342.632) [-1332.824] -- 0:00:00
      999500 -- (-1341.637) (-1345.957) [-1336.968] (-1338.946) * (-1339.330) [-1330.145] (-1339.735) (-1331.889) -- 0:00:00
      1000000 -- (-1345.156) (-1340.680) [-1342.068] (-1341.799) * (-1344.238) [-1331.270] (-1337.425) (-1339.934) -- 0:00:00

      Average standard deviation of split frequencies: 0.005182
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -1345.155526 -- 10.158636
         Chain 1 -- -1345.155527 -- 10.158636
         Chain 2 -- -1340.680244 -- 26.880241
         Chain 2 -- -1340.680243 -- 26.880241
         Chain 3 -- -1342.067780 -- 24.185667
         Chain 3 -- -1342.067782 -- 24.185667
         Chain 4 -- -1341.799165 -- 25.245059
         Chain 4 -- -1341.799168 -- 25.245059
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -1344.237681 -- 7.992300
         Chain 1 -- -1344.237679 -- 7.992300
         Chain 2 -- -1331.270201 -- 26.772415
         Chain 2 -- -1331.270195 -- 26.772415
         Chain 3 -- -1337.424661 -- 24.664443
         Chain 3 -- -1337.424657 -- 24.664443
         Chain 4 -- -1339.934025 -- 20.164772
         Chain 4 -- -1339.934026 -- 20.164772

      Analysis completed in 4 mins 17 seconds
      Analysis used 256.60 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1300.34
      Likelihood of best state for "cold" chain of run 2 was -1303.01

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            58.9 %     ( 61 %)     Dirichlet(Revmat{all})
            78.7 %     ( 74 %)     Slider(Revmat{all})
            27.1 %     ( 24 %)     Dirichlet(Pi{all})
            29.2 %     ( 34 %)     Slider(Pi{all})
            35.4 %     ( 20 %)     Multiplier(Alpha{1,2})
            47.5 %     ( 29 %)     Multiplier(Alpha{3})
            35.1 %     ( 25 %)     Slider(Pinvar{all})
            37.9 %     ( 40 %)     ExtSPR(Tau{all},V{all})
            13.7 %     ( 15 %)     ExtTBR(Tau{all},V{all})
            47.2 %     ( 49 %)     NNI(Tau{all},V{all})
            39.5 %     ( 32 %)     ParsSPR(Tau{all},V{all})
            27.3 %     ( 28 %)     Multiplier(V{all})
            63.4 %     ( 59 %)     Nodeslider(V{all})
            28.5 %     ( 24 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            58.7 %     ( 42 %)     Dirichlet(Revmat{all})
            78.0 %     ( 67 %)     Slider(Revmat{all})
            27.0 %     ( 31 %)     Dirichlet(Pi{all})
            29.5 %     ( 22 %)     Slider(Pi{all})
            35.1 %     ( 22 %)     Multiplier(Alpha{1,2})
            47.5 %     ( 34 %)     Multiplier(Alpha{3})
            35.0 %     ( 32 %)     Slider(Pinvar{all})
            37.7 %     ( 36 %)     ExtSPR(Tau{all},V{all})
            13.4 %     ( 14 %)     ExtTBR(Tau{all},V{all})
            47.1 %     ( 54 %)     NNI(Tau{all},V{all})
            39.3 %     ( 31 %)     ParsSPR(Tau{all},V{all})
            27.6 %     ( 29 %)     Multiplier(V{all})
            63.5 %     ( 61 %)     Nodeslider(V{all})
            28.7 %     ( 17 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.47    0.20    0.09 
         2 |  166203            0.58    0.32 
         3 |  166879  166866            0.66 
         4 |  166371  167154  166527         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.47    0.21    0.09 
         2 |  167099            0.59    0.33 
         3 |  166211  166333            0.66 
         4 |  167060  167070  166227         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -1325.28
      |    2           1                                      1    |
      |                                                            |
      |         2                       2      1                   |
      |       1     22     2      2             1                  |
      |                      2           22    2   1          2   2|
      |  1    2 1  1        1  1  11               2    1 1  1 2   |
      |   2 1            1    22    122    2  2 22        2*     2 |
      |      2   * 2  1 1 2   1  1     1   111    2      2     1   |
      |*1      2         2      1     12      1        2    2   21 |
      |    12  1  *    2           2      1      1  2 21    12  1  |
      |   1  1          2    1  2   21  1   2       1              |
      |  2            2   1      2           2       1   1         |
      |                    12            1            1           1|
      |             11                            1  2  2          |
      | 2                                                          |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1337.80
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -1309.54         -1349.51
        2      -1309.56         -1346.69
      --------------------------------------
      TOTAL    -1309.55         -1348.87
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.773171    0.183746    0.131319    1.555523    0.690411    663.42    688.18    1.000
      r(A<->C){all}   0.076535    0.002012    0.001789    0.161277    0.069540    462.70    489.46    1.001
      r(A<->G){all}   0.184582    0.011134    0.020620    0.390947    0.167742    212.49    231.45    1.002
      r(A<->T){all}   0.057489    0.001708    0.000097    0.134465    0.048918    377.68    445.33    1.004
      r(C<->G){all}   0.047575    0.001074    0.000793    0.112710    0.040204    431.71    433.92    1.001
      r(C<->T){all}   0.612294    0.021431    0.353034    0.902968    0.619312    213.30    224.03    1.002
      r(G<->T){all}   0.021526    0.000482    0.000014    0.064504    0.014852    601.31    750.46    1.000
      pi(A){all}      0.287230    0.000269    0.256960    0.320471    0.286909   1068.07   1074.44    1.000
      pi(C){all}      0.257498    0.000247    0.227803    0.288917    0.257218   1026.46   1151.09    1.000
      pi(G){all}      0.257149    0.000252    0.225835    0.287693    0.257058   1164.42   1248.35    1.000
      pi(T){all}      0.198123    0.000200    0.170892    0.225212    0.197553   1054.69   1148.15    1.000
      alpha{1,2}      0.088992    0.000625    0.051868    0.147356    0.085145    599.85    891.91    1.000
      alpha{3}        0.762185    0.259295    0.077749    1.735662    0.631283    704.62    757.91    1.000
      pinvar{all}     0.853421    0.001031    0.787751    0.908532    0.857633    767.83    969.32    1.001
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8
      9 -- C9
     10 -- C10
     11 -- C11
     12 -- C12

   Key to taxon bipartitions (saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------------
    1 -- .***********
    2 -- .*..........
    3 -- ..*.........
    4 -- ...*........
    5 -- ....*.......
    6 -- .....*......
    7 -- ......*.....
    8 -- .......*....
    9 -- ........*...
   10 -- .........*..
   11 -- ..........*.
   12 -- ...........*
   13 -- .....*******
   14 -- .....***....
   15 -- ...**.......
   16 -- .....*.*....
   17 -- ...*********
   18 -- .....***.***
   19 -- ..........**
   20 -- .**.........
   21 -- ......**....
   22 -- ..**********
   23 -- .*.*********
   24 -- .....***.*..
   25 -- .........***
   26 -- .....***..**
   27 -- ....********
   28 -- ...*.*******
   29 -- .****.......
   ------------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
   13  3002    1.000000    0.000000    1.000000    1.000000    2
   14  2396    0.798135    0.003769    0.795470    0.800799    2
   15  1936    0.644903    0.004711    0.641572    0.648235    2
   16  1923    0.640573    0.011777    0.632245    0.648901    2
   17  1883    0.627249    0.003298    0.624917    0.629580    2
   18  1807    0.601932    0.005182    0.598268    0.605596    2
   19  1510    0.502998    0.000942    0.502332    0.503664    2
   20   904    0.301133    0.002827    0.299134    0.303131    2
   21   863    0.287475    0.001413    0.286476    0.288474    2
   22   799    0.266156    0.000471    0.265823    0.266489    2
   23   759    0.252831    0.010835    0.245170    0.260493    2
   24   617    0.205530    0.014604    0.195203    0.215856    2
   25   606    0.201865    0.012248    0.193205    0.210526    2
   26   567    0.188874    0.009893    0.181879    0.195869    2
   27   505    0.168221    0.000471    0.167888    0.168554    2
   28   463    0.154231    0.004240    0.151233    0.157229    2
   29   301    0.100266    0.001413    0.099267    0.101266    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.019842    0.000440    0.000009    0.059940    0.013273    1.000    2
   length{all}[2]     0.010013    0.000173    0.000005    0.034282    0.005636    1.000    2
   length{all}[3]     0.019618    0.000399    0.000006    0.056496    0.013282    1.000    2
   length{all}[4]     0.011538    0.000243    0.000003    0.040313    0.006259    1.000    2
   length{all}[5]     0.020287    0.000432    0.000030    0.062166    0.013798    1.000    2
   length{all}[6]     0.031088    0.000993    0.000144    0.089947    0.021542    1.002    2
   length{all}[7]     0.031357    0.000900    0.000064    0.094820    0.022371    1.000    2
   length{all}[8]     0.025340    0.000729    0.000012    0.075549    0.017199    1.000    2
   length{all}[9]     0.100096    0.005424    0.001928    0.246714    0.080981    1.001    2
   length{all}[10]    0.052965    0.001899    0.002200    0.137604    0.040736    1.000    2
   length{all}[11]    0.055734    0.001987    0.002572    0.147711    0.042965    1.000    2
   length{all}[12]    0.055828    0.001988    0.002722    0.144408    0.042643    1.000    2
   length{all}[13]    0.150544    0.010237    0.013064    0.345342    0.126889    1.000    2
   length{all}[14]    0.042564    0.001700    0.000048    0.126677    0.030258    1.000    2
   length{all}[15]    0.024778    0.000660    0.000046    0.076561    0.016780    0.999    2
   length{all}[16]    0.028003    0.000806    0.000058    0.081638    0.019381    1.001    2
   length{all}[17]    0.027145    0.000749    0.000037    0.078086    0.018904    1.000    2
   length{all}[18]    0.042234    0.001854    0.000082    0.123934    0.028841    1.000    2
   length{all}[19]    0.027755    0.000995    0.000064    0.083785    0.017970    1.000    2
   length{all}[20]    0.011071    0.000215    0.000000    0.035771    0.006598    1.000    2
   length{all}[21]    0.026934    0.000754    0.000160    0.074879    0.018687    0.999    2
   length{all}[22]    0.011266    0.000234    0.000004    0.038275    0.006296    1.000    2
   length{all}[23]    0.010944    0.000223    0.000030    0.034506    0.005984    0.999    2
   length{all}[24]    0.015949    0.000347    0.000007    0.057891    0.009669    0.999    2
   length{all}[25]    0.016755    0.000424    0.000035    0.059675    0.009212    1.002    2
   length{all}[26]    0.016818    0.000464    0.000014    0.061695    0.009872    0.998    2
   length{all}[27]    0.013684    0.000330    0.000006    0.047381    0.007486    1.016    2
   length{all}[28]    0.013134    0.000343    0.000019    0.043222    0.007331    0.998    2
   length{all}[29]    0.014948    0.000453    0.000010    0.053464    0.007087    0.998    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.005182
       Maximum standard deviation of split frequencies = 0.014604
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.016


   Clade credibility values:

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |---------------------------------------------------------------------- C2 (2)
   |                                                                               
   |---------------------------------------------------------------------- C3 (3)
   |                                                                               
   |                                                         /------------ C4 (4)
   +           /----------------------64---------------------+                     
   |           |                                             \------------ C5 (5)
   |           |                                                                   
   |           |                                             /------------ C6 (6)
   |           |                                  /----64----+                     
   |           |                                  |          \------------ C8 (8)
   \-----63----+                      /-----80----+                                
               |                      |           \----------------------- C7 (7)
               |                      |                                            
               |          /-----60----+----------------------------------- C10 (10)
               |          |           |                                            
               |          |           |                      /------------ C11 (11)
               \----100---+           \----------50----------+                     
                          |                                  \------------ C12 (12)
                          |                                                        
                          \----------------------------------------------- C9 (9)
                                                                                   

   Phylogram (based on average branch lengths):

   /---- C1 (1)
   |                                                                               
   |-- C2 (2)
   |                                                                               
   |---- C3 (3)
   |                                                                               
   |         /-- C4 (4)
   +     /---+                                                                     
   |     |   \---- C5 (5)
   |     |                                                                         
   |     |                                                           /------ C6 (6)
   |     |                                                     /-----+             
   |     |                                                     |     \----- C8 (8)
   \-----+                                            /--------+                   
         |                                            |        \------- C7 (7)
         |                                            |                            
         |                                    /-------+------------ C10 (10)
         |                                    |       |                            
         |                                    |       |    /------------- C11 (11)
         \------------------------------------+       \----+                       
                                              |            \------------- C12 (12)
                                              |                                    
                                              \----------------------- C9 (9)
                                                                                   
   |-------------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (1833 trees sampled):
      50 % credible set contains 380 trees
      90 % credible set contains 1533 trees
      95 % credible set contains 1683 trees
      99 % credible set contains 1803 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 12  	ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Reading seq # 9: C9     
Reading seq #10: C10     
Reading seq #11: C11     
Reading seq #12: C12     
Sequences read..
Counting site patterns..  0:00

          83 patterns at      248 /      248 sites (100.0%),  0:00
Counting codons..
NG distances for seqs.:
   1   2   3   4   5   6   7   8   9  10  11  12

      528 bytes for distance
    81008 bytes for conP
    11288 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
   324032 bytes for conP, adjusted

    0.004202    0.000000    0.004879    0.006223    0.003050    0.000742    0.004580    0.027677    0.009289    0.009324    0.002061    0.005066    0.007700    0.006923    0.014015    0.006934    0.010881    0.014562    0.023027    0.300000    1.300000

ntime & nrate & np:    19     2    21

Bounds (np=21):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    21
lnL0 = -1305.189573

Iterating by ming2
Initial: fx=  1305.189573
x=  0.00420  0.00000  0.00488  0.00622  0.00305  0.00074  0.00458  0.02768  0.00929  0.00932  0.00206  0.00507  0.00770  0.00692  0.01401  0.00693  0.01088  0.01456  0.02303  0.30000  1.30000

  1 h-m-p  0.0000 0.0000 455.7460 ++     1305.188894  m 0.0000    26 | 1/21
  2 h-m-p  0.0000 0.0000 645.6971 ++     1304.944780  m 0.0000    50 | 2/21
  3 h-m-p  0.0000 0.0000 242.1478 CYCCC  1304.699064  4 0.0000    81 | 2/21
  4 h-m-p  0.0000 0.0002 224.7969 +CCCCC  1303.817034  4 0.0001   114 | 2/21
  5 h-m-p  0.0000 0.0004 522.0149 +YYYYCCCC  1300.885492  7 0.0002   149 | 2/21
  6 h-m-p  0.0000 0.0002 1615.1048 +YYYCCC  1292.562366  5 0.0001   181 | 2/21
  7 h-m-p  0.0000 0.0000 7030.5814 +YYYCCC  1289.063676  5 0.0000   213 | 2/21
  8 h-m-p  0.0000 0.0000 8519.7966 +YYCCC  1286.452896  4 0.0000   244 | 2/21
  9 h-m-p  0.0000 0.0001 1555.1510 +YYYYYCCCCC  1282.220052  9 0.0001   282 | 2/21
 10 h-m-p  0.0000 0.0000 3462.1297 +YCYCCC  1281.043357  5 0.0000   315 | 2/21
 11 h-m-p  0.0000 0.0001 563.2043 YCCCC  1280.366428  4 0.0000   346 | 2/21
 12 h-m-p  0.0000 0.0001 653.5107 CCCCC  1279.654816  4 0.0000   378 | 2/21
 13 h-m-p  0.0001 0.0003  74.9382 YYC    1279.577738  2 0.0000   404 | 2/21
 14 h-m-p  0.0001 0.0032  42.0755 +CCC   1279.355009  2 0.0004   433 | 2/21
 15 h-m-p  0.0001 0.0008 283.8948 +YYCCCCC  1278.257275  6 0.0003   468 | 2/21
 16 h-m-p  0.0001 0.0007 1336.5051 ++     1244.915164  m 0.0007   492 | 2/21
 17 h-m-p  0.0000 0.0000 216075.3895 YYY    1244.844121  2 0.0000   518 | 2/21
 18 h-m-p  0.0000 0.0000  13.7373 ++     1244.841598  m 0.0000   542 | 2/21
 19 h-m-p  0.0001 0.0433   1.3212 +++YCCC  1243.339823  3 0.0105   574 | 2/21
 20 h-m-p  0.0001 0.0003  95.1540 YCYCCC  1241.202862  5 0.0002   606 | 2/21
 21 h-m-p  0.1112 0.5562   0.0548 +YCCCC  1238.109287  4 0.3067   638 | 2/21
 22 h-m-p  0.2253 1.2484   0.0746 +YYYCCC  1233.970542  5 0.8065   689 | 2/21
 23 h-m-p  0.8733 4.3665   0.0477 CCCC   1232.983031  3 1.3899   738 | 2/21
 24 h-m-p  0.5210 2.7184   0.1272 YCCCC  1231.920607  4 1.1456   788 | 2/21
 25 h-m-p  0.3760 1.8802   0.1944 YCCCC  1230.944791  4 0.9233   838 | 2/21
 26 h-m-p  0.6090 3.0450   0.2140 CCCC   1230.260478  3 0.8305   887 | 2/21
 27 h-m-p  1.0428 5.2141   0.1611 CCC    1229.756032  2 1.2906   934 | 2/21
 28 h-m-p  0.9937 4.9684   0.2032 CYCCC  1229.112827  4 1.5060   984 | 2/21
 29 h-m-p  0.9439 4.7196   0.1847 CCCC   1228.702074  3 1.4362  1033 | 2/21
 30 h-m-p  1.3957 8.0000   0.1901 CYC    1228.355379  2 1.4156  1079 | 2/21
 31 h-m-p  1.6000 8.0000   0.1078 CCC    1228.186581  2 1.7716  1126 | 2/21
 32 h-m-p  1.6000 8.0000   0.0611 CCCC   1228.065903  3 2.2130  1175 | 2/21
 33 h-m-p  1.6000 8.0000   0.0275 CC     1228.007800  1 2.0369  1220 | 2/21
 34 h-m-p  1.6000 8.0000   0.0297 YCC    1227.969608  2 2.6246  1266 | 2/21
 35 h-m-p  1.6000 8.0000   0.0236 YC     1227.917936  1 3.5656  1310 | 2/21
 36 h-m-p  1.6000 8.0000   0.0343 +YC    1227.797345  1 4.2711  1355 | 2/21
 37 h-m-p  1.3248 8.0000   0.1107 +YC    1227.473386  1 4.1629  1400 | 2/21
 38 h-m-p  1.6000 8.0000   0.1441 CCCC   1227.036866  3 2.5313  1449 | 2/21
 39 h-m-p  1.6000 8.0000   0.0766 YCCC   1226.745241  3 2.7734  1497 | 2/21
 40 h-m-p  1.4191 8.0000   0.1498 CC     1226.588818  1 1.6735  1542 | 2/21
 41 h-m-p  1.6000 8.0000   0.1158 CCC    1226.540323  2 1.3982  1589 | 2/21
 42 h-m-p  1.6000 8.0000   0.0322 CC     1226.520512  1 1.8902  1634 | 2/21
 43 h-m-p  1.6000 8.0000   0.0189 C      1226.518369  0 1.5054  1677 | 2/21
 44 h-m-p  1.6000 8.0000   0.0004 C      1226.517954  0 1.8490  1720 | 2/21
 45 h-m-p  0.9173 8.0000   0.0008 C      1226.517894  0 1.4586  1763 | 2/21
 46 h-m-p  1.6000 8.0000   0.0001 C      1226.517884  0 1.6607  1806 | 2/21
 47 h-m-p  1.6000 8.0000   0.0000 C      1226.517883  0 1.8971  1849 | 2/21
 48 h-m-p  0.3794 8.0000   0.0001 +Y     1226.517883  0 1.1898  1893 | 2/21
 49 h-m-p  1.6000 8.0000   0.0000 C      1226.517883  0 1.6000  1936 | 2/21
 50 h-m-p  1.6000 8.0000   0.0000 Y      1226.517883  0 2.6049  1979 | 2/21
 51 h-m-p  1.6000 8.0000   0.0000 --Y    1226.517883  0 0.0250  2024 | 2/21
 52 h-m-p  0.0160 8.0000   0.0000 ------C  1226.517883  0 0.0000  2073
Out..
lnL  = -1226.517883
2074 lfun, 2074 eigenQcodon, 39406 P(t)

Time used:  0:12


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
    0.004608    0.000869    0.004645    0.006155    0.002447    0.000000    0.005164    0.027740    0.008922    0.010170    0.001602    0.005036    0.007631    0.007607    0.013922    0.006795    0.010580    0.014695    0.023269    2.353508    0.822315    0.590611

ntime & nrate & np:    19     2    22

Bounds (np=22):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 5.453029

np =    22
lnL0 = -1255.239283

Iterating by ming2
Initial: fx=  1255.239283
x=  0.00461  0.00087  0.00465  0.00615  0.00245  0.00000  0.00516  0.02774  0.00892  0.01017  0.00160  0.00504  0.00763  0.00761  0.01392  0.00679  0.01058  0.01470  0.02327  2.35351  0.82232  0.59061

  1 h-m-p  0.0000 0.0000 555.4129 ++     1255.238263  m 0.0000    27 | 1/22
  2 h-m-p  0.0000 0.0000 446.9959 ++     1254.943963  m 0.0000    52 | 2/22
  3 h-m-p  0.0000 0.0001 189.2076 CCCC   1254.773434  3 0.0000    83 | 2/22
  4 h-m-p  0.0000 0.0004  63.8337 CCC    1254.679731  2 0.0001   112 | 2/22
  5 h-m-p  0.0001 0.0005  69.1109 CCC    1254.573742  2 0.0001   141 | 2/22
  6 h-m-p  0.0000 0.0008 158.5391 +CCCC  1254.084621  3 0.0002   173 | 2/22
  7 h-m-p  0.0000 0.0004 706.9681 +CCYCCC  1250.188974  5 0.0003   209 | 2/22
  8 h-m-p  0.0000 0.0000 15656.0697 +CYYCCC  1246.213455  5 0.0000   243 | 2/22
  9 h-m-p  0.0000 0.0000 329945.3670 ++     1245.619137  m 0.0000   268 | 3/22
 10 h-m-p  0.0000 0.0000 1621.7545 CCCCC  1245.499340  4 0.0000   301 | 3/22
 11 h-m-p  0.0000 0.0001 2064.8118 YCCC   1245.147941  3 0.0000   331 | 3/22
 12 h-m-p  0.0000 0.0000 1301.2811 CCC    1245.042042  2 0.0000   360 | 3/22
 13 h-m-p  0.0000 0.0001 1843.7000 CYC    1244.818817  2 0.0000   388 | 3/22
 14 h-m-p  0.0001 0.0003 269.5120 YCCC   1244.665276  3 0.0001   418 | 3/22
 15 h-m-p  0.0001 0.0008 187.1573 YCCC   1244.281270  3 0.0002   448 | 3/22
 16 h-m-p  0.0001 0.0003 351.7492 CYCCC  1243.597558  4 0.0001   480 | 3/22
 17 h-m-p  0.0000 0.0002 348.3676 CCCCC  1243.250564  4 0.0001   513 | 3/22
 18 h-m-p  0.0002 0.0009  59.2675 CYCCC  1242.816695  4 0.0003   545 | 2/22
 19 h-m-p  0.0001 0.0006  77.1043 +CC    1242.101842  1 0.0005   573 | 2/22
 20 h-m-p  0.0033 0.0166   3.4294 YYC    1242.049387  2 0.0025   600 | 2/22
 21 h-m-p  0.0003 0.0485  33.1070 +++CYYYYYCCCC  1233.406798 10 0.0332   642 | 2/22
 22 h-m-p  0.0767 0.3833   0.5136 ++     1230.109955  m 0.3833   667 | 3/22
 23 h-m-p  0.1498 0.7489   0.2077 CCCC   1229.260485  3 0.2070   718 | 2/22
 24 h-m-p  0.0079 0.0393   3.5785 -YC    1229.258938  1 0.0003   764 | 2/22
 25 h-m-p  0.0020 0.0255   0.5593 ++     1229.154882  m 0.0255   789 | 3/22
 26 h-m-p  0.0235 1.8782   0.6060 ++CCY  1228.288829  2 0.5526   840 | 3/22
 27 h-m-p  0.3427 1.7136   0.8644 CCCC   1227.726200  3 0.4749   890 | 3/22
 28 h-m-p  0.4948 3.4689   0.8295 CCC    1227.238144  2 0.5512   938 | 3/22
 29 h-m-p  1.4012 7.0059   0.1220 CCCCC  1226.809212  4 1.8653   990 | 3/22
 30 h-m-p  0.9221 4.6106   0.0504 CCCC   1226.585571  3 1.4886  1040 | 3/22
 31 h-m-p  1.6000 8.0000   0.0447 CYC    1226.321014  2 2.0868  1087 | 3/22
 32 h-m-p  0.5895 2.9473   0.1215 CCCCC  1226.141640  4 0.7924  1139 | 3/22
 33 h-m-p  1.6000 8.0000   0.0388 CCC    1226.022449  2 1.8246  1187 | 3/22
 34 h-m-p  0.9988 8.0000   0.0709 YC     1225.950175  1 2.2541  1232 | 3/22
 35 h-m-p  1.6000 8.0000   0.0036 CCC    1225.878230  2 2.1757  1280 | 3/22
 36 h-m-p  0.1724 8.0000   0.0456 ++CCC  1225.792462  2 3.0583  1330 | 3/22
 37 h-m-p  1.6000 8.0000   0.0585 CCC    1225.732525  2 1.7123  1378 | 3/22
 38 h-m-p  1.6000 8.0000   0.0508 CC     1225.681772  1 1.9698  1424 | 3/22
 39 h-m-p  1.6000 8.0000   0.0158 YC     1225.579991  1 3.8703  1469 | 3/22
 40 h-m-p  1.6000 8.0000   0.0137 CCC    1225.516658  2 2.3471  1517 | 3/22
 41 h-m-p  1.6000 8.0000   0.0027 CC     1225.486984  1 1.7940  1563 | 3/22
 42 h-m-p  0.1765 8.0000   0.0271 +YC    1225.478116  1 1.5600  1609 | 3/22
 43 h-m-p  1.6000 8.0000   0.0143 YC     1225.470261  1 2.6254  1654 | 3/22
 44 h-m-p  1.6000 8.0000   0.0122 CC     1225.466864  1 2.4281  1700 | 3/22
 45 h-m-p  1.6000 8.0000   0.0070 CC     1225.465257  1 1.9070  1746 | 3/22
 46 h-m-p  1.6000 8.0000   0.0024 C      1225.465103  0 1.8030  1790 | 3/22
 47 h-m-p  1.6000 8.0000   0.0010 C      1225.465070  0 1.7644  1834 | 3/22
 48 h-m-p  1.6000 8.0000   0.0003 C      1225.465063  0 1.7795  1878 | 3/22
 49 h-m-p  1.6000 8.0000   0.0000 C      1225.465063  0 1.3737  1922 | 3/22
 50 h-m-p  1.6000 8.0000   0.0000 Y      1225.465062  0 1.0862  1966 | 3/22
 51 h-m-p  1.6000 8.0000   0.0000 C      1225.465062  0 1.6000  2010 | 3/22
 52 h-m-p  1.6000 8.0000   0.0000 Y      1225.465062  0 2.9940  2054 | 3/22
 53 h-m-p  1.5814 8.0000   0.0000 -Y     1225.465062  0 0.0722  2099 | 3/22
 54 h-m-p  0.0270 8.0000   0.0000 Y      1225.465062  0 0.0067  2143
Out..
lnL  = -1225.465062
2144 lfun, 6432 eigenQcodon, 81472 P(t)

Time used:  0:34


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
initial w for M2:NSpselection reset.

    0.004212    0.000000    0.004552    0.006294    0.002792    0.000312    0.005103    0.027713    0.009081    0.010000    0.001818    0.005838    0.008421    0.007704    0.014835    0.006606    0.010455    0.014728    0.022483    2.384138    0.862503    0.107410    0.336572    2.818396

ntime & nrate & np:    19     3    24

Bounds (np=24):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 3.886298

np =    24
lnL0 = -1264.012265

Iterating by ming2
Initial: fx=  1264.012265
x=  0.00421  0.00000  0.00455  0.00629  0.00279  0.00031  0.00510  0.02771  0.00908  0.01000  0.00182  0.00584  0.00842  0.00770  0.01484  0.00661  0.01046  0.01473  0.02248  2.38414  0.86250  0.10741  0.33657  2.81840

  1 h-m-p  0.0000 0.0000 491.4095 ++     1264.011410  m 0.0000    29 | 1/24
  2 h-m-p  0.0000 0.0000 428.2494 ++     1263.914947  m 0.0000    56 | 2/24
  3 h-m-p  0.0000 0.0001 146.9791 CCCC   1263.803054  3 0.0000    89 | 2/24
  4 h-m-p  0.0000 0.0004  52.4256 CCC    1263.746745  2 0.0001   120 | 2/24
  5 h-m-p  0.0001 0.0008  44.8745 CYC    1263.709351  2 0.0001   150 | 2/24
  6 h-m-p  0.0001 0.0005  53.6513 YCCC   1263.653193  3 0.0001   182 | 2/24
  7 h-m-p  0.0000 0.0004 164.6089 +YYC   1263.496387  2 0.0001   212 | 2/24
  8 h-m-p  0.0000 0.0005 397.8353 +CYCCC  1262.663706  4 0.0002   247 | 2/24
  9 h-m-p  0.0000 0.0002 1506.4049 +YYCYC  1260.522114  4 0.0001   280 | 2/24
 10 h-m-p  0.0000 0.0000 11235.0166 ++     1258.758240  m 0.0000   307 | 3/24
 11 h-m-p  0.0000 0.0002 1151.0436 CCC    1258.741348  2 0.0000   338 | 3/24
 12 h-m-p  0.0002 0.0017  72.8650 CCC    1258.700599  2 0.0002   369 | 3/24
 13 h-m-p  0.0002 0.0009  31.2781 CYCCC  1258.541816  4 0.0003   403 | 3/24
 14 h-m-p  0.0001 0.0004  65.9793 CYCCC  1258.041356  4 0.0002   437 | 3/24
 15 h-m-p  0.0000 0.0002 177.3960 YCCCC  1256.846940  4 0.0001   471 | 3/24
 16 h-m-p  0.0000 0.0001 212.1655 CCCC   1256.607955  3 0.0000   504 | 3/24
 17 h-m-p  0.0001 0.0005  78.6206 YCCC   1256.328778  3 0.0001   536 | 3/24
 18 h-m-p  0.0001 0.0007  39.8808 YCCC   1256.272986  3 0.0001   568 | 3/24
 19 h-m-p  0.0003 0.0474  12.3564 +++YCYCCCC  1254.989041  6 0.0240   608 | 3/24
 20 h-m-p  0.0001 0.0004 5639.4182 ++     1248.075341  m 0.0004   635 | 4/24
 21 h-m-p  0.2692 1.3461   3.6893 YYYCC  1244.748785  4 0.3073   667 | 4/24
 22 h-m-p  0.4027 6.0751   2.8153 YYCCC  1242.037099  4 0.6378   700 | 4/24
 23 h-m-p  0.5639 2.8197   2.0837 CCC    1241.121844  2 0.6216   731 | 4/24
 24 h-m-p  0.9949 4.9747   0.3651 ----------------..  | 4/24
 25 h-m-p  0.0000 0.0002 163.0523 +YC    1240.716862  1 0.0000   821 | 4/24
 26 h-m-p  0.0000 0.0002  93.6154 CCCC   1240.569576  3 0.0000   854 | 4/24
 27 h-m-p  0.0001 0.0005  41.3711 YC     1240.542072  1 0.0000   882 | 4/24
 28 h-m-p  0.0001 0.0010  20.2293 YC     1240.533020  1 0.0001   910 | 4/24
 29 h-m-p  0.0000 0.0017  28.8325 +YC    1240.513729  1 0.0001   939 | 4/24
 30 h-m-p  0.0001 0.0028  49.8357 YCC    1240.487927  2 0.0001   969 | 4/24
 31 h-m-p  0.0000 0.0008 131.1218 +YYC   1240.396989  2 0.0001   999 | 4/24
 32 h-m-p  0.0000 0.0004 385.1819 +YYYYYYC  1240.005529  6 0.0002  1033 | 4/24
 33 h-m-p  0.0000 0.0007 1944.3449 +YCCCC  1236.988375  4 0.0003  1068 | 4/24
 34 h-m-p  0.0000 0.0002 9771.1860 +YCCC  1232.526164  3 0.0001  1101 | 4/24
 35 h-m-p  0.0000 0.0001 12716.9791 YCCC   1230.051617  3 0.0000  1133 | 4/24
 36 h-m-p  0.0000 0.0001 2737.7445 CYCCC  1229.548881  4 0.0000  1167 | 4/24
 37 h-m-p  0.0001 0.0005 329.1833 YYCC   1229.417209  3 0.0001  1198 | 4/24
 38 h-m-p  0.0000 0.0002 231.0169 YCC    1229.389600  2 0.0000  1228 | 4/24
 39 h-m-p  0.0008 0.0042   4.9407 -YC    1229.389329  1 0.0000  1257 | 4/24
 40 h-m-p  0.0001 0.0122   1.6863 YC     1229.389262  1 0.0000  1285 | 4/24
 41 h-m-p  0.0001 0.0271   1.6381 +Y     1229.389075  0 0.0002  1313 | 4/24
 42 h-m-p  0.0003 0.1746   6.2791 +++YCCC  1229.208541  3 0.0433  1348 | 4/24
 43 h-m-p  0.0000 0.0005 5544.7450 +YCCCCC  1228.310768  5 0.0002  1385 | 4/24
 44 h-m-p  0.3486 1.7430   3.3595 CYCCC  1226.981073  4 0.7518  1420 | 4/24
 45 h-m-p  0.1373 0.6863   4.8533 CYCCCC  1226.345723  5 0.2196  1456 | 4/24
 46 h-m-p  1.2690 6.3450   0.6607 YCCCC  1225.625930  4 0.7145  1490 | 4/24
 47 h-m-p  1.1081 6.4970   0.4260 YYC    1225.479036  2 0.8815  1539 | 4/24
 48 h-m-p  1.6000 8.0000   0.0349 YC     1225.466994  1 0.7724  1587 | 3/24
 49 h-m-p  0.2709 8.0000   0.0994 +YC    1225.462377  1 0.6850  1636 | 3/24
 50 h-m-p  1.6000 8.0000   0.0330 CC     1225.459652  1 1.8445  1686 | 3/24
 51 h-m-p  1.4381 8.0000   0.0423 CC     1225.457852  1 1.9650  1736 | 3/24
 52 h-m-p  1.6000 8.0000   0.0170 YC     1225.457499  1 1.0146  1785 | 3/24
 53 h-m-p  1.6000 8.0000   0.0027 Y      1225.457474  0 1.0337  1833 | 3/24
 54 h-m-p  1.6000 8.0000   0.0008 C      1225.457473  0 1.5138  1881 | 3/24
 55 h-m-p  1.0961 8.0000   0.0011 ++     1225.457465  m 8.0000  1929 | 3/24
 56 h-m-p  0.1556 8.0000   0.0577 ++C    1225.457399  0 2.5060  1979 | 3/24
 57 h-m-p  1.3566 8.0000   0.1067 C      1225.457288  0 1.5751  2027 | 3/24
 58 h-m-p  0.3752 8.0000   0.4478 Y      1225.457193  0 0.3752  2075 | 3/24
 59 h-m-p  1.6000 8.0000   0.0792 Y      1225.457072  0 1.2791  2123 | 3/24
 60 h-m-p  1.3581 8.0000   0.0746 YC     1225.456989  1 2.4693  2172 | 3/24
 61 h-m-p  1.6000 8.0000   0.0652 YC     1225.456925  1 0.8602  2221 | 3/24
 62 h-m-p  0.2577 8.0000   0.2177 +C     1225.456836  0 1.0306  2270 | 3/24
 63 h-m-p  1.1001 8.0000   0.2039 Y      1225.456775  0 1.1001  2318 | 3/24
 64 h-m-p  1.6000 8.0000   0.0320 YC     1225.456728  1 0.8418  2367 | 3/24
 65 h-m-p  0.1497 8.0000   0.1800 ++Y    1225.456652  0 1.6053  2417 | 3/24
 66 h-m-p  1.5017 8.0000   0.1924 C      1225.456602  0 1.5017  2465 | 3/24
 67 h-m-p  1.6000 8.0000   0.0945 YC     1225.456567  1 0.8595  2514 | 3/24
 68 h-m-p  0.2646 8.0000   0.3069 +C     1225.456518  0 1.0583  2563 | 3/24
 69 h-m-p  1.4830 8.0000   0.2190 Y      1225.456495  0 1.4830  2611 | 3/24
 70 h-m-p  1.6000 8.0000   0.0645 Y      1225.456474  0 0.9869  2659 | 3/24
 71 h-m-p  0.2584 8.0000   0.2463 +C     1225.456444  0 1.5724  2708 | 3/24
 72 h-m-p  1.3897 8.0000   0.2787 C      1225.456430  0 1.3897  2756 | 3/24
 73 h-m-p  1.6000 8.0000   0.1851 C      1225.456415  0 1.6000  2804 | 3/24
 74 h-m-p  0.5830 8.0000   0.5080 C      1225.456402  0 0.8547  2852 | 3/24
 75 h-m-p  1.3345 8.0000   0.3254 C      1225.456397  0 1.3345  2900 | 3/24
 76 h-m-p  1.6000 8.0000   0.1247 C      1225.456392  0 1.9322  2948 | 3/24
 77 h-m-p  0.6123 8.0000   0.3935 +Y     1225.456387  0 1.6839  2997 | 3/24
 78 h-m-p  1.6000 8.0000   0.2570 +Y     1225.456383  0 4.4557  3046 | 3/24
 79 h-m-p  1.6000 8.0000   0.3583 C      1225.456382  0 1.3213  3094 | 3/24
 80 h-m-p  1.6000 8.0000   0.1779 Y      1225.456381  0 1.2069  3142 | 3/24
 81 h-m-p  0.5826 8.0000   0.3685 +Y     1225.456381  0 3.9329  3191 | 3/24
 82 h-m-p  1.6000 8.0000   0.2340 C      1225.456381  0 1.6000  3239 | 3/24
 83 h-m-p  1.0459 8.0000   0.3580 +Y     1225.456381  0 3.3286  3288 | 3/24
 84 h-m-p  1.6000 8.0000   0.3781 C      1225.456381  0 2.3721  3336 | 3/24
 85 h-m-p  1.6000 8.0000   0.1720 Y      1225.456381  0 0.6952  3384 | 3/24
 86 h-m-p  0.1479 8.0000   0.8088 +Y     1225.456381  0 0.4132  3433 | 3/24
 87 h-m-p  0.8477 8.0000   0.3942 C      1225.456381  0 1.0346  3481 | 3/24
 88 h-m-p  0.8519 8.0000   0.4788 +C     1225.456381  0 3.1494  3530 | 3/24
 89 h-m-p  1.6000 8.0000   0.1715 +C     1225.456381  0 6.1102  3579 | 3/24
 90 h-m-p  1.6000 8.0000   0.5464 -----C  1225.456381  0 0.0006  3632 | 3/24
 91 h-m-p  0.0160 8.0000   0.0244 ----C  1225.456381  0 0.0000  3684 | 3/24
 92 h-m-p  0.0160 8.0000   0.0212 --------Y  1225.456381  0 0.0000  3740 | 3/24
 93 h-m-p  0.0160 8.0000   0.6452 -------------..  | 3/24
 94 h-m-p  0.0015 0.7640   0.0199 ----------- | 3/24
 95 h-m-p  0.0015 0.7640   0.0199 -----------
Out..
lnL  = -1225.456381
3914 lfun, 15656 eigenQcodon, 223098 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1238.764259  S = -1215.955456   -14.075063
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  83 patterns   1:36
	did  20 /  83 patterns   1:36
	did  30 /  83 patterns   1:36
	did  40 /  83 patterns   1:36
	did  50 /  83 patterns   1:36
	did  60 /  83 patterns   1:36
	did  70 /  83 patterns   1:36
	did  80 /  83 patterns   1:36
	did  83 /  83 patterns   1:36
Time used:  1:36


Model 3: discrete

TREE #  1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
    0.004450    0.000000    0.004208    0.006145    0.002320    0.000204    0.004535    0.027671    0.008720    0.009314    0.001734    0.004918    0.007642    0.007045    0.013897    0.006532    0.010256    0.014343    0.022677    2.392637    0.335590    0.845675    0.014885    0.038125    0.053731

ntime & nrate & np:    19     4    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.621487

np =    25
lnL0 = -1227.356217

Iterating by ming2
Initial: fx=  1227.356217
x=  0.00445  0.00000  0.00421  0.00615  0.00232  0.00020  0.00453  0.02767  0.00872  0.00931  0.00173  0.00492  0.00764  0.00704  0.01390  0.00653  0.01026  0.01434  0.02268  2.39264  0.33559  0.84567  0.01488  0.03812  0.05373

  1 h-m-p  0.0000 0.0000 483.3147 ++     1227.354738  m 0.0000    55 | 1/25
  2 h-m-p  0.0000 0.0000 457.8488 ++     1227.288911  m 0.0000   108 | 2/25
  3 h-m-p  0.0000 0.0001 185.0290 CCCC   1227.152319  3 0.0000   166 | 2/25
  4 h-m-p  0.0001 0.0005  45.3641 YCC    1227.117239  2 0.0000   220 | 2/25
  5 h-m-p  0.0001 0.0007  27.1782 YC     1227.107435  1 0.0000   272 | 2/25
  6 h-m-p  0.0001 0.0021  14.5744 CC     1227.101435  1 0.0001   325 | 2/25
  7 h-m-p  0.0001 0.0012  19.6919 CC     1227.095150  1 0.0001   378 | 2/25
  8 h-m-p  0.0000 0.0006  32.2082 YC     1227.084639  1 0.0001   430 | 2/25
  9 h-m-p  0.0001 0.0004  41.9535 CC     1227.076503  1 0.0001   483 | 2/25
 10 h-m-p  0.0001 0.0004  36.1413 YC     1227.070622  1 0.0000   535 | 2/25
 11 h-m-p  0.0002 0.0014   9.0518 CC     1227.068817  1 0.0001   588 | 2/25
 12 h-m-p  0.0001 0.0013   8.5481 YC     1227.067655  1 0.0001   640 | 2/25
 13 h-m-p  0.0001 0.0013   7.7362 +YC    1227.064240  1 0.0002   693 | 2/25
 14 h-m-p  0.0000 0.0002  39.3718 ++     1227.049889  m 0.0002   744 | 3/25
 15 h-m-p  0.0000 0.0013  98.0058 CC     1227.029226  1 0.0001   797 | 3/25
 16 h-m-p  0.0001 0.0009 105.5417 CCC    1227.010013  2 0.0001   851 | 3/25
 17 h-m-p  0.0001 0.0012  51.1823 CC     1227.004849  1 0.0000   903 | 3/25
 18 h-m-p  0.0005 0.0241   4.0563 CC     1226.999721  1 0.0006   955 | 3/25
 19 h-m-p  0.0000 0.0017  53.3480 +++    1226.637368  m 0.0017  1006 | 4/25
 20 h-m-p  0.0001 0.0026 896.4330 CC     1226.615062  1 0.0000  1058 | 4/25
 21 h-m-p  0.0439 0.5181   0.4776 YCCC   1226.174695  3 0.0880  1112 | 4/25
 22 h-m-p  0.1602 8.0000   0.2624 ++YYC  1226.061440  2 1.9706  1165 | 4/25
 23 h-m-p  0.9828 8.0000   0.5262 CCCC   1225.886207  3 1.7834  1220 | 4/25
 24 h-m-p  1.6000 8.0000   0.2635 CCC    1225.777915  2 1.6878  1273 | 4/25
 25 h-m-p  1.6000 8.0000   0.1334 CYC    1225.716553  2 1.5044  1325 | 4/25
 26 h-m-p  0.4136 8.0000   0.4851 YCCC   1225.653543  3 0.9681  1379 | 4/25
 27 h-m-p  1.6000 8.0000   0.0961 YC     1225.596521  1 2.6254  1429 | 4/25
 28 h-m-p  1.6000 8.0000   0.0847 YCCC   1225.528373  3 3.2665  1483 | 4/25
 29 h-m-p  1.6000 8.0000   0.1523 CCC    1225.496472  2 2.0653  1536 | 4/25
 30 h-m-p  1.6000 8.0000   0.0763 CC     1225.477319  1 1.4134  1587 | 4/25
 31 h-m-p  0.5096 8.0000   0.2116 +YC    1225.459223  1 1.3225  1638 | 4/25
 32 h-m-p  1.6000 8.0000   0.0359 YC     1225.456656  1 1.2453  1688 | 4/25
 33 h-m-p  1.6000 8.0000   0.0196 YC     1225.456416  1 1.2204  1738 | 4/25
 34 h-m-p  1.6000 8.0000   0.0044 C      1225.456384  0 1.3846  1787 | 4/25
 35 h-m-p  1.6000 8.0000   0.0011 Y      1225.456381  0 1.0906  1836 | 4/25
 36 h-m-p  1.6000 8.0000   0.0002 Y      1225.456381  0 1.1615  1885 | 4/25
 37 h-m-p  1.6000 8.0000   0.0001 C      1225.456381  0 0.5752  1934 | 4/25
 38 h-m-p  1.5918 8.0000   0.0000 -----C  1225.456381  0 0.0005  1988
Out..
lnL  = -1225.456381
1989 lfun, 7956 eigenQcodon, 113373 P(t)

Time used:  2:07


Model 7: beta

TREE #  1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
    0.004258    0.000000    0.005015    0.006394    0.003010    0.000104    0.004575    0.028084    0.009000    0.009253    0.001791    0.005681    0.007635    0.007062    0.014239    0.006819    0.010438    0.014319    0.022794    2.392660    0.637551    1.244267

ntime & nrate & np:    19     1    22

Bounds (np=22):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 8.022649

np =    22
lnL0 = -1241.645976

Iterating by ming2
Initial: fx=  1241.645976
x=  0.00426  0.00000  0.00502  0.00639  0.00301  0.00010  0.00457  0.02808  0.00900  0.00925  0.00179  0.00568  0.00763  0.00706  0.01424  0.00682  0.01044  0.01432  0.02279  2.39266  0.63755  1.24427

  1 h-m-p  0.0000 0.0000 448.6245 ++     1241.644650  m 0.0000    49 | 1/22
  2 h-m-p  0.0000 0.0000 458.6599 ++     1241.613612  m 0.0000    96 | 2/22
  3 h-m-p  0.0000 0.0001 132.6212 CCCC   1241.528009  3 0.0000   148 | 2/22
  4 h-m-p  0.0000 0.0004  47.5359 CCC    1241.487559  2 0.0000   197 | 2/22
  5 h-m-p  0.0001 0.0010  41.6487 CC     1241.447544  1 0.0001   244 | 2/22
  6 h-m-p  0.0001 0.0015  55.6834 +CCC   1241.273466  2 0.0003   294 | 2/22
  7 h-m-p  0.0000 0.0003 457.6499 +YYC   1240.709733  2 0.0001   342 | 2/22
  8 h-m-p  0.0000 0.0004 1446.9963 +CYYCCC  1237.333237  5 0.0003   397 | 2/22
  9 h-m-p  0.0000 0.0000 19423.4747 YCYCCC  1235.708110  5 0.0000   450 | 2/22
 10 h-m-p  0.0000 0.0000 5322.2867 CYCCC  1235.337458  4 0.0000   502 | 2/22
 11 h-m-p  0.0000 0.0001 247.3462 YY     1235.303697  1 0.0000   548 | 2/22
 12 h-m-p  0.0000 0.0002 104.6017 YC     1235.290316  1 0.0000   594 | 2/22
 13 h-m-p  0.0001 0.0006  22.6216 YCC    1235.284212  2 0.0000   642 | 2/22
 14 h-m-p  0.0000 0.0017  29.2917 +YC    1235.266997  1 0.0001   689 | 2/22
 15 h-m-p  0.0001 0.0024  33.8197 CCC    1235.253636  2 0.0001   738 | 2/22
 16 h-m-p  0.0000 0.0013  58.2797 YC     1235.231880  1 0.0001   784 | 2/22
 17 h-m-p  0.0000 0.0020 171.0145 ++CYCCC  1234.650914  4 0.0007   838 | 2/22
 18 h-m-p  0.0001 0.0006 1165.0012 +YYCYCCC  1231.453106  6 0.0005   893 | 2/22
 19 h-m-p  0.0005 0.0025  19.4219 CC     1231.442079  1 0.0002   940 | 2/22
 20 h-m-p  0.0010 0.2644   3.0398 +++YCYCCC  1228.494463  5 0.1603   996 | 2/22
 21 h-m-p  0.1173 0.5863   0.3154 YCCCC  1227.413237  4 0.2879  1048 | 2/22
 22 h-m-p  0.2268 1.5217   0.4003 CYC    1226.773403  2 0.2528  1096 | 2/22
 23 h-m-p  0.3865 5.9192   0.2618 YCCC   1226.436546  3 0.6704  1146 | 2/22
 24 h-m-p  1.0900 5.4501   0.1356 YYC    1226.242260  2 0.9396  1193 | 2/22
 25 h-m-p  1.6000 8.0000   0.0595 CY     1226.162666  1 1.5839  1240 | 2/22
 26 h-m-p  1.6000 8.0000   0.0184 CC     1226.122344  1 1.3331  1287 | 2/22
 27 h-m-p  0.6161 8.0000   0.0399 CC     1226.102278  1 0.8428  1334 | 2/22
 28 h-m-p  1.6000 8.0000   0.0055 CC     1226.084804  1 2.0305  1381 | 2/22
 29 h-m-p  0.2324 8.0000   0.0476 +CC    1226.077789  1 1.2472  1429 | 2/22
 30 h-m-p  1.6000 8.0000   0.0284 CC     1226.071801  1 2.4170  1476 | 2/22
 31 h-m-p  1.6000 8.0000   0.0377 CC     1226.066228  1 2.3628  1523 | 2/22
 32 h-m-p  1.6000 8.0000   0.0435 CC     1226.062671  1 1.7104  1570 | 2/22
 33 h-m-p  1.2060 8.0000   0.0617 +CC    1226.052743  1 4.1932  1618 | 2/22
 34 h-m-p  1.4867 8.0000   0.1740 +CYYC  1225.973099  3 6.8746  1669 | 2/22
 35 h-m-p  0.0617 0.3083   3.1292 YYYYCCCCC  1225.962003  8 0.0713  1726 | 2/22
 36 h-m-p  0.0898 0.4490   1.3696 CCC    1225.914949  2 0.2431  1776 | 2/22
 37 h-m-p  0.9575 4.7876   0.1584 YCCCC  1225.861227  4 1.1967  1828 | 2/22
 38 h-m-p  0.5247 6.8952   0.3612 CYC    1225.854022  2 0.1105  1876 | 2/22
 39 h-m-p  1.6000 8.0000   0.0139 CCC    1225.830102  2 1.9479  1925 | 2/22
 40 h-m-p  0.2577 2.5455   0.1052 +YYYC  1225.823838  3 0.9410  1974 | 2/22
 41 h-m-p  1.6000 8.0000   0.0194 CC     1225.819439  1 0.6124  2021 | 2/22
 42 h-m-p  0.7132 8.0000   0.0167 CC     1225.818609  1 1.1697  2068 | 2/22
 43 h-m-p  1.6000 8.0000   0.0074 C      1225.818505  0 1.8705  2113 | 2/22
 44 h-m-p  1.6000 8.0000   0.0025 C      1225.818482  0 1.5413  2158 | 2/22
 45 h-m-p  1.6000 8.0000   0.0017 C      1225.818470  0 2.0822  2203 | 2/22
 46 h-m-p  1.6000 8.0000   0.0010 C      1225.818470  0 0.4776  2248 | 2/22
 47 h-m-p  1.6000 8.0000   0.0001 Y      1225.818469  0 1.0891  2293 | 2/22
 48 h-m-p  0.7510 8.0000   0.0001 ++     1225.818465  m 8.0000  2338 | 2/22
 49 h-m-p  1.4572 8.0000   0.0008 -----------C  1225.818465  0 0.0000  2394
Out..
lnL  = -1225.818465
2395 lfun, 26345 eigenQcodon, 455050 P(t)

Time used:  4:12


Model 8: beta&w>1

TREE #  1
(1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
initial w for M8:NSbetaw>1 reset.

    0.004438    0.000000    0.004856    0.006791    0.002458    0.000662    0.004286    0.027916    0.008570    0.009279    0.001793    0.005661    0.008264    0.007126    0.014322    0.007033    0.010947    0.014564    0.022912    2.395352    0.900000    0.681712    1.353905    2.843187

ntime & nrate & np:    19     2    24

Bounds (np=24):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 5.862038

np =    24
lnL0 = -1249.969688

Iterating by ming2
Initial: fx=  1249.969688
x=  0.00444  0.00000  0.00486  0.00679  0.00246  0.00066  0.00429  0.02792  0.00857  0.00928  0.00179  0.00566  0.00826  0.00713  0.01432  0.00703  0.01095  0.01456  0.02291  2.39535  0.90000  0.68171  1.35390  2.84319

  1 h-m-p  0.0000 0.0000 479.6739 ++     1249.968076  m 0.0000    53 | 1/24
  2 h-m-p  0.0000 0.0000 425.4109 ++     1249.748026  m 0.0000   104 | 2/24
  3 h-m-p  0.0000 0.0001 291.0466 YCCCC  1249.328658  4 0.0000   161 | 2/24
  4 h-m-p  0.0000 0.0003 178.4633 +CYCCC  1247.599065  4 0.0002   218 | 2/24
  5 h-m-p  0.0000 0.0001 1076.6024 +CC    1245.510542  1 0.0000   270 | 2/24
  6 h-m-p  0.0000 0.0000 2551.0231 ++     1244.620597  m 0.0000   319 | 3/24
  7 h-m-p  0.0000 0.0004 131.9534 YCCC   1244.476433  3 0.0001   373 | 3/24
  8 h-m-p  0.0000 0.0002 216.9844 CCCC   1244.220558  3 0.0001   427 | 3/24
  9 h-m-p  0.0001 0.0003 215.1355 CCC    1243.974352  2 0.0001   479 | 3/24
 10 h-m-p  0.0001 0.0005 171.5386 +YC    1243.237392  1 0.0002   529 | 3/24
 11 h-m-p  0.0000 0.0001 669.1414 +YYCYCC  1242.217186  5 0.0001   585 | 3/24
 12 h-m-p  0.0000 0.0000 1599.6385 +YCYCCC  1241.436266  5 0.0000   642 | 3/24
 13 h-m-p  0.0000 0.0002 240.7596 CCCC   1241.283651  3 0.0000   696 | 3/24
 14 h-m-p  0.0000 0.0002  63.0070 Y      1241.261668  0 0.0000   744 | 3/24
 15 h-m-p  0.0000 0.0004 112.3495 YC     1241.223571  1 0.0000   793 | 3/24
 16 h-m-p  0.0001 0.0009  69.0672 +YCC   1241.134081  2 0.0001   845 | 3/24
 17 h-m-p  0.0001 0.0032 170.6652 ++CYCCCC  1239.130720  5 0.0014   904 | 3/24
 18 h-m-p  0.0000 0.0001 6093.4688 +YYYCCCC  1235.940893  6 0.0000   962 | 3/24
 19 h-m-p  0.0000 0.0002 266.2059 CCCC   1235.846718  3 0.0000  1016 | 3/24
 20 h-m-p  0.0019 0.8085   5.5660 +++YCCC  1231.780217  3 0.2529  1072 | 2/24
 21 h-m-p  0.0001 0.0004 8813.4819 CYCCC  1230.378791  4 0.0001  1127 | 2/24
 22 h-m-p  0.0851 0.4256   3.2816 YCCCC  1228.199872  4 0.1770  1183 | 2/24
 23 h-m-p  0.0208 0.1041   5.4421 +
QuantileBeta(0.15, 0.00500, 3.59844) = 6.617715e-161	2000 rounds
YCCC  1226.934459  3 0.0546  1238 | 2/24
 24 h-m-p  0.4076 2.2192   0.7290 CCC    1226.146743  2 0.4845  1291 | 2/24
 25 h-m-p  0.4002 2.0009   0.6671 YCCC   1225.717894  3 0.8138  1345 | 2/24
 26 h-m-p  0.2140 1.0701   0.5346 YCC    1225.593869  2 0.4609  1397 | 2/24
 27 h-m-p  0.5234 2.6168   0.0931 +
QuantileBeta(0.15, 0.00500, 3.80239) = 6.212430e-161	2000 rounds
YC    1225.523908  1 1.4023  1448 | 2/24
 28 h-m-p  0.2237 1.1184   0.0572 +
QuantileBeta(0.15, 0.00500, 3.80966) = 6.198900e-161	2000 rounds
CC    1225.502567  1 0.7730  1500 | 2/24
 29 h-m-p  0.0824 0.4122   0.0733 +
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds
+     1225.490828  m 0.4122  1549
QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81088) = 6.196633e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81056) = 6.197228e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81072) = 6.196931e-161	2000 rounds
 | 3/24
 30 h-m-p  0.2087 2.9600   0.1440 
QuantileBeta(0.15, 0.00500, 3.80878) = 6.200538e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80296) = 6.211385e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.78318) = 6.248491e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80105) = 6.214945e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.79211) = 6.231673e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80065) = 6.215695e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.79638) = 6.223674e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds
C   1225.469575  2 1.0889  1603
QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.432791e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80075) = 6.215500e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80043) = 6.216098e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.80059) = 6.215799e-161	2000 rounds
 | 3/24
 31 h-m-p  1.6000 8.0000   0.0186 
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.73644) = 6.337963e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78362) = 6.247660e-161	2000 rounds
C      1225.464926  0 1.6000  1651
QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.463940e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78471) = 6.245597e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78439) = 6.246199e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.78455) = 6.245898e-161	2000 rounds
 | 3/24
 32 h-m-p  0.6832 6.2041   0.0436 
QuantileBeta(0.15, 0.00500, 3.77399) = 6.265884e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74230) = 6.326615e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75962) = 6.293269e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds
C     1225.461053  1 1.6154  1700
QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.513062e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75973) = 6.293058e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75942) = 6.293667e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.75958) = 6.293363e-161	2000 rounds
 | 3/24
 33 h-m-p  1.6000 8.0000   0.0151 
QuantileBeta(0.15, 0.00500, 3.73731) = 6.336272e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67053) = 6.468572e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74224) = 6.326732e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds
C     1225.459516  1 1.2564  1749
QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.547881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74225) = 6.326701e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74194) = 6.327315e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.74210) = 6.327008e-161	2000 rounds
 | 3/24
 34 h-m-p  0.8702 8.0000   0.0218 
QuantileBeta(0.15, 0.00500, 3.72465) = 6.360953e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67230) = 6.465002e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71741) = 6.375130e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.69486) = 6.419753e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds
C     1225.458499  1 1.2369  1799
QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.597929e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71745) = 6.375056e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71714) = 6.375677e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.71729) = 6.375367e-161	2000 rounds
 | 3/24
 35 h-m-p  1.5263 8.0000   0.0177 
QuantileBeta(0.15, 0.00500, 3.69465) = 6.420162e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62672) = 6.558391e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67553) = 6.458481e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds
C     1225.457416  1 2.8123  1848
QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.683858e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67573) = 6.458081e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67541) = 6.458714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.67557) = 6.458398e-161	2000 rounds
 | 3/24
 36 h-m-p  1.6000 8.0000   0.0136 
QuantileBeta(0.15, 0.00500, 3.65781) = 6.494406e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.60452) = 6.604871e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65212) = 6.506013e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.62832) = 6.555071e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds
C     1225.456791  1 2.1219  1898
QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.733368e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65217) = 6.505917e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65186) = 6.506558e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.65201) = 6.506238e-161	2000 rounds
 | 3/24
 37 h-m-p  1.6000 8.0000   0.0110 
QuantileBeta(0.15, 0.00500, 3.63866) = 6.533680e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.59858) = 6.617410e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63525) = 6.540715e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.61692) = 6.578840e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds
C     1225.456496  1 2.0118  1948
QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.769118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63538) = 6.540458e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63506) = 6.541104e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.63522) = 6.540781e-161	2000 rounds
 | 3/24
 38 h-m-p  1.6000 8.0000   0.0053 
QuantileBeta(0.15, 0.00500, 3.62683) = 6.558163e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.60168) = 6.610865e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62935) = 6.552932e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds
C     1225.456403  1 1.1233  1997
QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.781737e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62949) = 6.552651e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62918) = 6.553299e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62933) = 6.552975e-161	2000 rounds
 | 3/24
 39 h-m-p  1.6000 8.0000   0.0020 
QuantileBeta(0.15, 0.00500, 3.62788) = 6.555993e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62352) = 6.565063e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds
Y      1225.456387  0 1.0899  2045
QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.783864e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62850) = 6.554706e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62819) = 6.555355e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62834) = 6.555030e-161	2000 rounds
 | 3/24
 40 h-m-p  1.6000 8.0000   0.0009 
QuantileBeta(0.15, 0.00500, 3.62777) = 6.556214e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62606) = 6.559766e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds
C      1225.456380  0 1.7457  2093
QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.785200e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62788) = 6.555997e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62756) = 6.556646e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62772) = 6.556321e-161	2000 rounds
 | 3/24
 41 h-m-p  1.6000 8.0000   0.0003 
QuantileBeta(0.15, 0.00500, 3.62811) = 6.555518e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62927) = 6.553108e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds
C      1225.456378  0 1.5859  2141
QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.784376e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555201e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62795) = 6.555849e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555525e-161	2000 rounds
 | 3/24
 42 h-m-p  1.6000 8.0000   0.0002 
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555150e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62883) = 6.554026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds
C      1225.456377  0 1.5656  2189
QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.783996e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62844) = 6.554834e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62812) = 6.555482e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62828) = 6.555158e-161	2000 rounds
 | 3/24
 43 h-m-p  1.6000 8.0000   0.0001 
QuantileBeta(0.15, 0.00500, 3.62823) = 6.555269e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62807) = 6.555603e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds
C      1225.456377  0 1.9197  2237
QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.784135e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62837) = 6.554967e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62806) = 6.555616e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62822) = 6.555292e-161	2000 rounds
 | 3/24
 44 h-m-p  1.6000 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555209e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62837) = 6.554963e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds
Y      1225.456377  0 1.1400  2285
QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.784074e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62840) = 6.554909e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62809) = 6.555557e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62824) = 6.555233e-161	2000 rounds
 | 3/24
 45 h-m-p  1.5959 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62827) = 6.555177e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555219e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds
C      1225.456377  0 0.6348  2333
QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.784051e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554886e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555535e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62825) = 6.555211e-161	2000 rounds
 | 3/24
 46 h-m-p  1.4568 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555193e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
C      1225.456377  0 0.3642  2381
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555530e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
 | 3/24
 47 h-m-p  0.5217 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
C      1225.456377  0 0.5217  2429
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555528e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
 | 3/24
 48 h-m-p  0.8642 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555203e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
C      1225.456377  0 0.7078  2477
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554879e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555528e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
 | 3/24
 49 h-m-p  1.3398 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555210e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds
Y      1225.456377  0 2.9657  2525
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784047e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555531e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds
 | 3/24
 50 h-m-p  1.6000 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
C      1225.456377  0 0.5200  2573
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555531e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
 | 3/24
 51 h-m-p  1.1673 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
Y      1225.456377  0 1.8721  2621
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555530e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
 | 3/24
 52 h-m-p  1.6000 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
C      1225.456377  0 1.6000  2669
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784046e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554882e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555530e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555206e-161	2000 rounds
 | 3/24
 53 h-m-p  1.6000 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555203e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555203e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
Y     1225.456377  0 4.3478  2718
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555528e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
 | 3/24
 54 h-m-p  1.2754 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555205e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
C      1225.456377  0 0.3189  2766
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555529e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
 | 3/24
 55 h-m-p  0.4181 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
C      1225.456377  0 0.4181  2814
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.784044e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62841) = 6.554880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62810) = 6.555529e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
 | 3/24
 56 h-m-p  0.5645 8.0000   0.0000 
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds
C    1225.456377  0 0.0088  2864
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

Out..
lnL  = -1225.456377
2865 lfun, 34380 eigenQcodon, 598785 P(t)

QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1239.987903  S = -1215.955465   -15.973356
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  83 patterns   7:24
	did  20 /  83 patterns   7:24
	did  30 /  83 patterns   7:24
	did  40 /  83 patterns   7:24
	did  50 /  83 patterns   7:25
	did  60 /  83 patterns   7:25
	did  70 /  83 patterns   7:25
	did  80 /  83 patterns   7:25
	did  83 /  83 patterns   7:25
QuantileBeta(0.15, 0.00500, 3.62826) = 6.555204e-161	2000 rounds

Time used:  7:25
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=248 

D_melanogaster_14-3-3zeta-PF   MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_sechellia_14-3-3zeta-PF      MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_simulans_14-3-3zeta-PF       MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_yakuba_14-3-3zeta-PF         MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_erecta_14-3-3zeta-PF         MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_takahashii_14-3-3zeta-PF     MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_biarmipes_14-3-3zeta-PF      MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_suzukii_14-3-3zeta-PF        MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_eugracilis_14-3-3zeta-PF     MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_ficusphila_14-3-3zeta-PF     MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_rhopaloa_14-3-3zeta-PF       MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_elegans_14-3-3zeta-PF        MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
                               **************************************************

D_melanogaster_14-3-3zeta-PF   YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_sechellia_14-3-3zeta-PF      YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_simulans_14-3-3zeta-PF       YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_yakuba_14-3-3zeta-PF         YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_erecta_14-3-3zeta-PF         YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_takahashii_14-3-3zeta-PF     YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_biarmipes_14-3-3zeta-PF      YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_suzukii_14-3-3zeta-PF        YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_eugracilis_14-3-3zeta-PF     YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_ficusphila_14-3-3zeta-PF     YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_rhopaloa_14-3-3zeta-PF       YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_elegans_14-3-3zeta-PF        YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
                               **************************************************

D_melanogaster_14-3-3zeta-PF   LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_sechellia_14-3-3zeta-PF      LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_simulans_14-3-3zeta-PF       LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_yakuba_14-3-3zeta-PF         LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_erecta_14-3-3zeta-PF         LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_takahashii_14-3-3zeta-PF     LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_biarmipes_14-3-3zeta-PF      LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_suzukii_14-3-3zeta-PF        LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_eugracilis_14-3-3zeta-PF     LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_ficusphila_14-3-3zeta-PF     LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_rhopaloa_14-3-3zeta-PF       LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_elegans_14-3-3zeta-PF        LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
                               **************************************************

D_melanogaster_14-3-3zeta-PF   AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_sechellia_14-3-3zeta-PF      AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_simulans_14-3-3zeta-PF       AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_yakuba_14-3-3zeta-PF         AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_erecta_14-3-3zeta-PF         AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_takahashii_14-3-3zeta-PF     AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_biarmipes_14-3-3zeta-PF      AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_suzukii_14-3-3zeta-PF        AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_eugracilis_14-3-3zeta-PF     AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_ficusphila_14-3-3zeta-PF     AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_rhopaloa_14-3-3zeta-PF       AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_elegans_14-3-3zeta-PF        AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
                               **************************************************

D_melanogaster_14-3-3zeta-PF   DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_sechellia_14-3-3zeta-PF      DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_simulans_14-3-3zeta-PF       DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_yakuba_14-3-3zeta-PF         DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_erecta_14-3-3zeta-PF         DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_takahashii_14-3-3zeta-PF     DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_biarmipes_14-3-3zeta-PF      DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_suzukii_14-3-3zeta-PF        DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_eugracilis_14-3-3zeta-PF     DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_ficusphila_14-3-3zeta-PF     DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_rhopaloa_14-3-3zeta-PF       DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_elegans_14-3-3zeta-PF        DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
                               **********************************:***  ********



>D_melanogaster_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>D_sechellia_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>D_simulans_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>D_yakuba_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>D_erecta_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>D_takahashii_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>D_biarmipes_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>D_suzukii_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>D_eugracilis_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
>D_ficusphila_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>D_rhopaloa_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>D_elegans_14-3-3zeta-PF
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>D_melanogaster_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>D_sechellia_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>D_simulans_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>D_yakuba_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>D_erecta_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>D_takahashii_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>D_biarmipes_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>D_suzukii_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>D_eugracilis_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>D_ficusphila_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>D_rhopaloa_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>D_elegans_14-3-3zeta-PF
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
#NEXUS

[ID: 6225957245]
begin taxa;
	dimensions ntax=12;
	taxlabels
		D_melanogaster_14-3-3zeta-PF
		D_sechellia_14-3-3zeta-PF
		D_simulans_14-3-3zeta-PF
		D_yakuba_14-3-3zeta-PF
		D_erecta_14-3-3zeta-PF
		D_takahashii_14-3-3zeta-PF
		D_biarmipes_14-3-3zeta-PF
		D_suzukii_14-3-3zeta-PF
		D_eugracilis_14-3-3zeta-PF
		D_ficusphila_14-3-3zeta-PF
		D_rhopaloa_14-3-3zeta-PF
		D_elegans_14-3-3zeta-PF
		;
end;
begin trees;
	translate
		1	D_melanogaster_14-3-3zeta-PF,
		2	D_sechellia_14-3-3zeta-PF,
		3	D_simulans_14-3-3zeta-PF,
		4	D_yakuba_14-3-3zeta-PF,
		5	D_erecta_14-3-3zeta-PF,
		6	D_takahashii_14-3-3zeta-PF,
		7	D_biarmipes_14-3-3zeta-PF,
		8	D_suzukii_14-3-3zeta-PF,
		9	D_eugracilis_14-3-3zeta-PF,
		10	D_ficusphila_14-3-3zeta-PF,
		11	D_rhopaloa_14-3-3zeta-PF,
		12	D_elegans_14-3-3zeta-PF
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.01327324,2:0.005635917,3:0.01328236,((4:0.006259317,5:0.01379816)0.645:0.01677952,((((6:0.02154193,8:0.01719851)0.641:0.01938097,7:0.02237133)0.798:0.030258,10:0.04073566,(11:0.04296512,12:0.04264341)0.503:0.01797)0.602:0.02884072,9:0.08098087)1.000:0.1268889)0.627:0.01890439);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.01327324,2:0.005635917,3:0.01328236,((4:0.006259317,5:0.01379816):0.01677952,((((6:0.02154193,8:0.01719851):0.01938097,7:0.02237133):0.030258,10:0.04073566,(11:0.04296512,12:0.04264341):0.01797):0.02884072,9:0.08098087):0.1268889):0.01890439);
end;
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1309.54         -1349.51
2      -1309.56         -1346.69
--------------------------------------
TOTAL    -1309.55         -1348.87
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.773171    0.183746    0.131319    1.555523    0.690411    663.42    688.18    1.000
r(A<->C){all}   0.076535    0.002012    0.001789    0.161277    0.069540    462.70    489.46    1.001
r(A<->G){all}   0.184582    0.011134    0.020620    0.390947    0.167742    212.49    231.45    1.002
r(A<->T){all}   0.057489    0.001708    0.000097    0.134465    0.048918    377.68    445.33    1.004
r(C<->G){all}   0.047575    0.001074    0.000793    0.112710    0.040204    431.71    433.92    1.001
r(C<->T){all}   0.612294    0.021431    0.353034    0.902968    0.619312    213.30    224.03    1.002
r(G<->T){all}   0.021526    0.000482    0.000014    0.064504    0.014852    601.31    750.46    1.000
pi(A){all}      0.287230    0.000269    0.256960    0.320471    0.286909   1068.07   1074.44    1.000
pi(C){all}      0.257498    0.000247    0.227803    0.288917    0.257218   1026.46   1151.09    1.000
pi(G){all}      0.257149    0.000252    0.225835    0.287693    0.257058   1164.42   1248.35    1.000
pi(T){all}      0.198123    0.000200    0.170892    0.225212    0.197553   1054.69   1148.15    1.000
alpha{1,2}      0.088992    0.000625    0.051868    0.147356    0.085145    599.85    891.91    1.000
alpha{3}        0.762185    0.259295    0.077749    1.735662    0.631283    704.62    757.91    1.000
pinvar{all}     0.853421    0.001031    0.787751    0.908532    0.857633    767.83    969.32    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/1/14-3-3zeta-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =  12  ls = 248

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   2   1   1   1   1   1 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   3   3   3   3   3   4 | Cys TGT   1   1   1   1   1   1
    TTC   3   4   4   4   4   4 |     TCC   8   8   8   8   8   8 |     TAC  10  10  10  10  10   9 |     TGC   1   1   1   1   1   1
Leu TTA   3   3   3   3   3   3 |     TCA   4   4   4   4   4   4 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   2   2   2   2   2   2 |     TCG   4   4   4   4   4   4 |     TAG   0   0   0   0   0   0 | Trp TGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   3   3   3   3   3   3 | Pro CCT   0   0   0   0   0   1 | His CAT   1   1   1   1   1   1 | Arg CGT   4   4   3   4   4   3
    CTC   6   6   6   6   6   6 |     CCC   2   2   2   2   2   2 |     CAC   1   1   1   1   1   1 |     CGC   2   2   3   2   2   3
    CTA   0   0   0   0   0   1 |     CCA   4   4   4   4   4   3 | Gln CAA   1   1   1   1   1   1 |     CGA   0   0   0   0   0   0
    CTG  10  10  10  10  10   9 |     CCG   0   0   0   0   0   0 |     CAG  11  11  11  11  11  11 |     CGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   4   4   4   4   4   3 | Thr ACT   2   2   2   2   3   1 | Asn AAT   5   5   5   5   5   5 | Ser AGT   0   0   0   0   0   0
    ATC   5   5   5   5   5   6 |     ACC   4   4   4   4   3   5 |     AAC   5   5   5   5   5   5 |     AGC   2   2   2   2   2   2
    ATA   1   1   1   1   1   1 |     ACA   6   6   6   6   6   6 | Lys AAA  11  11  11  11  11  12 | Arg AGA   4   4   4   4   4   4
Met ATG   6   6   6   6   6   6 |     ACG   1   1   1   1   1   1 |     AAG   8   8   8   8   8   7 |     AGG   5   5   5   5   5   5
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   5   5   5   5   5   5 | Ala GCT   6   6   6   6   6   4 | Asp GAT   8   8   8   6   6   7 | Gly GGT   3   3   3   3   3   3
    GTC   7   7   7   7   7   7 |     GCC  11  11  11  11  11  11 |     GAC   9   9   9  11  11  11 |     GGC   4   4   4   4   4   5
    GTA   0   0   0   0   0   0 |     GCA   3   3   3   3   3   4 | Glu GAA   8   8   8   8   8   7 |     GGA   2   2   2   2   2   2
    GTG   3   3   3   3   3   3 |     GCG   4   4   4   4   4   4 |     GAG  18  18  18  18  18  18 |     GGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   1   1   1   1   1 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   4   4   4   4   3   4 | Cys TGT   1   1   1   1   1   1
    TTC   4   4   4   4   4   4 |     TCC   8   8   7   8   9   8 |     TAC   9   9   9   9  10   9 |     TGC   1   1   1   1   1   1
Leu TTA   3   3   3   2   3   3 |     TCA   4   4   4   4   3   4 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   1   2   3   3   2   2 |     TCG   4   4   5   4   4   4 |     TAG   0   0   0   0   0   0 | Trp TGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   3   3   3   3   4   4 | Pro CCT   0   1   0   0   0   0 | His CAT   1   1   1   1   1   1 | Arg CGT   3   3   3   3   3   3
    CTC   7   7   7   7   6   6 |     CCC   2   2   2   2   2   2 |     CAC   1   1   1   1   1   1 |     CGC   3   3   3   3   3   3
    CTA   0   0   1   0   0   1 |     CCA   4   3   4   4   4   4 | Gln CAA   1   2   1   1   2   2 |     CGA   0   0   0   0   0   0
    CTG  10   9   7   9   9   8 |     CCG   0   0   0   0   0   0 |     CAG  11  10  11  11  10  10 |     CGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   3   3   4   4   4   4 | Thr ACT   1   1   2   1   1   1 | Asn AAT   5   5   4   5   5   5 | Ser AGT   0   0   0   0   0   0
    ATC   6   6   5   5   5   5 |     ACC   5   5   4   5   6   4 |     AAC   5   5   6   5   5   5 |     AGC   2   2   2   2   2   2
    ATA   1   1   1   1   1   1 |     ACA   6   6   6   6   5   6 | Lys AAA  12  12  12  12  12  12 | Arg AGA   4   4   4   4   4   4
Met ATG   6   6   6   6   6   6 |     ACG   1   1   1   1   1   1 |     AAG   7   7   7   7   7   7 |     AGG   5   5   5   5   5   5
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   5   5   5   5   5   5 | Ala GCT   4   4   5   4   4   4 | Asp GAT   7   7   9   7   8   8 | Gly GGT   3   3   3   3   3   3
    GTC   7   7   7   8   7   7 |     GCC  11  11  11  11  11  12 |     GAC  11  11   9  11  10  10 |     GGC   5   5   5   5   5   5
    GTA   0   0   0   0   0   0 |     GCA   4   4   3   4   4   4 | Glu GAA   6   6   7   7   7   8 |     GGA   2   2   2   2   2   2
    GTG   3   3   3   2   3   3 |     GCG   4   4   4   4   4   4 |     GAG  19  19  18  18  18  17 |     GGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23790    A:0.39919    G:0.12097
position  3:    T:0.18952    C:0.32258    A:0.18952    G:0.29839
Average         T:0.20161    C:0.24731    A:0.28898    G:0.26210

#2: D_sechellia_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23790    A:0.39919    G:0.12097
position  3:    T:0.18548    C:0.32661    A:0.18952    G:0.29839
Average         T:0.20027    C:0.24866    A:0.28898    G:0.26210

#3: D_simulans_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23790    A:0.39919    G:0.12097
position  3:    T:0.18145    C:0.33065    A:0.18952    G:0.29839
Average         T:0.19892    C:0.25000    A:0.28898    G:0.26210

#4: D_yakuba_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23790    A:0.39919    G:0.12097
position  3:    T:0.17742    C:0.33468    A:0.18952    G:0.29839
Average         T:0.19758    C:0.25134    A:0.28898    G:0.26210

#5: D_erecta_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23790    A:0.39919    G:0.12097
position  3:    T:0.18145    C:0.33065    A:0.18952    G:0.29839
Average         T:0.19892    C:0.25000    A:0.28898    G:0.26210

#6: D_takahashii_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.16935    C:0.34677    A:0.19355    G:0.29032
Average         T:0.19489    C:0.25403    A:0.29032    G:0.26075

#7: D_biarmipes_14-3-3zeta-PF             
position  1:    T:0.16935    C:0.18548    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.16532    C:0.35081    A:0.18952    G:0.29435
Average         T:0.19220    C:0.25672    A:0.28898    G:0.26210

#8: D_suzukii_14-3-3zeta-PF             
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.16935    C:0.35081    A:0.18952    G:0.29032
Average         T:0.19489    C:0.25538    A:0.28898    G:0.26075

#9: D_eugracilis_14-3-3zeta-PF             
position  1:    T:0.17742    C:0.17742    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.18145    C:0.33468    A:0.19355    G:0.29032
Average         T:0.20027    C:0.24866    A:0.29032    G:0.26075

#10: D_ficusphila_14-3-3zeta-PF            
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.16935    C:0.35081    A:0.18952    G:0.29032
Average         T:0.19489    C:0.25538    A:0.28898    G:0.26075

#11: D_rhopaloa_14-3-3zeta-PF            
position  1:    T:0.17339    C:0.18145    A:0.27823    G:0.36694
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.17339    C:0.35081    A:0.18952    G:0.28629
Average         T:0.19624    C:0.25538    A:0.28898    G:0.25941

#12: D_elegans_14-3-3zeta-PF            
position  1:    T:0.17339    C:0.18145    A:0.27419    G:0.37097
position  2:    T:0.24194    C:0.23387    A:0.39919    G:0.12500
position  3:    T:0.17742    C:0.33871    A:0.20565    G:0.27823
Average         T:0.19758    C:0.25134    A:0.29301    G:0.25806

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      13 | Ser S TCT       0 | Tyr Y TAT      42 | Cys C TGT      12
      TTC      47 |       TCC      96 |       TAC     114 |       TGC      12
Leu L TTA      35 |       TCA      47 | *** * TAA       0 | *** * TGA       0
      TTG      25 |       TCG      49 |       TAG       0 | Trp W TGG      24
------------------------------------------------------------------------------
Leu L CTT      38 | Pro P CCT       2 | His H CAT      12 | Arg R CGT      40
      CTC      76 |       CCC      24 |       CAC      12 |       CGC      32
      CTA       3 |       CCA      46 | Gln Q CAA      15 |       CGA       0
      CTG     111 |       CCG       0 |       CAG     129 |       CGG       0
------------------------------------------------------------------------------
Ile I ATT      45 | Thr T ACT      19 | Asn N AAT      59 | Ser S AGT       0
      ATC      63 |       ACC      53 |       AAC      61 |       AGC      24
      ATA      12 |       ACA      71 | Lys K AAA     139 | Arg R AGA      48
Met M ATG      72 |       ACG      12 |       AAG      89 |       AGG      60
------------------------------------------------------------------------------
Val V GTT      60 | Ala A GCT      59 | Asp D GAT      89 | Gly G GGT      36
      GTC      85 |       GCC     133 |       GAC     122 |       GGC      55
      GTA       0 |       GCA      42 | Glu E GAA      88 |       GGA      24
      GTG      35 |       GCG      48 |       GAG     217 |       GGG       0
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.17339    C:0.18145    A:0.27789    G:0.36727
position  2:    T:0.24194    C:0.23555    A:0.39919    G:0.12332
position  3:    T:0.17675    C:0.33905    A:0.19153    G:0.29267
Average         T:0.19736    C:0.25202    A:0.28954    G:0.26109


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_14-3-3zeta-PF                  
D_sechellia_14-3-3zeta-PF                  -1.0000 (0.0000 0.0058)
D_simulans_14-3-3zeta-PF                  -1.0000 (0.0000 0.0117)-1.0000 (0.0000 0.0058)
D_yakuba_14-3-3zeta-PF                  -1.0000 (0.0000 0.0176)-1.0000 (0.0000 0.0117)-1.0000 (0.0000 0.0176)
D_erecta_14-3-3zeta-PF                  -1.0000 (0.0000 0.0236)-1.0000 (0.0000 0.0176)-1.0000 (0.0000 0.0236)-1.0000 (0.0000 0.0058)
D_takahashii_14-3-3zeta-PF                   0.0574 (0.0044 0.0764) 0.0627 (0.0044 0.0700) 0.0574 (0.0044 0.0764) 0.0765 (0.0044 0.0573) 0.0689 (0.0044 0.0636)
D_biarmipes_14-3-3zeta-PF                   0.0575 (0.0044 0.0763) 0.0627 (0.0044 0.0699) 0.0575 (0.0044 0.0763) 0.0766 (0.0044 0.0573) 0.0690 (0.0044 0.0636)-1.0000 (0.0000 0.0236)
D_suzukii_14-3-3zeta-PF                   0.0529 (0.0044 0.0829) 0.0573 (0.0044 0.0764) 0.0529 (0.0044 0.0829) 0.0688 (0.0044 0.0637) 0.0626 (0.0044 0.0700)-1.0000 (0.0000 0.0177)-1.0000 (0.0000 0.0176)
D_eugracilis_14-3-3zeta-PF                   0.0625 (0.0044 0.0702) 0.0687 (0.0044 0.0638) 0.0625 (0.0044 0.0702) 0.0687 (0.0044 0.0638) 0.0625 (0.0044 0.0702)-1.0000 (0.0000 0.0670)-1.0000 (0.0000 0.0669)-1.0000 (0.0000 0.0735)
D_ficusphila_14-3-3zeta-PF                  0.0626 (0.0044 0.0701) 0.0688 (0.0044 0.0637) 0.0626 (0.0044 0.0701) 0.0688 (0.0044 0.0637) 0.0626 (0.0044 0.0701)-1.0000 (0.0000 0.0419)-1.0000 (0.0000 0.0418)-1.0000 (0.0000 0.0481)-1.0000 (0.0000 0.0607)
D_rhopaloa_14-3-3zeta-PF                  0.0625 (0.0044 0.0701) 0.0688 (0.0044 0.0637) 0.0625 (0.0044 0.0701) 0.0688 (0.0044 0.0637) 0.0625 (0.0044 0.0701)-1.0000 (0.0000 0.0481)-1.0000 (0.0000 0.0542)-1.0000 (0.0000 0.0481)-1.0000 (0.0000 0.0735)-1.0000 (0.0000 0.0481)
D_elegans_14-3-3zeta-PF                  0.0804 (0.0061 0.0764) 0.0877 (0.0061 0.0700) 0.0804 (0.0061 0.0764) 0.0877 (0.0061 0.0700) 0.0804 (0.0061 0.0764) 0.0418 (0.0018 0.0419) 0.0365 (0.0018 0.0480) 0.0418 (0.0017 0.0419) 0.0261 (0.0017 0.0670) 0.0417 (0.0017 0.0419) 0.0589 (0.0017 0.0297)


Model 0: one-ratio


TREE #  1:  (1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
lnL(ntime: 19  np: 21):  -1226.517883      +0.000000
  13..1    13..2    13..3    13..14   14..15   15..4    15..5    14..16   16..17   17..18   18..19   19..6    19..8    18..7    17..10   17..20   20..11   20..12   16..9  
 0.004047 0.000004 0.004050 0.003950 0.004188 0.000004 0.004075 0.029827 0.008245 0.010521 0.004181 0.006424 0.005916 0.005937 0.012364 0.008214 0.012459 0.012286 0.020720 2.353508 0.029770

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.15741

(1: 0.004047, 2: 0.000004, 3: 0.004050, ((4: 0.000004, 5: 0.004075): 0.004188, ((((6: 0.006424, 8: 0.005916): 0.004181, 7: 0.005937): 0.010521, 10: 0.012364, (11: 0.012459, 12: 0.012286): 0.008214): 0.008245, 9: 0.020720): 0.029827): 0.003950);

(D_melanogaster_14-3-3zeta-PF: 0.004047, D_sechellia_14-3-3zeta-PF: 0.000004, D_simulans_14-3-3zeta-PF: 0.004050, ((D_yakuba_14-3-3zeta-PF: 0.000004, D_erecta_14-3-3zeta-PF: 0.004075): 0.004188, ((((D_takahashii_14-3-3zeta-PF: 0.006424, D_suzukii_14-3-3zeta-PF: 0.005916): 0.004181, D_biarmipes_14-3-3zeta-PF: 0.005937): 0.010521, D_ficusphila_14-3-3zeta-PF: 0.012364, (D_rhopaloa_14-3-3zeta-PF: 0.012459, D_elegans_14-3-3zeta-PF: 0.012286): 0.008214): 0.008245, D_eugracilis_14-3-3zeta-PF: 0.020720): 0.029827): 0.003950);

Detailed output identifying parameters

kappa (ts/tv) =  2.35351

omega (dN/dS) =  0.02977

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1      0.004   558.4   185.6  0.0298  0.0001  0.0050   0.1   0.9
  13..2      0.000   558.4   185.6  0.0298  0.0000  0.0000   0.0   0.0
  13..3      0.004   558.4   185.6  0.0298  0.0001  0.0050   0.1   0.9
  13..14     0.004   558.4   185.6  0.0298  0.0001  0.0048   0.1   0.9
  14..15     0.004   558.4   185.6  0.0298  0.0002  0.0051   0.1   1.0
  15..4      0.000   558.4   185.6  0.0298  0.0000  0.0000   0.0   0.0
  15..5      0.004   558.4   185.6  0.0298  0.0001  0.0050   0.1   0.9
  14..16     0.030   558.4   185.6  0.0298  0.0011  0.0366   0.6   6.8
  16..17     0.008   558.4   185.6  0.0298  0.0003  0.0101   0.2   1.9
  17..18     0.011   558.4   185.6  0.0298  0.0004  0.0129   0.2   2.4
  18..19     0.004   558.4   185.6  0.0298  0.0002  0.0051   0.1   1.0
  19..6      0.006   558.4   185.6  0.0298  0.0002  0.0079   0.1   1.5
  19..8      0.006   558.4   185.6  0.0298  0.0002  0.0073   0.1   1.3
  18..7      0.006   558.4   185.6  0.0298  0.0002  0.0073   0.1   1.4
  17..10     0.012   558.4   185.6  0.0298  0.0005  0.0152   0.3   2.8
  17..20     0.008   558.4   185.6  0.0298  0.0003  0.0101   0.2   1.9
  20..11     0.012   558.4   185.6  0.0298  0.0005  0.0153   0.3   2.8
  20..12     0.012   558.4   185.6  0.0298  0.0004  0.0151   0.3   2.8
  16..9      0.021   558.4   185.6  0.0298  0.0008  0.0254   0.4   4.7

tree length for dN:       0.0057
tree length for dS:       0.1930


Time used:  0:12


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
lnL(ntime: 19  np: 22):  -1225.465062      +0.000000
  13..1    13..2    13..3    13..14   14..15   15..4    15..5    14..16   16..17   17..18   18..19   19..6    19..8    18..7    17..10   17..20   20..11   20..12   16..9  
 0.004064 0.000004 0.004067 0.003971 0.004206 0.000004 0.004104 0.029854 0.008251 0.010500 0.004170 0.006410 0.005902 0.005924 0.012340 0.008223 0.012459 0.012233 0.020705 2.384138 0.963651 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.15739

(1: 0.004064, 2: 0.000004, 3: 0.004067, ((4: 0.000004, 5: 0.004104): 0.004206, ((((6: 0.006410, 8: 0.005902): 0.004170, 7: 0.005924): 0.010500, 10: 0.012340, (11: 0.012459, 12: 0.012233): 0.008223): 0.008251, 9: 0.020705): 0.029854): 0.003971);

(D_melanogaster_14-3-3zeta-PF: 0.004064, D_sechellia_14-3-3zeta-PF: 0.000004, D_simulans_14-3-3zeta-PF: 0.004067, ((D_yakuba_14-3-3zeta-PF: 0.000004, D_erecta_14-3-3zeta-PF: 0.004104): 0.004206, ((((D_takahashii_14-3-3zeta-PF: 0.006410, D_suzukii_14-3-3zeta-PF: 0.005902): 0.004170, D_biarmipes_14-3-3zeta-PF: 0.005924): 0.010500, D_ficusphila_14-3-3zeta-PF: 0.012340, (D_rhopaloa_14-3-3zeta-PF: 0.012459, D_elegans_14-3-3zeta-PF: 0.012233): 0.008223): 0.008251, D_eugracilis_14-3-3zeta-PF: 0.020705): 0.029854): 0.003971);

Detailed output identifying parameters

kappa (ts/tv) =  2.38414


dN/dS (w) for site classes (K=2)

p:   0.96365  0.03635
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.004    557.9    186.1   0.0363   0.0002   0.0049    0.1    0.9
  13..2       0.000    557.9    186.1   0.0363   0.0000   0.0000    0.0    0.0
  13..3       0.004    557.9    186.1   0.0363   0.0002   0.0049    0.1    0.9
  13..14      0.004    557.9    186.1   0.0363   0.0002   0.0048    0.1    0.9
  14..15      0.004    557.9    186.1   0.0363   0.0002   0.0051    0.1    0.9
  15..4       0.000    557.9    186.1   0.0363   0.0000   0.0000    0.0    0.0
  15..5       0.004    557.9    186.1   0.0363   0.0002   0.0049    0.1    0.9
  14..16      0.030    557.9    186.1   0.0363   0.0013   0.0359    0.7    6.7
  16..17      0.008    557.9    186.1   0.0363   0.0004   0.0099    0.2    1.8
  17..18      0.011    557.9    186.1   0.0363   0.0005   0.0126    0.3    2.3
  18..19      0.004    557.9    186.1   0.0363   0.0002   0.0050    0.1    0.9
  19..6       0.006    557.9    186.1   0.0363   0.0003   0.0077    0.2    1.4
  19..8       0.006    557.9    186.1   0.0363   0.0003   0.0071    0.1    1.3
  18..7       0.006    557.9    186.1   0.0363   0.0003   0.0071    0.1    1.3
  17..10      0.012    557.9    186.1   0.0363   0.0005   0.0148    0.3    2.8
  17..20      0.008    557.9    186.1   0.0363   0.0004   0.0099    0.2    1.8
  20..11      0.012    557.9    186.1   0.0363   0.0005   0.0150    0.3    2.8
  20..12      0.012    557.9    186.1   0.0363   0.0005   0.0147    0.3    2.7
  16..9       0.021    557.9    186.1   0.0363   0.0009   0.0249    0.5    4.6


Time used:  0:34


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
check convergence..
lnL(ntime: 19  np: 24):  -1225.456381      +0.000000
  13..1    13..2    13..3    13..14   14..15   15..4    15..5    14..16   16..17   17..18   18..19   19..6    19..8    18..7    17..10   17..20   20..11   20..12   16..9  
 0.004066 0.000004 0.004069 0.003973 0.004209 0.000004 0.004108 0.029853 0.008253 0.010495 0.004168 0.006407 0.005900 0.005921 0.012334 0.008224 0.012457 0.012223 0.020702 2.392637 0.967552 0.000000 0.000001 1.163958

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.15737

(1: 0.004066, 2: 0.000004, 3: 0.004069, ((4: 0.000004, 5: 0.004108): 0.004209, ((((6: 0.006407, 8: 0.005900): 0.004168, 7: 0.005921): 0.010495, 10: 0.012334, (11: 0.012457, 12: 0.012223): 0.008224): 0.008253, 9: 0.020702): 0.029853): 0.003973);

(D_melanogaster_14-3-3zeta-PF: 0.004066, D_sechellia_14-3-3zeta-PF: 0.000004, D_simulans_14-3-3zeta-PF: 0.004069, ((D_yakuba_14-3-3zeta-PF: 0.000004, D_erecta_14-3-3zeta-PF: 0.004108): 0.004209, ((((D_takahashii_14-3-3zeta-PF: 0.006407, D_suzukii_14-3-3zeta-PF: 0.005900): 0.004168, D_biarmipes_14-3-3zeta-PF: 0.005921): 0.010495, D_ficusphila_14-3-3zeta-PF: 0.012334, (D_rhopaloa_14-3-3zeta-PF: 0.012457, D_elegans_14-3-3zeta-PF: 0.012223): 0.008224): 0.008253, D_eugracilis_14-3-3zeta-PF: 0.020702): 0.029853): 0.003973);

Detailed output identifying parameters

kappa (ts/tv) =  2.39264


dN/dS (w) for site classes (K=3)

p:   0.96755  0.00000  0.03245
w:   0.00000  1.00000  1.16396

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  13..2       0.000    557.8    186.2   0.0378   0.0000   0.0000    0.0    0.0
  13..3       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  13..14      0.004    557.8    186.2   0.0378   0.0002   0.0048    0.1    0.9
  14..15      0.004    557.8    186.2   0.0378   0.0002   0.0050    0.1    0.9
  15..4       0.000    557.8    186.2   0.0378   0.0000   0.0000    0.0    0.0
  15..5       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  14..16      0.030    557.8    186.2   0.0378   0.0013   0.0357    0.8    6.7
  16..17      0.008    557.8    186.2   0.0378   0.0004   0.0099    0.2    1.8
  17..18      0.010    557.8    186.2   0.0378   0.0005   0.0126    0.3    2.3
  18..19      0.004    557.8    186.2   0.0378   0.0002   0.0050    0.1    0.9
  19..6       0.006    557.8    186.2   0.0378   0.0003   0.0077    0.2    1.4
  19..8       0.006    557.8    186.2   0.0378   0.0003   0.0071    0.1    1.3
  18..7       0.006    557.8    186.2   0.0378   0.0003   0.0071    0.1    1.3
  17..10      0.012    557.8    186.2   0.0378   0.0006   0.0148    0.3    2.7
  17..20      0.008    557.8    186.2   0.0378   0.0004   0.0098    0.2    1.8
  20..11      0.012    557.8    186.2   0.0378   0.0006   0.0149    0.3    2.8
  20..12      0.012    557.8    186.2   0.0378   0.0006   0.0146    0.3    2.7
  16..9       0.021    557.8    186.2   0.0378   0.0009   0.0248    0.5    4.6


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PF)

            Pr(w>1)     post mean +- SE for w

   235 T      1.000**       1.164
   239 E      1.000**       1.164
   240 A      1.000**       1.164


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PF)

            Pr(w>1)     post mean +- SE for w

   239 E      0.579         1.653 +- 1.356



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.626  0.201  0.080  0.038  0.021  0.012  0.008  0.006  0.004  0.003

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.994

sum of density on p0-p1 =   1.000000

Time used:  1:36


Model 3: discrete (3 categories)


TREE #  1:  (1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
lnL(ntime: 19  np: 25):  -1225.456381      +0.000000
  13..1    13..2    13..3    13..14   14..15   15..4    15..5    14..16   16..17   17..18   18..19   19..6    19..8    18..7    17..10   17..20   20..11   20..12   16..9  
 0.004066 0.000004 0.004069 0.003973 0.004209 0.000004 0.004108 0.029853 0.008253 0.010495 0.004168 0.006406 0.005899 0.005921 0.012334 0.008224 0.012457 0.012223 0.020702 2.392660 0.459952 0.507600 0.000001 0.000001 1.163963

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.15737

(1: 0.004066, 2: 0.000004, 3: 0.004069, ((4: 0.000004, 5: 0.004108): 0.004209, ((((6: 0.006406, 8: 0.005899): 0.004168, 7: 0.005921): 0.010495, 10: 0.012334, (11: 0.012457, 12: 0.012223): 0.008224): 0.008253, 9: 0.020702): 0.029853): 0.003973);

(D_melanogaster_14-3-3zeta-PF: 0.004066, D_sechellia_14-3-3zeta-PF: 0.000004, D_simulans_14-3-3zeta-PF: 0.004069, ((D_yakuba_14-3-3zeta-PF: 0.000004, D_erecta_14-3-3zeta-PF: 0.004108): 0.004209, ((((D_takahashii_14-3-3zeta-PF: 0.006406, D_suzukii_14-3-3zeta-PF: 0.005899): 0.004168, D_biarmipes_14-3-3zeta-PF: 0.005921): 0.010495, D_ficusphila_14-3-3zeta-PF: 0.012334, (D_rhopaloa_14-3-3zeta-PF: 0.012457, D_elegans_14-3-3zeta-PF: 0.012223): 0.008224): 0.008253, D_eugracilis_14-3-3zeta-PF: 0.020702): 0.029853): 0.003973);

Detailed output identifying parameters

kappa (ts/tv) =  2.39266


dN/dS (w) for site classes (K=3)

p:   0.45995  0.50760  0.03245
w:   0.00000  0.00000  1.16396

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  13..2       0.000    557.8    186.2   0.0378   0.0000   0.0000    0.0    0.0
  13..3       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  13..14      0.004    557.8    186.2   0.0378   0.0002   0.0048    0.1    0.9
  14..15      0.004    557.8    186.2   0.0378   0.0002   0.0050    0.1    0.9
  15..4       0.000    557.8    186.2   0.0378   0.0000   0.0000    0.0    0.0
  15..5       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  14..16      0.030    557.8    186.2   0.0378   0.0013   0.0357    0.8    6.7
  16..17      0.008    557.8    186.2   0.0378   0.0004   0.0099    0.2    1.8
  17..18      0.010    557.8    186.2   0.0378   0.0005   0.0126    0.3    2.3
  18..19      0.004    557.8    186.2   0.0378   0.0002   0.0050    0.1    0.9
  19..6       0.006    557.8    186.2   0.0378   0.0003   0.0077    0.2    1.4
  19..8       0.006    557.8    186.2   0.0378   0.0003   0.0071    0.1    1.3
  18..7       0.006    557.8    186.2   0.0378   0.0003   0.0071    0.1    1.3
  17..10      0.012    557.8    186.2   0.0378   0.0006   0.0148    0.3    2.7
  17..20      0.008    557.8    186.2   0.0378   0.0004   0.0098    0.2    1.8
  20..11      0.012    557.8    186.2   0.0378   0.0006   0.0149    0.3    2.8
  20..12      0.012    557.8    186.2   0.0378   0.0006   0.0146    0.3    2.7
  16..9       0.021    557.8    186.2   0.0378   0.0009   0.0248    0.5    4.6


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PF)

            Pr(w>1)     post mean +- SE for w

   235 T      1.000**       1.164
   239 E      1.000**       1.164
   240 A      1.000**       1.164


Time used:  2:07


Model 7: beta (10 categories)


TREE #  1:  (1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
lnL(ntime: 19  np: 22):  -1225.818465      +0.000000
  13..1    13..2    13..3    13..14   14..15   15..4    15..5    14..16   16..17   17..18   18..19   19..6    19..8    18..7    17..10   17..20   20..11   20..12   16..9  
 0.004060 0.000004 0.004064 0.003965 0.004199 0.000004 0.004091 0.029880 0.008257 0.010530 0.004182 0.006428 0.005922 0.005944 0.012375 0.008231 0.012478 0.012290 0.020740 2.395352 0.011434 0.236181

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.15765

(1: 0.004060, 2: 0.000004, 3: 0.004064, ((4: 0.000004, 5: 0.004091): 0.004199, ((((6: 0.006428, 8: 0.005922): 0.004182, 7: 0.005944): 0.010530, 10: 0.012375, (11: 0.012478, 12: 0.012290): 0.008231): 0.008257, 9: 0.020740): 0.029880): 0.003965);

(D_melanogaster_14-3-3zeta-PF: 0.004060, D_sechellia_14-3-3zeta-PF: 0.000004, D_simulans_14-3-3zeta-PF: 0.004064, ((D_yakuba_14-3-3zeta-PF: 0.000004, D_erecta_14-3-3zeta-PF: 0.004091): 0.004199, ((((D_takahashii_14-3-3zeta-PF: 0.006428, D_suzukii_14-3-3zeta-PF: 0.005922): 0.004182, D_biarmipes_14-3-3zeta-PF: 0.005944): 0.010530, D_ficusphila_14-3-3zeta-PF: 0.012375, (D_rhopaloa_14-3-3zeta-PF: 0.012478, D_elegans_14-3-3zeta-PF: 0.012290): 0.008231): 0.008257, D_eugracilis_14-3-3zeta-PF: 0.020740): 0.029880): 0.003965);

Detailed output identifying parameters

kappa (ts/tv) =  2.39535

Parameters in M7 (beta):
 p =   0.01143  q =   0.23618


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00003  0.36306

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.004    557.7    186.3   0.0363   0.0002   0.0049    0.1    0.9
  13..2       0.000    557.7    186.3   0.0363   0.0000   0.0000    0.0    0.0
  13..3       0.004    557.7    186.3   0.0363   0.0002   0.0049    0.1    0.9
  13..14      0.004    557.7    186.3   0.0363   0.0002   0.0048    0.1    0.9
  14..15      0.004    557.7    186.3   0.0363   0.0002   0.0050    0.1    0.9
  15..4       0.000    557.7    186.3   0.0363   0.0000   0.0000    0.0    0.0
  15..5       0.004    557.7    186.3   0.0363   0.0002   0.0049    0.1    0.9
  14..16      0.030    557.7    186.3   0.0363   0.0013   0.0359    0.7    6.7
  16..17      0.008    557.7    186.3   0.0363   0.0004   0.0099    0.2    1.8
  17..18      0.011    557.7    186.3   0.0363   0.0005   0.0126    0.3    2.4
  18..19      0.004    557.7    186.3   0.0363   0.0002   0.0050    0.1    0.9
  19..6       0.006    557.7    186.3   0.0363   0.0003   0.0077    0.2    1.4
  19..8       0.006    557.7    186.3   0.0363   0.0003   0.0071    0.1    1.3
  18..7       0.006    557.7    186.3   0.0363   0.0003   0.0071    0.1    1.3
  17..10      0.012    557.7    186.3   0.0363   0.0005   0.0149    0.3    2.8
  17..20      0.008    557.7    186.3   0.0363   0.0004   0.0099    0.2    1.8
  20..11      0.012    557.7    186.3   0.0363   0.0005   0.0150    0.3    2.8
  20..12      0.012    557.7    186.3   0.0363   0.0005   0.0148    0.3    2.7
  16..9       0.021    557.7    186.3   0.0363   0.0009   0.0249    0.5    4.6


Time used:  4:12


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 2, 3, ((4, 5), ((((6, 8), 7), 10, (11, 12)), 9)));   MP score: 37
lnL(ntime: 19  np: 24):  -1225.456377      +0.000000
  13..1    13..2    13..3    13..14   14..15   15..4    15..5    14..16   16..17   17..18   18..19   19..6    19..8    18..7    17..10   17..20   20..11   20..12   16..9  
 0.004066 0.000004 0.004069 0.003973 0.004209 0.000004 0.004108 0.029853 0.008253 0.010495 0.004168 0.006407 0.005899 0.005921 0.012334 0.008224 0.012457 0.012223 0.020702 2.392645 0.967551 0.005000 3.628258 1.163938

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.15737

(1: 0.004066, 2: 0.000004, 3: 0.004069, ((4: 0.000004, 5: 0.004108): 0.004209, ((((6: 0.006407, 8: 0.005899): 0.004168, 7: 0.005921): 0.010495, 10: 0.012334, (11: 0.012457, 12: 0.012223): 0.008224): 0.008253, 9: 0.020702): 0.029853): 0.003973);

(D_melanogaster_14-3-3zeta-PF: 0.004066, D_sechellia_14-3-3zeta-PF: 0.000004, D_simulans_14-3-3zeta-PF: 0.004069, ((D_yakuba_14-3-3zeta-PF: 0.000004, D_erecta_14-3-3zeta-PF: 0.004108): 0.004209, ((((D_takahashii_14-3-3zeta-PF: 0.006407, D_suzukii_14-3-3zeta-PF: 0.005899): 0.004168, D_biarmipes_14-3-3zeta-PF: 0.005921): 0.010495, D_ficusphila_14-3-3zeta-PF: 0.012334, (D_rhopaloa_14-3-3zeta-PF: 0.012457, D_elegans_14-3-3zeta-PF: 0.012223): 0.008224): 0.008253, D_eugracilis_14-3-3zeta-PF: 0.020702): 0.029853): 0.003973);

Detailed output identifying parameters

kappa (ts/tv) =  2.39265

Parameters in M8 (beta&w>1):
  p0 =   0.96755  p =   0.00500 q =   3.62826
 (p1 =   0.03245) w =   1.16394


dN/dS (w) for site classes (K=11)

p:   0.09676  0.09676  0.09676  0.09676  0.09676  0.09676  0.09676  0.09676  0.09676  0.09676  0.03245
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00001  1.16394

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  13..2       0.000    557.8    186.2   0.0378   0.0000   0.0000    0.0    0.0
  13..3       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  13..14      0.004    557.8    186.2   0.0378   0.0002   0.0048    0.1    0.9
  14..15      0.004    557.8    186.2   0.0378   0.0002   0.0050    0.1    0.9
  15..4       0.000    557.8    186.2   0.0378   0.0000   0.0000    0.0    0.0
  15..5       0.004    557.8    186.2   0.0378   0.0002   0.0049    0.1    0.9
  14..16      0.030    557.8    186.2   0.0378   0.0013   0.0357    0.8    6.7
  16..17      0.008    557.8    186.2   0.0378   0.0004   0.0099    0.2    1.8
  17..18      0.010    557.8    186.2   0.0378   0.0005   0.0126    0.3    2.3
  18..19      0.004    557.8    186.2   0.0378   0.0002   0.0050    0.1    0.9
  19..6       0.006    557.8    186.2   0.0378   0.0003   0.0077    0.2    1.4
  19..8       0.006    557.8    186.2   0.0378   0.0003   0.0071    0.1    1.3
  18..7       0.006    557.8    186.2   0.0378   0.0003   0.0071    0.1    1.3
  17..10      0.012    557.8    186.2   0.0378   0.0006   0.0148    0.3    2.7
  17..20      0.008    557.8    186.2   0.0378   0.0004   0.0098    0.2    1.8
  20..11      0.012    557.8    186.2   0.0378   0.0006   0.0149    0.3    2.8
  20..12      0.012    557.8    186.2   0.0378   0.0006   0.0146    0.3    2.7
  16..9       0.021    557.8    186.2   0.0378   0.0009   0.0248    0.5    4.6


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PF)

            Pr(w>1)     post mean +- SE for w

   235 T      1.000**       1.164
   239 E      1.000**       1.164
   240 A      1.000**       1.164


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PF)

            Pr(w>1)     post mean +- SE for w

   239 E      0.663         1.328 +- 0.924



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   0.997  0.003  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.000  0.003  0.015  0.045  0.098  0.175  0.274  0.390
ws:   0.818  0.131  0.032  0.010  0.004  0.002  0.001  0.001  0.000  0.000

Time used:  7:25
Model 1: NearlyNeutral	-1225.465062
Model 2: PositiveSelection	-1225.456381
Model 0: one-ratio	-1226.517883
Model 3: discrete	-1225.456381
Model 7: beta	-1225.818465
Model 8: beta&w>1	-1225.456377


Model 0 vs 1	2.105641999999989

Model 2 vs 1	0.017362000000048283

Model 8 vs 7	0.7241760000001705